BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026H10

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN35778.1|  Plasma membrane ATPase 4                                327   3e-107   Glycine soja [wild soybean]
emb|CAG28306.1|  proton-exporting ATPase                                324   4e-107   Cucumis sativus [cucumbers]
gb|KJB22049.1|  hypothetical protein B456_004G027300                    335   1e-106   Gossypium raimondii
gb|KHG28536.1|  Plasma membrane ATPase 4                                333   4e-106   Gossypium arboreum [tree cotton]
gb|KHG26452.1|  Plasma membrane ATPase 4                                332   9e-106   Gossypium arboreum [tree cotton]
gb|KJB22047.1|  hypothetical protein B456_004G027300                    334   2e-104   Gossypium raimondii
gb|KJB53771.1|  hypothetical protein B456_009G004200                    333   2e-104   Gossypium raimondii
gb|KJB22048.1|  hypothetical protein B456_004G027300                    335   4e-104   Gossypium raimondii
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 331   4e-103   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 331   1e-102   
gb|AFK46374.1|  unknown                                                 312   1e-102   Lotus japonicus
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   330   1e-102   Citrus sinensis [apfelsine]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                330   2e-102   Nicotiana tomentosiformis
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    330   2e-102   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             328   2e-102   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                330   3e-102   Nicotiana sylvestris
gb|KGN62871.1|  hypothetical protein Csa_2G378530                       306   3e-102   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             329   6e-102   Citrus clementina [clementine]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    328   8e-102   Populus euphratica
emb|CDP04837.1|  unnamed protein product                                307   1e-101   Coffea canephora [robusta coffee]
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                328   2e-101   Vitis vinifera
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                327   2e-101   Cucumis melo [Oriental melon]
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           327   3e-101   Glycine max [soybeans]
dbj|BAC77531.1|  plasma membrane H+-ATPase                              327   3e-101   Sesbania rostrata
emb|CAN64375.1|  hypothetical protein VITISV_014422                     327   3e-101   Vitis vinifera
dbj|BAA37150.1|  p-type H+-ATPase                                       326   5e-101   Vicia faba [broad bean]
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            319   8e-101   Gossypium arboreum [tree cotton]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           326   8e-101   
gb|ACE77057.1|  plasma membrane proton pump                             326   9e-101   Cucumis sativus [cucumbers]
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                325   1e-100   Prunus mume [ume]
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           325   1e-100   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    325   2e-100   Glycine max [soybeans]
gb|KHN15309.1|  Plasma membrane ATPase 4                                325   2e-100   Glycine soja [wild soybean]
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    325   2e-100   Ricinus communis
gb|KHN22686.1|  Plasma membrane ATPase 4                                325   3e-100   Glycine soja [wild soybean]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                324   3e-100   Sesamum indicum [beniseed]
gb|AAB84202.2|  plasma membrane proton ATPase                           324   3e-100   Kosteletzkya pentacarpos [seashore mallow]
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             324   4e-100   Phaseolus vulgaris [French bean]
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          324   4e-100   Medicago truncatula
gb|KHN17608.1|  Plasma membrane ATPase 4                                324   4e-100   Glycine soja [wild soybean]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    324   4e-100   Glycine max [soybeans]
dbj|BAD16687.1|  plasma membrane H+-ATPase                              324   5e-100   Daucus carota [carrots]
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    319   5e-100   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             322   7e-100   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             323   7e-100   Phaseolus vulgaris [French bean]
emb|CAA59799.1|  H(+)-transporting ATPase                               323   8e-100   Phaseolus vulgaris [French bean]
emb|CAD62443.1|  proton-exporting ATPase                                305   9e-100   Zea mays [maize]
emb|CAG28305.1|  proton-exporting ATPase                                305   1e-99    Cucumis sativus [cucumbers]
emb|CAD29579.1|  proton-exporting ATPase                                305   1e-99    Zea mays [maize]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           323   1e-99    Malus domestica [apple tree]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      322   2e-99    Glycine max [soybeans]
gb|KHN16462.1|  Plasma membrane ATPase 4                                322   2e-99    Glycine soja [wild soybean]
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         322   2e-99    Jatropha curcas
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    322   2e-99    Glycine max [soybeans]
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             322   2e-99    
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           322   2e-99    Cicer arietinum [garbanzo]
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           322   2e-99    
emb|CAB69823.1|  plasma membrane H+ ATPase                              322   2e-99    Prunus persica
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           322   3e-99    
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    321   4e-99    Prunus mume [ume]
gb|AFW04239.1|  plasma membrane H+-ATPase                               321   5e-99    Sesuvium portulacastrum [sea-purslane]
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      321   5e-99    Solanum tuberosum [potatoes]
gb|AAB17186.1|  plasma membrane H+-ATPase                               321   5e-99    Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                321   5e-99    
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  321   5e-99    Elaeis guineensis
ref|XP_010094202.1|  Plasma membrane ATPase 4                           321   7e-99    Morus notabilis
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             320   8e-99    Prunus persica
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          320   1e-98    Glycine soja [wild soybean]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    320   1e-98    Gossypium raimondii
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    320   1e-98    Glycine max [soybeans]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           320   1e-98    Pyrus x bretschneideri [bai li]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  320   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH39758.1|  plasma membrane H+-ATPase                               320   2e-98    Medicago truncatula
gb|KJB55189.1|  hypothetical protein B456_009G068100                    320   2e-98    Gossypium raimondii
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                319   2e-98    Eucalyptus grandis [rose gum]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                319   2e-98    Erythranthe guttata [common monkey flower]
ref|XP_006404985.1|  hypothetical protein EUTSA_v10000729mg             298   2e-98    
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    319   3e-98    Eucalyptus grandis [rose gum]
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                318   3e-98    
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                319   3e-98    Phoenix dactylifera
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           319   3e-98    Sesamum indicum [beniseed]
dbj|BAD16684.1|  plasma membrane H+-ATPase                              319   4e-98    Daucus carota [carrots]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           319   4e-98    Phoenix dactylifera
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    318   7e-98    Glycine max [soybeans]
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         318   7e-98    Jatropha curcas
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                318   7e-98    
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                318   9e-98    Nelumbo nucifera [Indian lotus]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   316   1e-97    Citrus sinensis [apfelsine]
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     317   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                317   1e-97    
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           317   1e-97    Sesamum indicum [beniseed]
gb|KHF98166.1|  Plasma membrane ATPase 4                                311   2e-97    Gossypium arboreum [tree cotton]
emb|CDP02997.1|  unnamed protein product                                317   2e-97    Coffea canephora [robusta coffee]
gb|AAY42948.1|  plasma membrane H+ ATPase                               317   2e-97    Lupinus albus
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             317   3e-97    Citrus sinensis [apfelsine]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             316   3e-97    Citrus clementina [clementine]
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             316   3e-97    Phaseolus vulgaris [French bean]
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           316   3e-97    Cicer arietinum [garbanzo]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          316   3e-97    Amborella trichopoda
ref|XP_006382164.1|  H+-ATPase family protein                           316   3e-97    
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     316   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 316   5e-97    
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             316   5e-97    Elaeis guineensis
gb|AFM52333.1|  plasma membrane H+-ATPase                               316   5e-97    Malus baccata var. xiaojinensis
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           315   7e-97    Populus euphratica
dbj|BAO45902.1|  plasma membrane H+-ATPase                              315   8e-97    Acacia mangium
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           315   9e-97    Cicer arietinum [garbanzo]
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             315   1e-96    Phaseolus vulgaris [French bean]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    315   1e-96    Fragaria vesca subsp. vesca
gb|AAY42950.1|  plasma membrane H+ ATPase                               315   1e-96    Lupinus albus
dbj|BAD16688.1|  plasma membrane H+-ATPase                              315   1e-96    Daucus carota [carrots]
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    315   2e-96    Fragaria vesca subsp. vesca
gb|AEQ27822.1|  PM H+-ATPase R                                          314   3e-96    Eichhornia crassipes
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           314   3e-96    
gb|EPS65442.1|  hypothetical protein M569_09334                         313   3e-96    Genlisea aurea
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           313   3e-96    Cicer arietinum [garbanzo]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              313   5e-96    Daucus carota [carrots]
gb|ABM68570.1|  plasma membrane H+ ATPase                               291   5e-96    Lilium longiflorum [Easter lily]
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             313   6e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   313   6e-96    Vicia faba [broad bean]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    313   7e-96    Populus euphratica
gb|KHN01287.1|  Plasma membrane ATPase 4                                311   8e-96    Glycine soja [wild soybean]
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             312   9e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003594954.1|  Plasma membrane ATPase                             312   1e-95    Medicago truncatula
emb|CBW30173.1|  Plasma membrane ATPase 4                               312   1e-95    Musa balbisiana [starchy banana]
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             312   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    311   2e-95    
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                311   2e-95    Fragaria vesca subsp. vesca
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           311   2e-95    Cucumis melo [Oriental melon]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    311   2e-95    Gossypium raimondii
gb|KJB65971.1|  hypothetical protein B456_010G123000                    311   2e-95    Gossypium raimondii
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    311   2e-95    
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    311   2e-95    
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     311   2e-95    Eucalyptus grandis [rose gum]
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           311   3e-95    Glycine max [soybeans]
dbj|BAC77530.1|  plasma membrane H+-ATPase                              311   3e-95    Sesbania rostrata
emb|CAC29436.1|  P-type H+-ATPase                                       311   3e-95    Vicia faba [broad bean]
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  300   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             311   4e-95    Elaeis guineensis
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     311   4e-95    Eucalyptus grandis [rose gum]
gb|KEH35952.1|  plasma membrane H+-ATPase                               310   5e-95    Medicago truncatula
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          310   5e-95    Medicago truncatula
emb|CBW30211.1|  Plasma membrane ATPase                                 310   6e-95    Musa balbisiana [starchy banana]
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           311   6e-95    
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                310   9e-95    Erythranthe guttata [common monkey flower]
ref|XP_002324397.1|  H+-ATPase family protein                           309   1e-94    
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          309   2e-94    Fragaria vesca subsp. vesca
ref|XP_007023380.1|  H(+)-ATPase 9                                      308   2e-94    
gb|AAY42949.1|  plasma membrane H+ ATPase                               308   2e-94    Lupinus albus
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       305   4e-94    
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             307   6e-94    Vitis vinifera
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                307   7e-94    Beta vulgaris subsp. vulgaris [field beet]
emb|CBI35956.3|  unnamed protein product                                307   7e-94    Vitis vinifera
emb|CBI20766.3|  unnamed protein product                                306   7e-94    Vitis vinifera
gb|AAQ19041.1|  P-type H+-ATPase                                        292   7e-94    Phaseolus acutifolius
emb|CAN78639.1|  hypothetical protein VITISV_031738                     307   7e-94    Vitis vinifera
gb|AHK23067.1|  plasma membrane ATPase 4                                307   1e-93    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     307   1e-93    
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     305   1e-93    
gb|ABW25091.1|  plasma membrane proton pump                             306   1e-93    Cucumis sativus [cucumbers]
gb|EPS63245.1|  hypothetical protein M569_11541                         306   1e-93    Genlisea aurea
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     306   1e-93    
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    306   1e-93    
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           306   1e-93    
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       306   2e-93    
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                306   2e-93    Vitis vinifera
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    302   2e-93    
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  306   2e-93    Phoenix dactylifera
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                306   2e-93    Eucalyptus grandis [rose gum]
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  306   2e-93    
gb|ACL54575.1|  unknown                                                 306   2e-93    Zea mays [maize]
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     306   2e-93    Populus euphratica
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       306   3e-93    
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           305   4e-93    Cucumis melo [Oriental melon]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    305   4e-93    Tarenaya hassleriana [spider flower]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    305   4e-93    Tarenaya hassleriana [spider flower]
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             305   5e-93    
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   305   5e-93    Citrus sinensis [apfelsine]
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           305   6e-93    
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             304   1e-92    Setaria italica
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          304   1e-92    Sorghum bicolor [broomcorn]
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             303   2e-92    
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         303   2e-92    Jatropha curcas
gb|KHN38020.1|  Plasma membrane ATPase                                  302   2e-92    Glycine soja [wild soybean]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          303   2e-92    
dbj|BAL41366.1|  plasma membrane H+-ATPase                              303   2e-92    Aeluropus littoralis
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             303   3e-92    Prunus persica
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             302   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                302   5e-92    Erythranthe guttata [common monkey flower]
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           302   7e-92    Glycine max [soybeans]
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             302   7e-92    Phaseolus vulgaris [French bean]
dbj|BAG94605.1|  unnamed protein product                                301   8e-92    Oryza sativa Japonica Group [Japonica rice]
gb|AEO22063.1|  plasma membrane H+-ATPase                               301   9e-92    Aeluropus littoralis
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  301   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          301   1e-91    
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     301   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_010429928.1|  PREDICTED: ATPase 9, plasma membrane-type-like     283   1e-91    Camelina sativa [gold-of-pleasure]
gb|KJB70727.1|  hypothetical protein B456_011G089100                    301   1e-91    Gossypium raimondii
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          301   1e-91    Prunus mume [ume]
emb|CAD29313.1|  plasma membrane H+-ATPase                              301   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054118.1|  Os04g0656100                                       301   2e-91    
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          301   2e-91    Cucumis melo [Oriental melon]
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          301   2e-91    Oryza sativa Japonica Group [Japonica rice]
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       300   2e-91    
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    298   2e-91    Arabis alpina [alpine rockcress]
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      293   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          300   3e-91    Pyrus x bretschneideri [bai li]
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          300   3e-91    
emb|CDY03545.1|  BnaC03g68040D                                          294   3e-91    
ref|XP_007023381.1|  H(+)-ATPase 9                                      300   4e-91    
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             300   4e-91    Oryza brachyantha
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          300   4e-91    Tarenaya hassleriana [spider flower]
gb|AAB41898.1|  H+-transporting ATPase                                  300   5e-91    Mesembryanthemum crystallinum
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     300   5e-91    Cucumis sativus [cucumbers]
ref|NP_180028.1|  H(+)-ATPase 5                                         299   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     300   6e-91    
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    300   6e-91    
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     299   6e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          299   6e-91    Camelina sativa [gold-of-pleasure]
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    299   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          299   7e-91    Vitis vinifera
gb|AAK31799.2|  plasma membrane H+ ATPase                               299   8e-91    Lilium longiflorum [Easter lily]
emb|CDO98206.1|  unnamed protein product                                299   1e-90    Coffea canephora [robusta coffee]
emb|CAN61424.1|  hypothetical protein VITISV_027272                     299   1e-90    Vitis vinifera
gb|AAQ19039.1|  P-type H+-ATPase                                        284   1e-90    Vicia faba [broad bean]
gb|EPS59184.1|  hypothetical protein M569_15622                         288   2e-90    Genlisea aurea
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           298   2e-90    Elaeis guineensis
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     298   3e-90    Tarenaya hassleriana [spider flower]
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             297   4e-90    Phoenix dactylifera
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             297   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           297   4e-90    
dbj|BAD94367.1|  plasma membrane proton ATPase                          279   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          297   6e-90    Amborella trichopoda
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             297   6e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56561.1|  hypothetical protein B456_009G125200                    296   9e-90    Gossypium raimondii
dbj|BAJ34124.1|  unnamed protein product                                296   1e-89    Eutrema halophilum
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             296   1e-89    Eutrema salsugineum [saltwater cress]
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             295   2e-89    Capsella rubella
ref|NP_194748.1|  H(+)-ATPase 2                                         295   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190870.1|  H(+)-ATPase 2                                      296   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          295   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    295   3e-89    Phoenix dactylifera
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    295   3e-89    Phoenix dactylifera
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    295   3e-89    Arabis alpina [alpine rockcress]
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           295   3e-89    Sesamum indicum [beniseed]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        295   4e-89    Lilium longiflorum [Easter lily]
emb|CAC50884.1|  plasma membrane H+-ATPase                              288   5e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY14186.1|  BnaA08g13170D                                          293   8e-89    Brassica napus [oilseed rape]
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          293   9e-89    Brassica rapa
dbj|BAF03589.1|  P-type H+-ATPase                                       293   1e-88    Zostera marina
emb|CDX76810.1|  BnaC08g33960D                                          291   1e-88    
gb|KEH39623.1|  plasma membrane H+-ATPase                               293   1e-88    Medicago truncatula
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           293   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001185450.1|  H(+)-ATPase 9                                      293   2e-88    
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    293   2e-88    Arabis alpina [alpine rockcress]
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          292   2e-88    Glycine soja [wild soybean]
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     293   2e-88    Glycine max [soybeans]
ref|NP_178181.1|  H(+)-ATPase 9                                         292   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             292   3e-88    Phaseolus vulgaris [French bean]
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  292   3e-88    Brachypodium distachyon [annual false brome]
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          290   5e-88    Glycine soja [wild soybean]
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     291   7e-88    Tarenaya hassleriana [spider flower]
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           291   8e-88    Cicer arietinum [garbanzo]
gb|AAO22672.1|  putative plasma membrane proton ATPase                  276   8e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             291   9e-88    Eutrema salsugineum [saltwater cress]
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       291   9e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       291   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     274   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           291   1e-87    Elaeis guineensis
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             290   1e-87    Elaeis guineensis
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          291   1e-87    Tarenaya hassleriana [spider flower]
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    289   1e-87    
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       291   2e-87    
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       291   2e-87    
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     290   2e-87    Glycine max [soybeans]
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    289   2e-87    
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             290   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY34767.1|  BnaA09g41340D                                          290   2e-87    Brassica napus [oilseed rape]
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          290   3e-87    Brassica rapa
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           290   3e-87    
ref|XP_002307856.1|  ATPase 6 family protein                            289   3e-87    
gb|KFK29576.1|  h(+)-atpase 2                                           289   3e-87    
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             289   4e-87    
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    290   4e-87    
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     289   4e-87    
emb|CDY39956.1|  BnaC06g40340D                                          287   5e-87    
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     289   5e-87    
gb|ABR18001.1|  unknown                                                 288   7e-87    
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    285   7e-87    
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          288   8e-87    
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             288   1e-86    
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          288   1e-86    
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     288   1e-86    
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                288   1e-86    
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    288   1e-86    
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               288   2e-86    
gb|EMS60594.1|  Plasma membrane ATPase                                  287   2e-86    
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    286   2e-86    
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     286   3e-86    
gb|ABA18090.1|  putative plasma membrane ATPase                         287   3e-86    
gb|EMT26270.1|  Plasma membrane ATPase                                  287   3e-86    
gb|KJB66333.1|  hypothetical protein B456_010G136300                    287   3e-86    
emb|CDX87330.1|  BnaA07g35430D                                          285   3e-86    
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       286   4e-86    
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    286   5e-86    
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          286   5e-86    
ref|XP_002309321.1|  ATPase 6 family protein                            286   6e-86    
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          286   7e-86    
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          285   9e-86    
ref|XP_002324564.1|  ATPase 6 family protein                            285   1e-85    
ref|XP_007012006.1|  H(+)-ATPase 8                                      285   1e-85    
gb|AAV71150.1|  plasma membrane H+-ATPase                               285   1e-85    
dbj|BAF01699.1|  plasma membrane ATPase 3                               272   2e-85    
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     282   2e-85    
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    284   3e-85    
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             284   3e-85    
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             284   4e-85    
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                284   4e-85    
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    284   4e-85    
dbj|BAJ33915.1|  unnamed protein product                                284   4e-85    
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    284   5e-85    
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       281   5e-85    
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             283   6e-85    
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       277   7e-85    
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     283   8e-85    
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          282   1e-84    
gb|ABA18112.1|  putative plasma membrane ATPase                         282   1e-84    
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             282   1e-84    
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                280   1e-84    
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     282   2e-84    
gb|EYU35892.1|  hypothetical protein MIMGU_mgv1a0008592mg               265   2e-84    
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    282   2e-84    
dbj|BAC77533.1|  plasma membrane H+-ATPase                              268   2e-84    
ref|NP_179486.1|  H(+)-ATPase 1                                         281   3e-84    
gb|KFK27283.1|  h(+)-atpase 3                                           281   3e-84    
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     281   3e-84    
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   281   3e-84    
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             281   4e-84    
gb|AAA34096.1|  plasma membrane H+ ATPase                               269   5e-84    
ref|NP_001183637.1|  uncharacterized protein LOC100502231               265   5e-84    
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             280   6e-84    
ref|NP_189850.1|  H(+)-ATPase 8                                         280   6e-84    
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     280   9e-84    
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           280   1e-83    
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    279   2e-83    
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          279   2e-83    
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     279   2e-83    
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           279   2e-83    
gb|AAD46186.1|  plasma membrane proton ATPase                           279   2e-83    
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    278   3e-83    
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                278   3e-83    
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    279   4e-83    
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    278   4e-83    
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           278   4e-83    
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          278   4e-83    
emb|CDX82608.1|  BnaC07g02580D                                          278   4e-83    
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          278   5e-83    
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                278   5e-83    
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          278   5e-83    
emb|CDY64741.1|  BnaCnng44750D                                          278   5e-83    
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     278   5e-83    
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          278   6e-83    
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           278   6e-83    
emb|CDX67957.1|  BnaA07g19970D                                          277   6e-83    
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     278   7e-83    
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     278   7e-83    
ref|XP_008666713.1|  PREDICTED: plasma membrane ATPase-like             256   9e-83    
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             276   1e-82    
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    277   1e-82    
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       274   2e-82    
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     276   2e-82    
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    277   2e-82    
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     276   2e-82    
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          276   2e-82    
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    276   2e-82    
ref|NP_178762.1|  H(+)-ATPase 6                                         276   2e-82    
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             276   2e-82    
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    276   2e-82    
emb|CDX93092.1|  BnaA03g38140D                                          276   3e-82    
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             276   3e-82    
emb|CDY50939.1|  BnaC03g74390D                                          276   3e-82    
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    276   4e-82    
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     276   4e-82    
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   269   5e-82    
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                275   7e-82    
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    275   9e-82    
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          275   1e-81    
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     273   1e-81    
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     274   1e-81    
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    274   1e-81    
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          274   2e-81    
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             274   2e-81    
gb|AIV00616.1|  plasma membrane H+-ATPase                               255   2e-81    
emb|CDY30730.1|  BnaA02g33520D                                          271   2e-81    
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             275   2e-81    
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          273   2e-81    
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             273   2e-81    
ref|NP_001169535.1|  uncharacterized protein LOC100383411               258   2e-81    
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     273   2e-81    
ref|XP_002304716.2|  H+-ATPase family protein                           274   3e-81    
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             273   3e-81    
gb|AAL09726.1|  AT5g57350/MJB24_16                                      273   4e-81    
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     273   4e-81    
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       270   4e-81    
gb|ACR38028.1|  unknown                                                 259   5e-81    
ref|XP_010914191.1|  PREDICTED: plasma membrane ATPase-like             273   5e-81    
emb|CDY51651.1|  BnaAnng10910D                                          272   5e-81    
emb|CDP14275.1|  unnamed protein product                                267   5e-81    
emb|CDX72218.1|  BnaC07g42400D                                          272   5e-81    
ref|NP_200545.1|  H(+)-ATPase 3                                         272   6e-81    
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                272   6e-81    
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     272   7e-81    
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     272   8e-81    
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            268   8e-81    
gb|EEC69747.1|  hypothetical protein OsI_39279                          271   1e-80    
gb|KEH24964.1|  plasma membrane H+-ATPase                               272   1e-80    
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          271   1e-80    
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                272   1e-80    
gb|KEH24965.1|  plasma membrane H+-ATPase                               271   1e-80    
ref|NP_001067382.1|  Os12g0638700                                       271   1e-80    
emb|CAA70944.1|  pSB5                                                   252   1e-80    
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         271   2e-80    
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    271   2e-80    
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    271   2e-80    
emb|CDY45757.1|  BnaC02g42250D                                          271   3e-80    
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             271   3e-80    
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    271   3e-80    
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    271   3e-80    
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         271   3e-80    
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         270   3e-80    
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             271   3e-80    
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     266   3e-80    
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    271   3e-80    
ref|NP_001136587.1|  uncharacterized protein LOC100216710               259   4e-80    
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           270   4e-80    
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             259   4e-80    
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         270   5e-80    
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           265   6e-80    
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         270   6e-80    
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             259   6e-80    
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    266   7e-80    
ref|NP_201073.1|  H(+)-ATPase 11                                        269   8e-80    
gb|AAA34052.1|  H+-translocating ATPase                                 269   8e-80    
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             269   8e-80    
gb|EMS45119.1|  Plasma membrane ATPase 1                                269   9e-80    
emb|CDY51650.1|  BnaAnng10900D                                          268   9e-80    
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           269   1e-79    
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         269   1e-79    
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    269   1e-79    
gb|EMT31912.1|  Plasma membrane ATPase 1                                269   1e-79    
gb|AEQ27823.1|  PM H+-ATPase L                                          269   1e-79    
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           269   1e-79    
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         269   1e-79    
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    269   1e-79    
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                269   1e-79    
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    269   1e-79    
emb|CDX72217.1|  BnaC07g42390D                                          268   1e-79    
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     268   2e-79    
emb|CAH58642.1|  plasma membrane H+-ATPase                              250   2e-79    
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                268   2e-79    
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             268   2e-79    
gb|KJB33641.1|  hypothetical protein B456_006G023600                    268   2e-79    
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       266   2e-79    
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           268   2e-79    
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                268   2e-79    
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    268   3e-79    
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    268   3e-79    
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    268   3e-79    
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           268   3e-79    
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             268   4e-79    
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    268   4e-79    
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      268   4e-79    
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    267   4e-79    
ref|NP_001234477.1|  plasma membrane H+-ATPase                          267   4e-79    
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                267   5e-79    
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    267   5e-79    
gb|AFC88896.1|  plasma membrane H+-ATPase                               267   5e-79    
dbj|BAK04567.1|  predicted protein                                      267   5e-79    
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                267   5e-79    
dbj|BAJ92653.1|  predicted protein                                      267   6e-79    
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             267   7e-79    
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    267   7e-79    
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     267   7e-79    
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    263   7e-79    
gb|EMT26085.1|  Plasma membrane ATPase 1                                267   7e-79    
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     267   7e-79    
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    266   7e-79    
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    267   7e-79    
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                266   8e-79    
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    266   8e-79    
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         266   9e-79    
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    266   9e-79    
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                266   9e-79    
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          266   1e-78    
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    266   1e-78    
emb|CDY67153.1|  BnaAnng23670D                                          266   1e-78    
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                266   1e-78    
emb|CDY38294.1|  BnaA10g11420D                                          266   1e-78    
ref|XP_002864812.1|  AHA11-ATPASE 11                                    266   1e-78    
emb|CDY47940.1|  BnaA02g08160D                                          266   1e-78    



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLDIMKFA
Sbjct  197  ERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFA  256

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SY
Sbjct  257  IRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSY  316

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            REL+EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  317  RELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  365



>emb|CAG28306.1| proton-exporting ATPase [Cucumis sativus]
Length=310

 Score =   324 bits (831),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  142  ERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFA  201

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SY
Sbjct  202  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSY  261

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  262  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  310



>gb|KJB22049.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=695

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFA
Sbjct  527  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFA  586

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  587  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSY  646

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  647  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  695



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFA
Sbjct  488  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFA  547

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  548  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSY  607

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  608  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  656



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVAT+IAVYANWGFARIQG GWGWAGV+WLYS+VFYIPLD+MKFA
Sbjct  488  ERPGLLLVTAFIIAQLVATVIAVYANWGFARIQGIGWGWAGVIWLYSVVFYIPLDLMKFA  547

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF++K+SY
Sbjct  548  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNDKSSY  607

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  608  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  656



>gb|KJB22047.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=885

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFA
Sbjct  717  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFA  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  777  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  837  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>gb|KJB53771.1| hypothetical protein B456_009G004200 [Gossypium raimondii]
Length=825

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL AT+IAVYANWGFARIQG GWGWAGV+WLYS+VFYIPLD+MKFA
Sbjct  657  ERPGLLLVTAFIIAQLAATVIAVYANWGFARIQGIGWGWAGVIWLYSVVFYIPLDLMKFA  716

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF++K+SY
Sbjct  717  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNDKSSY  776

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  777  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  825



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   335 bits (858),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFA
Sbjct  783  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  843  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   331 bits (848),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  718  ERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFA  777

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF++K+SY
Sbjct  778  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSY  837

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  838  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  886



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   331 bits (848),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  786  ERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF++K+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AFK46374.1| unknown [Lotus japonicus]
Length=289

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT +AVYANW FARI G GWGWAGV+WLY+IV YIPLD++KFA
Sbjct  121  ERPGLLLLGAFMIAQLVATFLAVYANWSFARINGMGWGWAGVIWLYTIVTYIPLDLLKFA  180

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EKNSY
Sbjct  181  IRYALSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNVFNEKNSY  240

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  241  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  289



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   330 bits (847),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD+MKFA
Sbjct  785  ERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDVMKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SY
Sbjct  845  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   330 bits (846),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLV AF+IAQLVATLIAVYANW FAR++GCGWGWAGV+WLYSIVFY PLDIMKFA
Sbjct  784  ERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF+EKNSY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   330 bits (846),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLV AF+IAQLVATLIAVYANW FAR++GCGWGWAGV+WLYSI+FY+PLDIMKFA
Sbjct  784  ERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYLPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF+EKNSY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD+MKFA
Sbjct  717  ERPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFA  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SY
Sbjct  777  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  837  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   330 bits (845),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLV AF+IAQLVATLIAVYANW FAR++GCGWGWAGV+WLYSI+FY PLDIMKFA
Sbjct  784  ERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF+EKNSY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|KGN62871.1| hypothetical protein Csa_2G378530 [Cucumis sativus]
Length=170

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF 
Sbjct  2    ERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFG  61

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY  SGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SY
Sbjct  62   IRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSY  121

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  122  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  170



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   329 bits (843),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD+MKFA
Sbjct  786  ERPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   328 bits (842),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF++AQLVATLIAVYANWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFA
Sbjct  784  ERPGLLLVSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE + +F+EK+SY
Sbjct  844  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>emb|CDP04837.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQLVATLIAVYANW FARI+GCGWGWAGV+WLYS+VFY+PLD +KF 
Sbjct  59   ERPGLLLLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFF  118

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LS KAWLNL++NK AFTTKKDYGKEEREAQWA AQRTLHGLQPP+AS +  EK+SY
Sbjct  119  IRYVLSRKAWLNLIDNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSY  178

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQH T+
Sbjct  179  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHCTV  227



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   328 bits (840),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGVVW+YS+VFY+PLD +KF 
Sbjct  786  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFF  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   327 bits (839),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AFLIAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLDIMKFA
Sbjct  786  ERPGLLLVGAFLIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDIMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLDIMKFA
Sbjct  787  ERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SY
Sbjct  847  IRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            REL+EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQL+ATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFA
Sbjct  786  ERPGLLLMSAFVIAQLIATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S +F+EK+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSGIFNEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGVVW+YS+VFY+PLD +KF 
Sbjct  786  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFF  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF +KNSY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFXDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LLV AFLIAQL+ATLIAVYANWGFA++QG GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  784  ERPGALLVIAFLIAQLIATLIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F+EK+SY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   319 bits (818),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  491  ERPGLLLLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFA  550

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+EK+SY
Sbjct  551  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSY  610

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  611  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  659



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   326 bits (835),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF++AQLVATLIAVYANWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFA
Sbjct  784  ERPGLLLLSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE + +F+EK+SY
Sbjct  844  IRYILSGKAWLNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   326 bits (835),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  786  ERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   325 bits (834),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVATLIAVYANWGFARIQG GWGWAGV+W+YSIVFY PLD+MKFA
Sbjct  787  ERPGLLLLSAFMIAQLVATLIAVYANWGFARIQGVGWGWAGVIWIYSIVFYFPLDVMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PEA+NLF++K+SY
Sbjct  847  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   325 bits (834),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  786  ERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   325 bits (833),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLD+MKFA
Sbjct  787  ERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SY
Sbjct  847  IRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            REL+EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   325 bits (833),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLD+MKFA
Sbjct  787  ERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SY
Sbjct  847  IRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            REL+EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFA I+G GWGWAGV+WLYSIVFYIPLD++KFA
Sbjct  784  ERPGLLLVTAFIIAQLVATLIAVYANWGFAHIKGIGWGWAGVIWLYSIVFYIPLDLLKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+EK+SY
Sbjct  844  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLV AF+IAQL+AT+IAVYA+WGFA+++G GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  785  ERPGMLLVCAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSIVFYIPLDVMKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY+LSGKAW+N+LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE S +F+EKNSY
Sbjct  845  TRYVLSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   324 bits (831),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+GCGWGWAGV+WLYSIVFY+PLD+MKFA
Sbjct  783  ERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGCGWGWAGVIWLYSIVFYVPLDLMKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NL +NKTAFTTKKDYGK EREAQWA AQRTLHGLQ PEA+N+F+EK+SY
Sbjct  843  IRYILSGKAWQNLYDNKTAFTTKKDYGKGEREAQWALAQRTLHGLQTPEATNIFNEKSSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   324 bits (831),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD +KFA
Sbjct  786  ERPGLLLLSAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDFIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWL L ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EKNSY
Sbjct  846  IRYILSGKAWLTLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFHEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   324 bits (831),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIVFY PLDIMKFA
Sbjct  787  ERPGLLLLGAFVIAQLIATLIAVYANWSFARIKGVGWGWAGVIWLYSIVFYFPLDIMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASN+F+EK+SY
Sbjct  847  TRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LLV AF IAQL+AT+IAVYANWGFA++QG GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  784  ERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F+EK+SY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+IAQL+AT+IAVYA+WGFA+++G GWGWAGV+WLYS+VFYIPLD+MKFA
Sbjct  785  ERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RYILSGKAW+N+LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE S +F+EKNSY
Sbjct  845  TRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+IAQL+AT+IAVYA+WGFA+++G GWGWAGV+WLYS+VFYIPLD+MKFA
Sbjct  785  ERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RYILSGKAW+N+LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE S +F+EKNSY
Sbjct  845  TRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   324 bits (830),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AFL+AQL+AT +AVYANW FARI GCGWGWAGV+W+YSIVFYIPLDI+KF 
Sbjct  781  ERPGLLLVAAFLVAQLIATFVAVYANWDFARIHGCGWGWAGVIWIYSIVFYIPLDILKFG  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP  SN+F +KNSY
Sbjct  841  TRYALSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPADSNIFDDKNSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  901  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   319 bits (817),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+ AQL+AT+IAVYANWGFARI+GCGWGWAGV+WLYS+V Y+PLD++KFA
Sbjct  566  ERPGLLLIGAFIAAQLIATVIAVYANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLKFA  625

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N F++KNSY
Sbjct  626  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNFFADKNSY  685

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  686  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  734



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFA
Sbjct  717  ERPGLLLVSAFMIAQLVATVIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFA  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +F+EK+ Y
Sbjct  777  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETAGVFNEKSGY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  837  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   323 bits (828),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AFLIAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KFA
Sbjct  783  ERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  843  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   323 bits (828),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AFLIAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KFA
Sbjct  783  ERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  843  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   305 bits (782),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  142  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFF  201

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KN
Sbjct  202  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKN  261

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  262  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>emb|CAG28305.1| proton-exporting ATPase [Cucumis sativus]
Length=311

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFA
Sbjct  142  ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  201

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNS  334
            IRYILSGKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNS
Sbjct  202  IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNS  261

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  262  YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  311



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 163/171 (95%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  142  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFF  201

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEAS+  LF++K+
Sbjct  202  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKS  261

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  262  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AFLIAQL+ATLIAVYANW FARI GCGWGWAGV+W+YSIVFY PLD+MKFA
Sbjct  787  ERPGMLLLGAFLIAQLIATLIAVYANWSFARIHGCGWGWAGVIWIYSIVFYFPLDLMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGL+ PE+S++F++K+SY
Sbjct  847  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLEAPESSSIFNDKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVAT +AVYANWGFARIQG GWGWAGV+WLYS+V YIPLDI+KFA
Sbjct  783  ERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVAT +AVYANWGFARIQG GWGWAGV+WLYS+V YIPLDI+KFA
Sbjct  783  ERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AFLIAQLVATLIAVYA+WGFARI+G GWGWAGV+W+YSIVFYIPLD++KFA
Sbjct  784  ERPGLLLMSAFLIAQLVATLIAVYADWGFARIKGIGWGWAGVIWIYSIVFYIPLDLLKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+EKNSY
Sbjct  844  IRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVAT +AVYANWGFARIQG GWGWAGV+WLYS+V YIPLDI+KFA
Sbjct  783  ERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQLVATLIAVYANW FARI+GCGWGWAGV+WL+S+V Y PLD++KFA
Sbjct  775  ERPGLLLLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFA  834

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFSEKNSY
Sbjct  835  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSY  894

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  895  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  943



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  783  ERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNLFNEKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANWGFARIQG GWGWAGV+WLYSIV Y+PLD++KFA
Sbjct  786  ERPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  846  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQLVATLIAVYANW FARI+GCGWGWAGV+WL+S+V Y PLD++KFA
Sbjct  786  ERPGLLLLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFSEKNSY
Sbjct  846  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANWGFARIQG GWGWAGV+WLYSIV Y+PLD++KFA
Sbjct  780  ERPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFA  839

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  840  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  899

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  900  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   321 bits (823),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANW FARI+GCGWGWAGV+WL+S+V Y PLD++KFA
Sbjct  767  ERPGLLLLGAFMIAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFA  826

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  827  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  886

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  887  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  935



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 163/170 (96%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL TAFLIAQLVATLIAVYANWGFA I+GCGWGWAGVVWLY+IVFY+PLDI+KFA
Sbjct  784  ERPGALLFTAFLIAQLVATLIAVYANWGFADIKGCGWGWAGVVWLYNIVFYVPLDILKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN-LFSEKNS  334
            IRYILSGKAWLNL E+KTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE SN LF+EKNS
Sbjct  844  IRYILSGKAWLNLFESKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPEPSNHLFNEKNS  903

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  904  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVATLIAVYA+W FAR++GCGWGWAGV+W++SIV Y PLDIMKFA
Sbjct  784  ERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVATLIAVYA+W FAR++GCGWGWAGV+W++SIV Y PLDIMKFA
Sbjct  784  ERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVATLIAVYA+W FAR++GCGWGWAGV+W++SIV Y PLDIMKFA
Sbjct  784  ERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   321 bits (822),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARIQG GWGWAGV+WLYSIVF+ PLD+ KFA
Sbjct  786  ERPGLLLVTAFVIAQLVATLIAVYANWGFARIQGIGWGWAGVIWLYSIVFFFPLDLFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLF++K+SY
Sbjct  846  IRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   321 bits (822),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLV+AF+IAQLVATLIAVYA+W FARI+G  WGWAGV+W+YSIVFY+PLDIMKFA
Sbjct  789  ERPGMLLVSAFIIAQLVATLIAVYADWSFARIKGIDWGWAGVIWIYSIVFYVPLDIMKFA  848

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SY
Sbjct  849  TRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETTNLFPEKSSY  908

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   320 bits (821),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQL+ATL+AVYANWGFARI G GWGWAGV+W+YSIVFY PLD+MKFA
Sbjct  787  ERPGLLLLGAFMIAQLIATLVAVYANWGFARIHGVGWGWAGVIWVYSIVFYFPLDVMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PEA+NLF++K+SY
Sbjct  847  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   320 bits (820),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  772  ERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFA  831

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  832  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSY  891

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  892  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  940



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   320 bits (821),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  786  ERPGLLLLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+EK+SY
Sbjct  846  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   320 bits (820),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  783  ERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  843  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   320 bits (820),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL++AF+IAQLVATL+AVYA WGFARI G GWGWAGV+W+YSIVFY PLD MKF 
Sbjct  787  ERPGMLLMSAFMIAQLVATLLAVYAKWGFARIHGVGWGWAGVIWIYSIVFYFPLDFMKFT  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F++KNSY
Sbjct  847  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSIFNDKNSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVF+ PLD  KFA
Sbjct  786  ERPGLLLVTAFVIAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFFFPLDCFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLEN+TAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLFS+KNSY
Sbjct  846  IRYILSGKAWDNLLENRTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANLFSDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AFLIAQL+AT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  783  ERPGLLLLGAFLIAQLIATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASN+F+EKNSY
Sbjct  843  IRYFLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNVFNEKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRE+HTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLREVHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  786  ERPGLLLLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+EK+SY
Sbjct  846  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT  187
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT
Sbjct  906  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYT  953



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVATLIAVYANWGFA I+GCGWGWAG +W+YSIV Y+PLDI+KFA
Sbjct  786  ERPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S +FS+K+SY
Sbjct  846  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSTIFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQL+ATLIAVYANWGFARIQGCGWGWAGV+WLYSIVFY+PLD+MKFA
Sbjct  786  ERPGLLLLVAFCIAQLIATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYVPLDLMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NL +NK AF+TK+DYGK EREAQWAHAQRTLHGLQ PEA NLF+EK+SY
Sbjct  846  IRYILSGKAWQNLYDNKIAFSTKQDYGKGEREAQWAHAQRTLHGLQNPEAGNLFNEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006404985.1| hypothetical protein EUTSA_v10000729mg [Eutrema salsugineum]
 gb|ESQ46438.1| hypothetical protein EUTSA_v10000729mg [Eutrema salsugineum]
Length=197

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF IAQLVAT IAVYANW FARI+G GW WAGV+WLYS++ YIPLD++KFA
Sbjct  29   ERPGHLLLGAFFIAQLVATFIAVYANWSFARIEGVGWRWAGVIWLYSLITYIPLDLLKFA  88

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +N+F+EKN Y
Sbjct  89   IRYILSGKAWLNLLDNKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPETNNIFNEKNCY  148

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAEVARLREL+TLKG VESVVKLKGLDI+TIQQHYT+
Sbjct  149  SELSEIAEQAKRRAEVARLRELNTLKGQVESVVKLKGLDIDTIQQHYTV  197



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQLVATLIAVYANWGFA I+GCGWGWAG +W+YSIV Y+PLDI+KFA
Sbjct  767  ERPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFA  826

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S +FS+K+SY
Sbjct  827  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSTIFSDKSSY  886

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  887  RELSEIAEQAKRRAEVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  935



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   318 bits (814),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL++AF+IAQL ATL+AVYA WGFA+I G GWGWAGV+W+YSIVFY PLD MKFA
Sbjct  717  ERPGMLLMSAFMIAQLXATLLAVYAKWGFAKIHGVGWGWAGVIWIYSIVFYFPLDFMKFA  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F +KNSY
Sbjct  777  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSIFHDKNSY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  837  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATLIAVYANWGFARI+G GWGWA V+WLYSIVF+ PLD+ KF+
Sbjct  786  ERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFS  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  846  IRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+ L++AFLIAQLVATLIAVYANWGFA+I+GCGWGWAGV+WLYSIV YIPLDI+KF 
Sbjct  786  ERPGMFLLSAFLIAQLVATLIAVYANWGFAKIKGCGWGWAGVIWLYSIVTYIPLDILKFC  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTK +YGKEEREAQWA AQRTLHGLQPPE +NLF EK+SY
Sbjct  846  IRYVLSGKAWDNLLENKTAFTTKSNYGKEEREAQWAAAQRTLHGLQPPETTNLFPEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANWGFARIQGCGWGWAGV+WLYSIVFY PLDIMKFA
Sbjct  782  ERPGFLLLGAFLIAQLIATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYFPLDIMKFA  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LS KAW ++++N+TAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASN+F+EK+SY
Sbjct  842  TRYALSNKAWQSMIDNRTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  902  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+VF+ PLD+ KFA
Sbjct  786  ERPGLLLVTAFIVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDLFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  846  IRYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  783  ERPGLLLLGAFFIAQLVATFIAVYANWSFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  843  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF++AQL+ATLIAVYANWGFARI+GCGWGWAGV+WLYS+V Y+PLD++KFA
Sbjct  786  ERPGLLLVGAFIVAQLIATLIAVYANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N F EK+ Y
Sbjct  846  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETNNFFGEKSGY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+W YSIV Y+PLD++KFA
Sbjct  786  ERPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  846  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   318 bits (814),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVATLIAVYANWGF+RI+G GWGWAGV+WLY+IV Y+PLDI+KF 
Sbjct  786  ERPGLLLVSAFIIAQLVATLIAVYANWGFSRIKGIGWGWAGVIWLYTIVSYVPLDIIKFF  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++K+SY
Sbjct  846  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL TAF+IAQLVAT IAVYANW FARI+GCGWGWAGV+WLYS+V Y PLDI+KF 
Sbjct  717  ERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFG  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +FS+KNSY
Sbjct  777  IRYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  837  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y PLD +KFA
Sbjct  786  ERPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  846  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+W YSIV Y+PLD++KFA
Sbjct  788  ERPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFA  847

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  848  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  907

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+TAF+IAQLVATLIAVYANWGFARI+GCGWGWAGV+W+YS+VFY+PLD+MKFA
Sbjct  785  ERPGALLMTAFVIAQLVATLIAVYANWGFARIKGCGWGWAGVIWIYSVVFYVPLDLMKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            +RYILSGKAW NL ENK AFTTKKDYGKEEREAQWA AQRTLHGLQ PEA+ +F+EK+SY
Sbjct  845  VRYILSGKAWQNLYENKIAFTTKKDYGKEEREAQWALAQRTLHGLQTPEATTVFNEKSSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFL+AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+V YIPLD++KFA
Sbjct  495  ERPGLLLVSAFLVAQLVATLIAVYADWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFA  554

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+E++SY
Sbjct  555  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETTSIFNERSSY  614

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  615  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  663



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQLVATLIAVYANW FARI+GCGWGWAGV+WLYS+VFY+PLD +KF 
Sbjct  786  ERPGLLLLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFF  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAWLNL++NK AFTTKKDYGKEEREAQWA AQRTLHGLQPP+AS +  EK+SY
Sbjct  846  IRYVLSGKAWLNLIDNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 163/169 (96%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AF+IAQL+AT+IAVYANWGFA+IQG GWGWAGV+WLYS+VFY PLD++KFA
Sbjct  789  ERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFA  848

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW+N+ ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE SN+F+E N+Y
Sbjct  849  IRYVLSGKAWVNI-ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNY  907

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   317 bits (811),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL TAF+IAQLVAT IAVYANW FARI+GCGWGWAGV+WLYS+V Y PLDI+KF 
Sbjct  786  ERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFG  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +FS+KNSY
Sbjct  846  IRYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL TAF+IAQLVAT IAVYANW FARI+GCGWGWAGV+WLYS+V Y PLDI+KF 
Sbjct  786  ERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFG  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +FS+KNSY
Sbjct  846  IRYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT +AVYANW FARI+G GWGWAGV+WLYS+V YIPLDI+KFA
Sbjct  783  ERPGLLLLGAFMIAQLVATFLAVYANWEFARIKGMGWGWAGVIWLYSLVTYIPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AF IAQL+ATLIAVYANW FA++QG GWGWAGV+WLYSIVFY PLD+MKFA
Sbjct  784  ERPGMLLLIAFFIAQLIATLIAVYANWTFAKVQGIGWGWAGVIWLYSIVFYFPLDVMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPEAS +F+EK+SY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTSKKDYGKEEREAQWALAQRTLHGLQPPEASGIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF +AQLVATL+AVYANWGFAR++G GWGWAGV+W+YSIVFY+PLD++KFA
Sbjct  782  ERPGLLLVSAFFVAQLVATLLAVYANWGFARVKGIGWGWAGVIWIYSIVFYVPLDLIKFA  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            ++YILSGKAW  LLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPEASNLF+EK+SY
Sbjct  842  VKYILSGKAWDTLLEKKTAFTSKKDYGREEREAQWALAQRTLHGLQPPEASNLFNEKSSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  902  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF+ AQLVATLIAVYANWGFARI+GCGWGWAGV+WL+S+V Y+PLDI+KFA
Sbjct  786  ERPGFLLLGAFVAAQLVATLIAVYANWGFARIEGCGWGWAGVIWLFSVVTYVPLDILKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS-NLFSEKNS  334
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S N+FSEKNS
Sbjct  846  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNS  905

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  YRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   316 bits (810),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y PLD +KFA
Sbjct  786  ERPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSY
Sbjct  846  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI++IQQHYT 
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDSIQQHYTF  954



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   316 bits (809),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V ++PLD++KFA
Sbjct  786  ERPGLLLVSAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+FSE++SY
Sbjct  846  TRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSERSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   316 bits (809),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF++AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYSIVF+ PLD+ KFA
Sbjct  786  ERPGLLLVIAFVVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSIVFFFPLDLFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  846  IRYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWATAQRTLHGLQPPETTNLFNDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   316 bits (809),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y+PLD +KFA
Sbjct  786  ERPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+E+NSY
Sbjct  846  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNERNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   315 bits (808),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 162/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF+ AQL+ATLIAVYANWGFARI+GCGWGWAGV+WL+S+V Y+PLDI+KFA
Sbjct  786  ERPGFLLLGAFVAAQLIATLIAVYANWGFARIKGCGWGWAGVIWLFSVVTYVPLDILKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS-NLFSEKNS  334
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S N+FSEKNS
Sbjct  846  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNS  905

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  YRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   315 bits (807),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF+IAQL+AT +AVYA+WGFA+I+G GWGWAGVVWLYSIVFYIPLD +KF 
Sbjct  786  ERPGLLLMSAFIIAQLIATFLAVYADWGFAKIKGIGWGWAGVVWLYSIVFYIPLDFLKFT  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S++F++KNSY
Sbjct  846  IRYVLSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSSIFNDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   315 bits (807),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT +AVYANWGFARI+G GWGWAGV+W+YS+V YIPLDI+KF 
Sbjct  783  ERPGLLLLGAFMIAQLVATFLAVYANWGFARIKGMGWGWAGVIWVYSLVTYIPLDILKFT  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNIFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AF+IAQ++AT+IAVYA+W FA+++G GWGWAGV+WLYSIVFY PLD+MKFA
Sbjct  785  ERPGMLLIIAFMIAQMIATIIAVYADWSFAKVKGIGWGWAGVIWLYSIVFYFPLDLMKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW+NLLENKTAFTTKKDYG+EEREAQWAHAQRTLHGLQPPE +++F+EKNSY
Sbjct  845  IRYILSGKAWVNLLENKTAFTTKKDYGREEREAQWAHAQRTLHGLQPPETTSIFNEKNSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQA +RAEVARLRELHTLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  905  RELSEIAEQAMKRAEVARLRELHTLKGHVESVVKLKGLDIDNIQQHYTV  953



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQLVATLIAVYANW FARI GCGWGWAGVVWL+S+V Y PLD++KFA
Sbjct  787  ERPGLLLLGAFIVAQLVATLIAVYANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE+SN+FS+K+SY
Sbjct  847  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPESSNIFSDKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  955



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AF+IAQL+AT+IAVYANWGFA+IQG GWGWAGV+WLYS+VFY PLD++KFA
Sbjct  786  ERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW+N+ ENKTAFTTKKD GKEEREAQWAHAQRTLHGLQPPE SN+F+E N+Y
Sbjct  846  IRYVLSGKAWVNI-ENKTAFTTKKDCGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF+IAQL+AT+IAVYANWGFARI GCGWGWAGVVWLYSIVFY PLDIMKFA
Sbjct  782  ERPGFLLLGAFMIAQLLATVIAVYANWGFARIHGCGWGWAGVVWLYSIVFYFPLDIMKFA  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW N+++N+TAF+TKKDYGKEEREAQWA AQRTLHGLQPPEAS +F++K+SY
Sbjct  842  TRYALSGKAWQNMIDNRTAFSTKKDYGKEEREAQWALAQRTLHGLQPPEASTIFNDKSSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  902  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQLVATLIAVYANW FARI GCGWGWAGVVWL+S+V Y PLD++KFA
Sbjct  815  ERPGLLLLGAFIVAQLVATLIAVYANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFA  874

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE+SN+FS+K+SY
Sbjct  875  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPESSNIFSDKSSY  934

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  935  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  983



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+ AQL+ATLIAVYA+WGFARI+G GWGWAGV+WLYSIV + PLDI KFA
Sbjct  782  ERPGLLLVFAFIAAQLIATLIAVYADWGFARIKGIGWGWAGVIWLYSIVTFFPLDIFKFA  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA NLF+EKNSY
Sbjct  842  IRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAVNLFNEKNSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  902  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y+PLD +KFA
Sbjct  786  ERPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE  NLF+E+NSY
Sbjct  846  IRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETXNLFNERNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   313 bits (803),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFL+AQLVATLIAVYANWGFAR++GCGWGWAGV+WLYSIVFY PLD MKFA
Sbjct  786  ERPGLLLVSAFLLAQLVATLIAVYANWGFARVKGCGWGWAGVIWLYSIVFYFPLDPMKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NL +N+TAFTTKKDYGKEEREAQWA AQRT+HGL+  +A NLF++K+SY
Sbjct  846  IRYVLSGKAWNNLFDNRTAFTTKKDYGKEEREAQWALAQRTMHGLKTNDAGNLFTDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   313 bits (803),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AFL AQL+ATLIAVYANWGFARI G GWGWAGV+WLYSI+FY+PLD++KF 
Sbjct  788  ERPGMLLMGAFLTAQLIATLIAVYANWGFARIHGIGWGWAGVIWLYSIIFYLPLDVIKFF  847

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S++F+EK+SY
Sbjct  848  IRYLLSGKAWQNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSSVFNEKSSY  907

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   313 bits (802),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANWGFARI+GCGWGWAGV+W+YS+VFY PLDIMKF 
Sbjct  782  ERPGFLLLGAFLIAQLIATLIAVYANWGFARIEGCGWGWAGVIWIYSVVFYFPLDIMKFG  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNS-  334
             RY LSGKAW N++E + AFTTKKDYGKEEREAQWAH QRTLHGLQPPEA+N+F++KNS 
Sbjct  842  TRYALSGKAWNNMIEQRVAFTTKKDYGKEEREAQWAHVQRTLHGLQPPEATNIFNDKNSN  901

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  902  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|ABM68570.1| plasma membrane H+ ATPase [Lilium longiflorum]
Length=191

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL AQLVAT+I+VYA+WGFARI G GW WAGV+W++SIV Y PLDI+KF 
Sbjct  23   ERPGLLLVTAFLAAQLVATVISVYASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFI  82

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGK W NL++NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  + S+LF++KNSY
Sbjct  83   IRYALSGKTWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSY  142

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  143  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  191



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   313 bits (802),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVATL+AVYANWGFARI+G GWGWAGV+WLYSIVF+ PLD  KFA
Sbjct  786  ERPGLLLVTAFIIAQLVATLLAVYANWGFARIKGIGWGWAGVIWLYSIVFFFPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ +NLF EK+SY
Sbjct  846  IRYVLSGKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPDTANLFPEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESV KLKGLDI+ IQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVFKLKGLDIDNIQQHYTV  954



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   313 bits (802),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -1

Query  753  QVSM*VRLLSLSPDLAAGLSXERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGW  574
            QVS+  + L       +GL    PGLLL+ AFLIAQL+ATLIAVYANW FARIQG GWGW
Sbjct  763  QVSIVSQALIFVTRSRSGLMLNAPGLLLLGAFLIAQLIATLIAVYANWAFARIQGIGWGW  822

Query  573  AGVVWLYSIVFYIPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQ  394
            AGV+WLYSI+FYIPLDI+KFA RY LSGKAW NL ENKTAFTTKKDYGK EREAQWAHAQ
Sbjct  823  AGVIWLYSIIFYIPLDIIKFATRYFLSGKAWSNL-ENKTAFTTKKDYGKGEREAQWAHAQ  881

Query  393  RTLHGLQPPEASNLFSEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLD  214
            RTLHGL+PPE+S +F EKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLD
Sbjct  882  RTLHGLEPPESSGIFHEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLD  941

Query  213  IETIQQHYTL  184
            I+TIQQHYT+
Sbjct  942  IDTIQQHYTV  951



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   313 bits (801),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVAT+IAVY NWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFA
Sbjct  783  ERPGLLLVSAFMIAQLVATVIAVYVNWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFTTKKDYGKEEREA WA AQRTLHGLQPPE + +F+EK+ Y
Sbjct  843  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAHWALAQRTLHGLQPPETAGVFNEKSGY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGH ESVVKLKGLDI+TIQQH T+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHDESVVKLKGLDIDTIQQHCTV  951



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   311 bits (797),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL+ATLIAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF 
Sbjct  717  ERPGLLLVTAFIIAQLIATLIAVYANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFG  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW N+ ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPE   +FSEKN+Y
Sbjct  777  IRYFLSGKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIA+QA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  837  RELSEIADQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   312 bits (800),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVAT+IAVYA+WGFARI+G GW WAGV+W+YSIVF+ PLD  KFA
Sbjct  786  ERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFS+K+SY
Sbjct  846  IRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   312 bits (800),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AF+IAQL+ATLIAVYANWGFARIQG GWGWAGV+WLYSI+FYIPLDI+KFA
Sbjct  789  ERPGMLLMGAFVIAQLIATLIAVYANWGFARIQGIGWGWAGVIWLYSIIFYIPLDIIKFA  848

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP-EASNLFSEKNS  334
            IRY LSGKAW NLLENKTAFT KKDYGKEEREAQWAHAQRTLHGL  P E S+LF++KN+
Sbjct  849  IRYGLSGKAWTNLLENKTAFTNKKDYGKEEREAQWAHAQRTLHGLSAPEETSSLFNDKNT  908

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIET+QQHYT+
Sbjct  909  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  958



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVAT+IAVYA+WGFARI+G GW WAGV+W+YSIVF+ PLD  KFA
Sbjct  786  ERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFS+K+SY
Sbjct  846  IRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+VF+ PLD  KFA
Sbjct  786  ERPGLLLVSAFIIAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +N+FSEK+SY
Sbjct  846  IRYILSGKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANIFSEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+AR+REL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARIRELNTLKGHVESVVKLKGLDIDNIQQHYTV  954



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQL+AT IAVYANW FARIQG GWGWAGV+W+YS+V YIPLD++KFA
Sbjct  763  ERPGLLLLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFA  822

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSG+AW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP +A+N+FS+KNSY
Sbjct  823  IRYVLSGRAWNNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSY  882

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  883  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQL+ATL+AVYANWGFARI G GWGWAGV+WLYSIVFY PLDIMKFA
Sbjct  787  ERPGLLLLGAFAIAQLIATLVAVYANWGFARIHGVGWGWAGVIWLYSIVFYFPLDIMKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLN+L+N+TAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S+LF++K+SY
Sbjct  847  IRYILSGKAWLNMLDNRTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSLFNDKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL TLKGHVESV KLKGLD+++IQQHYT+
Sbjct  907  RELSEIAEQAKRRAEMARLRELTTLKGHVESVAKLKGLDLDSIQQHYTV  955



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF 
Sbjct  787  ERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFG  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY  SGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SY
Sbjct  847  IRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+ AQLVATLIAVYANW FA+IQG GWGWA V+WLYS+V YIPLD++KFA
Sbjct  786  ERPGLLLVTAFIAAQLVATLIAVYANWRFAKIQGMGWGWAAVIWLYSLVTYIPLDLIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+E++SY
Sbjct  846  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNVFNERSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFL+AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+V YIPLD +KFA
Sbjct  789  ERPGLLLVSAFLVAQLVATLIAVYADWGFARIKGMGWGWAGVIWLYSVVTYIPLDFIKFA  848

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+E++SY
Sbjct  849  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETTSIFNERSSY  908

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  909  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  957



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF 
Sbjct  787  ERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFG  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY  SGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SY
Sbjct  847  IRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSY  906

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF++AQL+AT IAVYANW FARIQG GWGWAGV+W+YS+V YIPLD++KFA
Sbjct  788  ERPGLLLLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFA  847

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSG+AW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP +A+N+FS+KNSY
Sbjct  848  IRYVLSGRAWNNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSY  907

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF +AQL+AT++AVYANWGFA I+GCGWGWAGV+WLYSIV Y+PLDI+KFA
Sbjct  786  ERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW+++LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP E S++F++K+SY
Sbjct  846  IRYILSGKAWVSMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL+ATLIAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF 
Sbjct  781  ERPGLLLVTAFIIAQLIATLIAVYANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFG  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW N+ ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPE   +FSEKN+Y
Sbjct  841  IRYFLSGKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIA+QA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  901  RELSEIADQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQLVAT +AVYANWGFARI+G GWGWA V+WLYS+V Y+PLDI+KF 
Sbjct  783  ERPGLLLLGAFFIAQLVATFLAVYANWGFARIKGMGWGWAAVIWLYSLVTYVPLDILKFT  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTSIFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT IAVYANWGFARI+G GWGWAGV+W+YS+V Y PLDI+KF 
Sbjct  783  ERPGLLLLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFV  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PE +NLF++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF 
Sbjct  333  ERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF  392

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR++LSG+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+
Sbjct  393  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKS  452

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  453  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  503



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   311 bits (796),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFLIAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVF++PLD  KFA
Sbjct  785  ERPGLLLVSAFLIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFFVPLDWFKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE+KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S LF+EKNSY
Sbjct  845  IRYILSGKAWDNLLESKTAFTTKKDYGREEREAQWALAQRTLHGLQPPETSALFNEKNSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI TIQQ YT+
Sbjct  905  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  953



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   311 bits (797),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AF +AQL+AT++AVYANWGFA I+GCGWGWAGV+WLYSIV Y+PLDI+KFA
Sbjct  822  ERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFA  881

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW+++LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP E S++F++K+SY
Sbjct  882  IRYILSGKAWVSMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSY  941

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  942  RELSEIAEQAKRRAEVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  990



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQL+AT IAVYANW FARI+G GWGWAGV+W+YSIV YIPLDI+KF 
Sbjct  782  ERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFV  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ P+ +NLF++KNSY
Sbjct  842  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  902  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  950



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQL+AT IAVYANW FARI+G GWGWAGV+W+YSIV YIPLDI+KF 
Sbjct  783  ERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFV  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ P+ +NLF++KNSY
Sbjct  843  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   310 bits (795),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVAT+IAVYA+WGFARI+G GW WAGV+W+YS VF+ PLD  KFA
Sbjct  786  ERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSFVFFFPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFS+K+SY
Sbjct  846  IRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   311 bits (798),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690   ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
             ERPGLLLV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF 
Sbjct  870   ERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFG  929

Query  510   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             IRY  SGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SY
Sbjct  930   IRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSY  989

Query  330   RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  990   RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  1038



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   310 bits (793),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+ L+ AFLIAQLVATLIAVYA+W FA+I+GCGWGWAGV+WLYSIV Y PLDI+KF 
Sbjct  786  ERPGMFLLGAFLIAQLVATLIAVYADWSFAKIKGCGWGWAGVIWLYSIVTYFPLDILKFC  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLEN+TAFTTK +YGKEEREAQWA +QRTLHGLQPPE +NLF+EK+SY
Sbjct  846  IRYVLSGKAWDNLLENRTAFTTKSNYGKEEREAQWAASQRTLHGLQPPETANLFAEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF++AQL+ATLIAVYANWGFA I+GCGWGWAGV+WL+S+V Y+PLD++KFA
Sbjct  786  ERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDVLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW N LENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP + + +FS+K+SY
Sbjct  846  IRYILSGKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTL
Sbjct  906  RELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTL  954



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=954

 Score =   309 bits (791),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG++L+ AFLIAQL+AT++AVYANWGFARI+G GWGWAGV+WLYSIV YIPLDI+KF 
Sbjct  786  ERPGVMLMIAFLIAQLLATILAVYANWGFARIKGMGWGWAGVIWLYSIVTYIPLDILKFM  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW N+LENKTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S++F++KN+Y
Sbjct  846  IRYALSGKAWDNVLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSDIFNDKNNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVAT++AVYANWGFARI+G GWGWAGV+W+YS+VFY PLD++KF 
Sbjct  758  ERPGLLLVTAFIIAQLVATILAVYANWGFARIKGIGWGWAGVIWIYSVVFYFPLDVLKFL  817

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE ++LF+EK +Y
Sbjct  818  IRYSLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWAMAQRTLHGLQPPETTDLFNEKTNY  877

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  878  RELSEIAEQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  926



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVAT +AVYANW FARI+G GWGWAGV+WLYS+V Y+PLDI+KFA
Sbjct  783  ERPGFLLMGAFLIAQLVATFLAVYANWSFARIKGMGWGWAGVIWLYSLVTYVPLDILKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            I Y LSGKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSY
Sbjct  843  IAYALSGKAWNTLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFA
Sbjct  638  ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  697

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNS  334
            IRYILSGKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNS
Sbjct  698  IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNS  757

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  758  YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  807



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   307 bits (787),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFLIAQLVAT IAVYANWGFA+I+GCGWGWAGV+WLYSIVFY PLDI+KF 
Sbjct  782  ERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFF  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY L+GKAW  LL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+ S LF+EK +Y
Sbjct  842  IRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSE+AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE IQQHYT+
Sbjct  902  RELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  950



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   307 bits (787),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AFLIAQLVATLIAVY NW FA I+GCGWGWAGVVWLY+IVFY PLD++KFA
Sbjct  784  ERPGMLLMVAFLIAQLVATLIAVYPNWAFAEIKGCGWGWAGVVWLYNIVFYFPLDVIKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS-NLFSEKNS  334
            IRYILSGKAWLNL E+KTAFT+KKDYGKEEREAQWA AQRTLHGLQ PE+S  LF++KNS
Sbjct  844  IRYILSGKAWLNLFESKTAFTSKKDYGKEEREAQWALAQRTLHGLQAPESSATLFNDKNS  903

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  904  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   307 bits (787),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFLIAQLVAT IAVYANWGFA+I+GCGWGWAGV+WLYSIVFY PLDI+KF 
Sbjct  784  ERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFF  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY L+GKAW  LL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+ S LF+EK +Y
Sbjct  844  IRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSE+AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE IQQHYT+
Sbjct  904  RELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  952



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   306 bits (783),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+ AQLVAT+I+VYANWGFARI+G GWGWAGV+WLYS+V Y+PLD +KFA
Sbjct  694  ERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTGWGWAGVIWLYSVVTYVPLDFLKFA  753

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+FS+K+ Y
Sbjct  754  IRYIQSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSDKSGY  813

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGH+ESVVKLKGLDI+TIQ HYT+
Sbjct  814  RELSEIAEQAKRRAEVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  862



>gb|AAQ19041.1| P-type H+-ATPase [Phaseolus acutifolius]
Length=370

 Score =   292 bits (748),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AFLIAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD +KFA
Sbjct  216  ERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDFLKFA  275

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSY
Sbjct  276  IRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSY  335

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  226
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL
Sbjct  336  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  370



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   307 bits (787),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFLIAQLVAT IAVYANWGFA+I+GCGWGWAGV+WLYSIVFY PLDI+KF 
Sbjct  790  ERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFF  849

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY L+GKAW  LL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+ S LF+EK +Y
Sbjct  850  IRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNY  909

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSE+AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE IQQHYT+
Sbjct  910  RELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  958



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF IAQLVATLIAVYANWGFARIQG GWGWAGV WLYS+VFY PLD++KFA
Sbjct  785  ERPGLLLVTAFFIAQLVATLIAVYANWGFARIQGMGWGWAGVAWLYSLVFYFPLDLLKFA  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN-LFSEKNS  334
            IRYILSGKAWL+L +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPP+ +N +FSEK+S
Sbjct  845  IRYILSGKAWLSLFDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPQTTNAMFSEKSS  904

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQA+RRAE+ARLREL TLKGHVESV KLKG+DIETIQQ YT+
Sbjct  905  YRELSEIAEQARRRAEMARLRELQTLKGHVESVAKLKGIDIETIQQSYTV  954



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   307 bits (786),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYAN+GFARI G GWGWAGV+WLYSIVFYIPLD++KF 
Sbjct  794  ERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWAGVIWLYSIVFYIPLDVLKFI  853

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            +RY L+GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S L ++KN+Y
Sbjct  854  VRYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNY  913

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  914  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKF 
Sbjct  717  ERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFG  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW+NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SY
Sbjct  777  IRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+    HYT+
Sbjct  837  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  885



>gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score =   306 bits (785),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFA
Sbjct  784  ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNS  334
            IRYILSGKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNS
Sbjct  844  IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNS  903

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|EPS63245.1| hypothetical protein M569_11541, partial [Genlisea aurea]
Length=935

 Score =   306 bits (784),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL++AFL+AQLVAT+IAVYA+WGFARI+GCGWGWAGV+W+YS+VFY+PLD +KFA
Sbjct  767  ERPGLLLMSAFLVAQLVATIIAVYADWGFARIKGCGWGWAGVIWIYSVVFYVPLDFIKFA  826

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFTTK +YGKE+REAQWA AQRTLHGLQ  E S++ +EKNSY
Sbjct  827  IRYILSGKAWLNLYENKTAFTTKSNYGKEDREAQWALAQRTLHGLQTTETSSVMNEKNSY  886

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ+YT+
Sbjct  887  RELSEIAEQAKKRAEIARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  935



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   306 bits (785),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  791  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFF  850

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KN
Sbjct  851  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKN  910

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  911  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  961



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =   306 bits (785),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFA
Sbjct  784  ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNS  334
            IRYILSGKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNS
Sbjct  844  IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNS  903

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =   306 bits (785),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFA
Sbjct  784  ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNS  334
            IRYILSGKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNS
Sbjct  844  IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNS  903

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  781  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KN
Sbjct  841  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKN  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+ AQLVAT+I+VYANWGFARI+G GWGWAGV+WLYS+V Y+PLD +KFA
Sbjct  786  ERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTGWGWAGVIWLYSVVTYVPLDFLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYI SGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+FS+K+ Y
Sbjct  846  IRYIQSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSDKSGY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGH+ESVVKLKGLDI+TIQ HYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  954



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+IAQL+ATL+AVYANW FA+I G GWGWAGV+WLYSIVFYIPLD++KFA
Sbjct  566  ERPGLLLVAAFIIAQLIATLLAVYANWAFAKIHGIGWGWAGVIWLYSIVFYIPLDVLKFA  625

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NL++NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE + +F +KN Y
Sbjct  626  IRYALSGKAWDNLVQNKTAFTTKKDYGRGEREAQWAAAQRTLHGLQPPETAEIFQDKN-Y  684

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  685  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  733



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFLIAQLVATLI+VYANWGFARI+G GWGWAGV+WLYSIVF++PLD  KFA
Sbjct  786  ERPGLLLVSAFLIAQLVATLISVYANWGFARIKGIGWGWAGVIWLYSIVFFLPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RYILSGKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S LF+EK+SY
Sbjct  846  TRYILSGKAWDNLLERKTAFTTKKDYGREEREAQWATAQRTLHGLQPPETSTLFNEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI TIQQ YT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  954



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+ AQLVATLIAVYA WGFARI+G GWGWAGV+WLYS+V Y+PLDI+KFA
Sbjct  786  ERPGLLLVSAFVAAQLVATLIAVYAEWGFARIKGTGWGWAGVIWLYSLVTYVPLDILKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSG+AW +LLENKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPE SN  S+K SY
Sbjct  846  IRYILSGRAWNSLLENKTAFTSKKDYGKEEREAQWATAQRTLHGLQPPETSNQKSDKGSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI++IQQHYT 
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDSIQQHYTF  954



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 163/171 (95%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  781  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEAS+  LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 163/171 (95%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  781  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEAS+  LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF++AQL+ATLIAVYANWGFA I+GCGWGWAGV+WL+S+V Y+PLD++KFA
Sbjct  786  ERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDLLKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW N LENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP + + +FS+K+SY
Sbjct  846  IRYILSGKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+ IQQHYTL
Sbjct  906  RELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDRIQQHYTL  954



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  812  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFF  871

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KN
Sbjct  872  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKN  931

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  932  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  982



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LL+ AF+IAQLVATL+AVYANW FA+I+G GWGWAGVVW+YS+VFYIPLD +KFA
Sbjct  784  ERPGMLLMGAFVIAQLVATLLAVYANWEFAKIKGAGWGWAGVVWIYSVVFYIPLDFIKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNS  334
            IRYILSGKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNS
Sbjct  844  IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNS  903

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  904  YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKF 
Sbjct  782  ERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFG  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW+NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SY
Sbjct  842  IRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+    HYT+
Sbjct  902  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  950



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKF 
Sbjct  782  ERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFG  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW+NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SY
Sbjct  842  IRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+    HYT+
Sbjct  902  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  950



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   305 bits (782),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYAN+GFARI G GWGW GV+WLYSIVFYIPLD++KF 
Sbjct  794  ERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFI  853

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            +RY L+GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S L ++KN+Y
Sbjct  854  VRYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNY  913

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  914  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   305 bits (781),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVATLIAVYAN+GFARI G GWGW GV+WLYSIVFYIPLD++KF 
Sbjct  794  ERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFI  853

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            +RY L+GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S L ++KN+Y
Sbjct  854  VRYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNY  913

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  914  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   305 bits (780),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGL+LV AFLIAQLVATLIAVYA W FARI G GWGWAGV+W++S+VFY PLDI+KF 
Sbjct  786  ERPGLMLVFAFLIAQLVATLIAVYAKWHFARISGIGWGWAGVIWIFSVVFYFPLDILKFL  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S+LF++K+SY
Sbjct  846  IRYGLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQPPETSSLFNDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 162/171 (95%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD+ KF 
Sbjct  781  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIEGIGWGWAGVVWLYSIVFYFPLDLFKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA++  LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAASNTLFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 162/171 (95%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF 
Sbjct  781  ERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS--NLFSEKN  337
            IR++LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA+   LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATNTLFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_006293643.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
 gb|EOA26541.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
Length=931

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS++ YIPLD++KF 
Sbjct  763  ERPGLLLLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFG  822

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY
Sbjct  823  IRYVLSGKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSY  882

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             +LS+IAEQAKRRAEV RLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  883  HDLSQIAEQAKRRAEVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  931



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFLIAQL+AT+IAVY +W FARIQG GWGWAGV+WLYSIVFY+PLD++KF 
Sbjct  785  ERPGLLLVTAFLIAQLIATIIAVYGDWKFARIQGIGWGWAGVIWLYSIVFYVPLDVLKFI  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NL++N+TAFTTKKDYG+ EREAQWA AQRTLHGLQPPE + LF +KN Y
Sbjct  845  IRYALSGKAWDNLVQNRTAFTTKKDYGRGEREAQWAAAQRTLHGLQPPETAELFQDKN-Y  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|KHN38020.1| Plasma membrane ATPase [Glycine soja]
Length=885

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL+AT+IAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF 
Sbjct  717  ERPGLLLVTAFVIAQLIATIIAVYANWGFARMKGIGWGWAGVIWLYSIIFYIPLDFLKFG  776

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW N+ ENKTAFTTKKDYGKEEREAQW  AQRTLHGL PPE   +FSEKN+Y
Sbjct  777  IRYFLSGRAWNNITENKTAFTTKKDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNNY  836

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELS+IA+QA++RAEVARLREL+TLKGHVESVVKLKGLDI TIQQHYT+
Sbjct  837  RELSDIADQARKRAEVARLRELYTLKGHVESVVKLKGLDIGTIQQHYTV  885



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG  L+ AF+IAQL+AT+IAVYANWGFARI G GWGWAGV+WLYS++ Y+PLDI+KF 
Sbjct  786  ERPGFFLLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW N+LE KTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S LF++KN+Y
Sbjct  846  IRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 163/171 (95%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLVTAFL+AQLVATLIAVYA+WGFARI+G GWGWAGVVWLYS+VFY+PLD+ KF 
Sbjct  781  ERPGVLLVTAFLLAQLVATLIAVYADWGFARIKGIGWGWAGVVWLYSVVFYLPLDVFKFL  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR+ LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF+EK+
Sbjct  841  IRFALSGRAWDNLLENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AFLIAQL+AT+IAVYA+WGFARI G GWGWAGV+WLYSIVFYIPLDI+KF 
Sbjct  786  ERPGLLLVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW N+LE KTAFTTKKDYGK EREAQWA AQRTLHGLQ  E + LFS+KN+Y
Sbjct  846  IRYALSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQSAETAELFSDKNNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   302 bits (774),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL  AF++AQLVATLIAVYANWGFA+I+GCGWGWAG++WLYS + +IPLD +KF+
Sbjct  786  ERPGLLLCGAFVVAQLVATLIAVYANWGFAKIKGCGWGWAGIIWLYSFITFIPLDWIKFS  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSG+AW +L E +TAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLFS+K+SY
Sbjct  846  IRYILSGRAWDSLFERRTAFTTKKDYGREEREAQWAIAQRTLHGLQPPETTNLFSDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEKAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   302 bits (774),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF IAQL+ATLIAVYANWGFARI GCGWGWAGV+WLYS+VFY+PLD+MKFA
Sbjct  784  ERPGALLMIAFCIAQLIATLIAVYANWGFARISGCGWGWAGVIWLYSLVFYVPLDLMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RYILSGKAW NL +NK AFT K DYGKEEREAQWA AQRTLHGLQ  EASN+F +K+SY
Sbjct  844  TRYILSGKAWQNLYDNKIAFTAKNDYGKEEREAQWALAQRTLHGLQTSEASNVFHDKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESV+KLKGLDIETI QHYT+
Sbjct  904  RELSEIAEQAKRRAEIARLRELHTLKGHVESVMKLKGLDIETIPQHYTV  952



>ref|XP_003531728.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   302 bits (773),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQL+AT+IAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF 
Sbjct  781  ERPGLLLVTAFVIAQLIATIIAVYANWGFARMKGIGWGWAGVIWLYSIIFYIPLDFLKFG  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW N+ ENKTAFTTKKDYGKEEREAQW  AQRTLHGL PPE   +FSEKN Y
Sbjct  841  IRYFLSGRAWNNITENKTAFTTKKDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNKY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELS+IA+QA++RAEVARLREL+TLKGHVESVVKLKGLDI TIQQHYT+
Sbjct  901  RELSDIADQARKRAEVARLRELYTLKGHVESVVKLKGLDIGTIQQHYTV  949



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   302 bits (773),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF++AQL+AT+IAVYANW FAR+QG GWGWAGV+WLYSIVFY+PLD++KF 
Sbjct  781  ERPGLLLVSAFIVAQLIATVIAVYANWEFARMQGIGWGWAGVIWLYSIVFYLPLDVLKFG  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW N+ ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPE    FSE+N+Y
Sbjct  841  IRYFLSGKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEPTFSERNNY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQA++RAEVARLRELHTLKGH+ESVVKLKGLDI+TIQ HYT+
Sbjct  901  RELSEIAEQARKRAEVARLRELHTLKGHMESVVKLKGLDIDTIQHHYTV  949



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   301 bits (771),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF 
Sbjct  738  ERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF  797

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR++LSG+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+
Sbjct  798  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKS  857

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  858  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  908



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   301 bits (772),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG+LLVTAFL+AQLVATLIAVYANWGFARI+G GWGWAGVVWLYS+V Y PLD+ KF 
Sbjct  781  ERPGVLLVTAFLLAQLVATLIAVYANWGFARIKGIGWGWAGVVWLYSVVLYFPLDVFKFL  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR+ LSG+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF+EK+
Sbjct  841  IRFALSGRAWDNLLENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AFL AQL+ATLIAVYA WGFARIQG GWGWAGV+W+YSI+FY PLD +KF 
Sbjct  786  ERPGLLLVSAFLAAQLLATLIAVYAKWGFARIQGIGWGWAGVIWVYSIIFYFPLDPLKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IR+ LSGKAW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ S L ++KNSY
Sbjct  846  IRFALSGKAWDNLLENKTAFTTKKDYGREEREAQWALAQRTLHGLQPPDLSGLLNDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  954



>ref|XP_010472461.1| PREDICTED: ATPase 5, plasma membrane-type [Camelina sativa]
Length=957

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT IAVYA+W FARI+G GWGWAGV+WLYS++ YIPLD++KF 
Sbjct  789  ERPGLLLLGAFVIAQLVATFIAVYADWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFG  848

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY
Sbjct  849  IRYVLSGKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSY  908

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELS+IAEQAKRRAEV RLRE+++LKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  SELSQIAEQAKRRAEVVRLREINSLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+TAF+IAQL+AT IAVYA+WGFA+I+G GWGWAGV+WLYS+V Y PLD+MKFA
Sbjct  781  ERPGLLLMTAFVIAQLIATFIAVYADWGFAKIKGIGWGWAGVIWLYSLVTYFPLDVMKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E+ N+F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPKESGNIFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDT-PGHYTV  948



>ref|XP_010429928.1| PREDICTED: ATPase 9, plasma membrane-type-like [Camelina sativa]
Length=276

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 154/170 (91%), Gaps = 1/170 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG  L+ AFLIAQL+ATLIAVYANW FARI+G GWGWAGV+WLY+IV YIPLDI+KF 
Sbjct  107  ERPGFWLIFAFLIAQLIATLIAVYANWDFARIRGTGWGWAGVIWLYTIVTYIPLDILKFI  166

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP-EASNLFSEKNS  334
            IRY LSG+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQP  ++S++F++K++
Sbjct  167  IRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPAHQSSDMFNDKST  226

Query  333  YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            YRELSEIA+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  227  YRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  276



>gb|KJB70727.1| hypothetical protein B456_011G089100 [Gossypium raimondii]
Length=953

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF++AQL+ATL+AVYANWGFARI+G GWGWAGV+WLYS+VFY+PLD++KF 
Sbjct  785  ERPGLLLVVAFILAQLIATLLAVYANWGFARIKGIGWGWAGVIWLYSLVFYVPLDVLKFL  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYGK EREAQWA AQRTLHGL PPE + L++E+ +Y
Sbjct  845  IRYSLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWAMAQRTLHGLTPPEMTQLYNEETNY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGL+LV AFLIAQL+AT+IAVYA+WGFARI G GWGWAGV+WLYSIVFYIPLDI+KF 
Sbjct  786  ERPGLMLVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW N+LE KTAFTTKKDYG+ EREAQWA AQRTLHGLQ  E + LFS+KN+Y
Sbjct  846  IRYALSGKAWDNVLERKTAFTTKKDYGRGEREAQWATAQRTLHGLQSAETAELFSDKNNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAD29313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=948

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF 
Sbjct  778  ERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF  837

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR++LSG+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+
Sbjct  838  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKS  897

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  898  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  948



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF 
Sbjct  781  ERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR++LSG+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS+VFYIPLD++KFA
Sbjct  783  ERPGLLLVFAFFVAQLVATLIAVYANWGFADMKGIGWGWAGVIWIYSVVFYIPLDVLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S+LF++K +Y
Sbjct  843  TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSDLFNDKTNY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  903  RELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF 
Sbjct  781  ERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR++LSG+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS++FYIPLD++KFA
Sbjct  722  ERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFA  781

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S LF++K +Y
Sbjct  782  TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNY  841

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  842  RELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  890



>gb|KFK32649.1| hypothetical protein AALP_AA6G270500 [Arabis alpina]
Length=838

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS++ YIPLD++KFA
Sbjct  670  ERPGLLLLGAFFIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFA  729

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNLLENKTAFT KKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNS+
Sbjct  730  IRYILSGKAWLNLLENKTAFTMKKDYGKEEREAQWAAAQRTLHGLQPAERNNIFNEKNSF  789

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAEV RLREL+TLK  VESVVKLKGLDI+TIQQHYT+
Sbjct  790  SELSEIAEQAKRRAEVVRLRELNTLKRQVESVVKLKGLDIDTIQQHYTV  838



>gb|AAF27113.1|AC018849_1 aha9, 5' partial; 1-2403 [Arabidopsis thaliana]
Length=612

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG  L++AF +AQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIVFYIPLDI+KF 
Sbjct  444  ERPGFWLISAFFMAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFI  503

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQP + S++F++K++Y
Sbjct  504  IRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTY  563

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIA+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  564  RELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  612



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG  L+ AF+IAQL+AT+IAVYANWGFARI G GWGWAGV+WLYS++ Y+PLDI+KF 
Sbjct  786  ERPGFFLLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW N+LE KTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S LF++KN+Y
Sbjct  846  IRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  GELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   300 bits (769),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LLV AF IAQL+AT+IAVYANWGFA++QG GWGWAGV+WLYSIVFYIPLD+MKFA
Sbjct  784  ERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFA  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F+EK+SY
Sbjct  844  IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE  208
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK + ++
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKAIKVK  944



>emb|CDY03545.1| BnaC03g68040D [Brassica napus]
Length=660

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVATLIAVYANW FA+++G GWGWAGV+WLYSIV Y P DI KFA
Sbjct  493  ERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFA  552

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  553  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  612

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  613  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  660



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+IAQLVAT++AVYANWGFAR++G GWGWAGV+W+YSIVFYIPLDI+KF 
Sbjct  785  ERPGLLLVTAFIIAQLVATILAVYANWGFARMKGIGWGWAGVIWIYSIVFYIPLDILKFF  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P + ++ ++KNS+
Sbjct  845  IRYSLSGKAWDNLLQNKTAFTTKKDYGREEREAQWATAQRTLHGLQTPGSVDILNDKNSH  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAK+RAEVARLRE HTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  EELSEIAEQAKKRAEVARLREFHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   300 bits (767),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 160/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF++AQLVAT IAVYANW FARI+G GWGWAGV+WLYSIVFY PLDI KF 
Sbjct  781  ERPGLLLVTAFMLAQLVATFIAVYANWSFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFF  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKN  337
            IR++LSG+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+
Sbjct  841  IRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNALFNDKS  900

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  901  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   300 bits (767),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFLIAQL+AT IAVYA+WGFA+I+G GWGWAGV+WLYS+V Y PLD+MKFA
Sbjct  781  ERPGLLLVTAFLIAQLIATFIAVYADWGFAKIKGIGWGWAGVIWLYSLVTYFPLDVMKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NL ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E  N+F EK SY
Sbjct  841  IRYILSGKAWTNLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPKEQVNIFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDT-PGHYTV  948



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   300 bits (767),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGL+L+ AF++AQL+ATLIAVYANW FA+I+G GWGWA  VW+Y++V YIPLDI+KF 
Sbjct  785  ERPGLMLLGAFVVAQLIATLIAVYANWSFAKIEGMGWGWALAVWIYTLVTYIPLDILKFT  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW NLL+NKTAFTTKKDYGKEEREAQWA AQRT+HGLQPPE +NLF EK++Y
Sbjct  845  IRYALSGRAWNNLLDNKTAFTTKKDYGKEEREAQWAAAQRTMHGLQPPETTNLFPEKSNY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  905  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   300 bits (767),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS++FYIPLD++KFA
Sbjct  783  ERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S LF++K +Y
Sbjct  843  TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  903  RELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|NP_180028.1| H(+)-ATPase 5 [Arabidopsis thaliana]
 gb|AAD23893.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC07588.1| H(+)-ATPase 5 [Arabidopsis thaliana]
Length=931

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            E PGLLL+ AF+IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS + YIPLD++KF 
Sbjct  763  ECPGLLLLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLLKFG  822

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY
Sbjct  823  IRYVLSGKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSY  882

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELS+IAEQAKRRAEV RLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  883  SELSQIAEQAKRRAEVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   300 bits (767),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 157/169 (93%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF IAQL+AT+IAVYANWGFARI+G GWGWAGV+WLYSIV YIPLDI+KF 
Sbjct  795  ERPGLLLLGAFFIAQLIATIIAVYANWGFARIRGIGWGWAGVIWLYSIVTYIPLDILKFI  854

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW N+LENKTAFTTKKDYGK +REAQWA AQRTLHGLQPPE + LF +KN Y
Sbjct  855  IRYILSGKAWDNVLENKTAFTTKKDYGKGDREAQWATAQRTLHGLQPPETAELFHDKN-Y  913

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  914  RELSEIAEQAKKRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  962



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   300 bits (767),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS++FYIPLD++KFA
Sbjct  783  ERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFA  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S LF++K +Y
Sbjct  843  TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  903  RELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   299 bits (766),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFA
Sbjct  781  ERPGALLMIAFLIAQLIATLIAVYANWQFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWAHAQRTLHGLQP EA N F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWAHAQRTLHGLQPKEADNTFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   299 bits (766),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFA
Sbjct  781  ERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWAHAQRTLHGLQP EA N F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWAHAQRTLHGLQPKEADNTFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>sp|Q9SJB3.3|PMA5_ARATH RecName: Full=ATPase 5, plasma membrane-type; AltName: Full=Proton 
pump 5 [Arabidopsis thaliana]
Length=949

 Score =   299 bits (766),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            E PGLLL+ AF+IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS + YIPLD++KF 
Sbjct  781  ECPGLLLLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLLKFG  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY
Sbjct  841  IRYVLSGKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELS+IAEQAKRRAEV RLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  901  SELSQIAEQAKRRAEVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   299 bits (766),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+ AQLVAT IAVY +WGFARI+G GWGWAG +WL+SI+ Y PLDI+KF 
Sbjct  784  ERPGLLLVGAFIAAQLVATCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFI  843

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE SNLF++ +SY
Sbjct  844  IRYGLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSY  903

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  904  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   299 bits (766),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL AQLVATLIAVYA+WGFARI G GWGWAGV+W++SIV Y PLDI+KF 
Sbjct  783  ERPGLLLVTAFLAAQLVATLIAVYASWGFARIDGIGWGWAGVIWIFSIVTYFPLDILKFI  842

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW NL++NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  + SNLF++KN+Y
Sbjct  843  IRYALSGRAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSNLFNDKNNY  902

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  903  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   299 bits (765),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF++AQL+ATLIAVYANW FA I G GWGWAGV+WLYS++FYIPLD+MKF 
Sbjct  788  ERPGLLLVGAFVVAQLIATLIAVYANWEFAYIHGIGWGWAGVIWLYSVIFYIPLDVMKFF  847

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY L+G+AW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S++ ++KN+Y
Sbjct  848  IRYCLTGRAWNNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPENSDILNDKNNY  907

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  908  RELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   299 bits (765),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF+ AQLVAT IAVY +WGFARI+G GWGWAG +WL+SI+ Y PLDI+KF 
Sbjct  799  ERPGLLLVGAFIAAQLVATCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFI  858

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE SNLF++ +SY
Sbjct  859  IRYGLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSY  918

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  919  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  967



>gb|AAQ19039.1| P-type H+-ATPase [Vicia faba]
Length=370

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT IAVYANWGFARI+G GWGWAGV+W+YS+V Y PLDI+KF 
Sbjct  216  ERPGLLLLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFV  275

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSGKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PE +NLF++KNSY
Sbjct  276  IRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSY  335

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  226
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL
Sbjct  336  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  370



>gb|EPS59184.1| hypothetical protein M569_15622, partial [Genlisea aurea]
Length=522

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AFL AQL+ATLIAVYANWGFA+IQG GWGWAGV+WLY+I+FYIPLD+ KF 
Sbjct  354  ERPGLLLVFAFLAAQLIATLIAVYANWGFAKIQGIGWGWAGVIWLYNIIFYIPLDVFKFI  413

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW ++LENK AFT+KKDYG+ EREAQWA AQRTLHGLQ P  S LF +K++Y
Sbjct  414  IRYALSGKAWNHMLENKIAFTSKKDYGRGEREAQWAMAQRTLHGLQAPNTSELFHDKSNY  473

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQA +RAEVARLRELHTLKGHVESVVK KGLDI+TIQQHYT+
Sbjct  474  RELSEIAEQAMKRAEVARLRELHTLKGHVESVVKRKGLDIDTIQQHYTV  522



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+ AQLVAT+IAVYA+W FARIQG GWGWA  +W+YS++ YIPLDI+KF 
Sbjct  782  ERPGLLLVTAFIAAQLVATVIAVYASWSFARIQGIGWGWAAFIWVYSVITYIPLDILKFI  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY+LSGKAW NLL+NKTAFT+KKDYG+ EREAQWA AQRTLHGLQ P+ S LF++KNSY
Sbjct  842  TRYVLSGKAWDNLLQNKTAFTSKKDYGRGEREAQWAMAQRTLHGLQSPDTSALFNDKNSY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  902  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   298 bits (762),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LLV AF++AQLVATLIAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKFA
Sbjct  789  ERPGTLLVIAFILAQLVATLIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDLMKFA  848

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWL+LL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ  EA  +  EK SY
Sbjct  849  IRYILSGKAWLSLLDNKTAFTTKKDYGREEREAQWALAQRTLHGLQSKEAVGILPEKGSY  908

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T   HYT+
Sbjct  909  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTPSGHYTV  957



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV+AF+IAQLVATLIAVYA+W FARI+G GWGWAGV+WLYSIVF++PLD  KFA
Sbjct  786  ERPGLLLVSAFMIAQLVATLIAVYADWSFARIKGVGWGWAGVIWLYSIVFFVPLDWFKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NLLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQP E S LFSEK+SY
Sbjct  846  IRYILSGKAWDNLLERKTAFTSKKDYGREEREAQWATAQRTLHGLQPRETSTLFSEKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAE+A+LREL+TLKGHVESVVKLKGLDI TIQQ YT+
Sbjct  906  HELSEIAEQAKRRAEIAKLRELNTLKGHVESVVKLKGLDINTIQQSYTV  954



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            +RPGLLL  AF+IAQL+ATL+AVYANW FARI+GCGWGWAG++WLYS++ +IPLD +KFA
Sbjct  786  DRPGLLLCCAFVIAQLIATLVAVYANWSFARIKGCGWGWAGIIWLYSLISFIPLDWIKFA  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY+LSG AW  L E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ ++LF++K+SY
Sbjct  846  IRYVLSGNAWTYLFERKTAFTTKKDYGREEREAQWAIAQRTLHGLQPPDTTSLFNDKSSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  906  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  954



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF+IAQLVAT+IAVYANWGFARI G GWGWAGV+WLYSI+FYIPLDI+KFA
Sbjct  787  ERPGLLLLAAFVIAQLVATIIAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILKFA  846

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW N++ENK AFT+KKDYG+ EREAQWA AQRTLHGLQP ++S +F  K SY
Sbjct  847  IRYTLSGRAWNNMMENKVAFTSKKDYGRGEREAQWALAQRTLHGLQPSDSSQVFDNK-SY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  MELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>dbj|BAD94367.1| plasma membrane proton ATPase [Arabidopsis thaliana]
Length=262

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF+IAQLVATLIAVYA+W FA+++G GWGWAGV+W+YSIV Y P DI+KFA
Sbjct  94   ERPGALLMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAGVIWIYSIVTYFPQDILKFA  153

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW +L +N+TAFTTKKDYG  EREAQWA AQRTLHGLQP E  N+F EK SY
Sbjct  154  IRYILSGKAWASLFDNRTAFTTKKDYGIGEREAQWAQAQRTLHGLQPKEDVNIFPEKGSY  213

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESV KLKGLDI+T   HYT+
Sbjct  214  RELSEIAEQAKRRAEIARLRELHTLKGHVESVAKLKGLDIDTAGHHYTV  262



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   297 bits (760),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLL+ AF +AQL+ATLIAVYANWGFARI G GWGWAGV+WLYSI+ Y PLDI KF 
Sbjct  786  ERPGLLLLFAFAVAQLIATLIAVYANWGFARISGIGWGWAGVIWLYSIITYSPLDIFKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            +RY LSGKAW  LL+NKTAFT+KKDYGK EREAQWA AQRTLHGLQPPE+S +F++K +Y
Sbjct  846  VRYALSGKAWDTLLQNKTAFTSKKDYGKGEREAQWALAQRTLHGLQPPESSQIFNDKTNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            REL+E+AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  RELTELAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   297 bits (760),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+ AQLVAT+IA YA+WGFARIQG GWGWAG++WL+S+V Y PLD++KF 
Sbjct  788  ERPGLLLVTAFIAAQLVATVIAAYASWGFARIQGIGWGWAGIIWLFSLVTYFPLDVLKFI  847

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGLQP +   LF++K+SY
Sbjct  848  IRYTLSGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLQPADTPGLFNDKSSY  907

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  908  RELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>gb|KJB56561.1| hypothetical protein B456_009G125200 [Gossypium raimondii]
Length=953

 Score =   296 bits (758),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AF++AQLVAT++AVYANWGFARI+G GW WAGV+WLYSIVFYIPLD++KF 
Sbjct  785  ERPGLLLVVAFILAQLVATVLAVYANWGFARIKGIGWPWAGVIWLYSIVFYIPLDVLKFL  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P A  + +EK+SY
Sbjct  845  IRYALSGKAWDNLLQNKTAFTTKKDYGREEREAQWATAQRTLHGLQAPGAEEILNEKSSY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAK+RAEVARLRELHTLKGHV+SVVKLKGLDIETI Q+YT+
Sbjct  905  RELSEIAEQAKKRAEVARLRELHTLKGHVDSVVKLKGLDIETINQNYTV  953



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANWGFA+++G GWGWAGV+WLYSIV Y P DI KFA
Sbjct  781  ERPGALLMIAFLIAQLIATLIAVYANWGFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  948



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANWGFA+++G GWGWAGV+WLYSIV Y P DI KFA
Sbjct  781  ERPGALLMIAFLIAQLIATLIAVYANWGFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  948



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFA
Sbjct  781  ERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFA
Sbjct  781  ERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFA  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  841  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  901  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   296 bits (757),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFA
Sbjct  814  ERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFA  873

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  874  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  933

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  934  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  981



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   295 bits (755),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LLV AF+ AQLVAT+IAVYA+W FARIQG GWGWAG++WL+S++ Y PLDI+KF 
Sbjct  781  ERPGFLLVAAFVAAQLVATVIAVYASWSFARIQGIGWGWAGIIWLFSLITYFPLDILKFI  840

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQP + S+LF++K+SY
Sbjct  841  IRYALSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPADTSDLFNDKSSY  900

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  901  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+ AQLVAT+IAVYA+WGFARI+G GWGWA  +W+YS++ YIPLDI+KF 
Sbjct  782  ERPGLLLVTAFIAAQLVATVIAVYASWGFARIEGIGWGWAAFIWVYSVITYIPLDILKFI  841

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW NLL+NKTAFT+KKDYG+ EREAQW  AQRTLHGLQPP+ S LF++KN Y
Sbjct  842  TRYALSGKAWDNLLQNKTAFTSKKDYGRGEREAQWVMAQRTLHGLQPPDTSGLFNDKNGY  901

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  902  TELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   295 bits (756),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAF+ AQLVAT+IAVYA+WGFARI+G GWGWA  +W+YS++ YIPLDI+KF 
Sbjct  811  ERPGLLLVTAFIAAQLVATVIAVYASWGFARIEGIGWGWAAFIWVYSVITYIPLDILKFI  870

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
             RY LSGKAW NLL+NKTAFT+KKDYG+ EREAQW  AQRTLHGLQPP+ S LF++KN Y
Sbjct  871  TRYALSGKAWDNLLQNKTAFTSKKDYGRGEREAQWVMAQRTLHGLQPPDTSGLFNDKNGY  930

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
             ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  931  TELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  979



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGL LV AF +AQLVA+LIAVYANW FARI+G GWGWAGV+WLYSIV YIPLDI+KF 
Sbjct  785  ERPGLWLVAAFFVAQLVASLIAVYANWNFARIRGIGWGWAGVIWLYSIVTYIPLDILKFI  844

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSG+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQPP+ S++F++K++Y
Sbjct  845  IRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPPQTSDMFNDKSTY  904

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIA+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  905  RELSEIADQAKRRAEVARLRECHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLV AFLIAQLVAT IAVYANW FARI G GWGWAG++WLYSI+FYIPLDI KF 
Sbjct  786  ERPGLLLVAAFLIAQLVATFIAVYANWEFARIYGIGWGWAGIIWLYSIIFYIPLDIFKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            I+Y LSG+AW N++ENKTAFT+KKDYG+ EREAQWA AQRTLHGLQP +A  LF++KN+Y
Sbjct  846  IKYGLSGRAWNNMIENKTAFTSKKDYGRGEREAQWAMAQRTLHGLQPTDAPELFADKNNY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            REL+EIAEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQ+YT+
Sbjct  906  RELTEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  954



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   295 bits (754),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPGLLLVTAFL AQLVAT+I+VYA+WGFARI G GW WAGV+W++SIV Y PLDI+KF 
Sbjct  786  ERPGLLLVTAFLAAQLVATVISVYASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFI  845

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRY LSGKAW NL++NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  + S+LF++KNSY
Sbjct  846  IRYALSGKAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSY  905

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  906  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>emb|CAC50884.1| plasma membrane H+-ATPase [Hordeum vulgare subsp. vulgare]
Length=635

 Score =   288 bits (736),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 156/171 (91%), Gaps = 2/171 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LLV AFL+AQLVATLIAVYANWGFARI G GWGWAGV+WL+SIVFY PLDI KF 
Sbjct  465  ERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAGVIWLFSIVFYFPLDIFKFF  524

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKN  337
            IR++LSG+AW NLL+NKTAFTTK++YGK EREAQWA AQRTLHGLQ PE ++  LF++K+
Sbjct  525  IRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFNDKS  584

Query  336  SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            SYRELSEIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TI Q+YT+
Sbjct  585  SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV  635



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   293 bits (751),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVATLIAVYANW FA+++G GWGWAGV+WLYSIV Y P DI KFA
Sbjct  772  ERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFA  831

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  832  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  891

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  892  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-SGHYTV  939



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   293 bits (751),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AFLIAQLVATLIAVYANW FA+++G GWGWAGV+WLYSIV Y P DI KFA
Sbjct  780  ERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFA  839

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SY
Sbjct  840  IRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSY  899

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  900  RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-SGHYTV  947



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  690  ERPGLLLVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFA  511
            ERPG LL+ AF IAQLVATLIA YANWGFA+I+G GWGWAGV+WLYSIV ++PLD++KFA
Sbjct  796  ERPGFLLLIAFCIAQLVATLIATYANWGFAKIKGIGWGWAGVIWLYSIVTFLPLDVLKFA  855

Query  510  IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSY  331
            IRYILSGKAW NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ  E+  LF++  +Y
Sbjct  856  IRYILSGKAWNNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQTNESQTLFADTRNY  915

Query  330  RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  184
            RELSEIAEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  916  RELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  964



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050