BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026A21

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610681.1|  PREDICTED: probable galacturonosyltransferase 4    246   4e-73   
ref|XP_004236640.1|  PREDICTED: probable galacturonosyltransferas...    240   3e-71   Solanum lycopersicum
ref|XP_010319211.1|  PREDICTED: probable galacturonosyltransferas...    240   4e-71   Solanum lycopersicum
ref|XP_006350232.1|  PREDICTED: probable galacturonosyltransferas...    239   1e-70   Solanum tuberosum [potatoes]
ref|XP_006350235.1|  PREDICTED: probable galacturonosyltransferas...    239   1e-70   Solanum tuberosum [potatoes]
ref|XP_009802396.1|  PREDICTED: probable galacturonosyltransferas...    239   1e-70   Nicotiana sylvestris
ref|XP_009802392.1|  PREDICTED: probable galacturonosyltransferas...    239   1e-70   Nicotiana sylvestris
ref|XP_011086294.1|  PREDICTED: probable galacturonosyltransferase 4    235   2e-69   Sesamum indicum [beniseed]
ref|XP_004486385.1|  PREDICTED: probable galacturonosyltransferas...    226   7e-66   Cicer arietinum [garbanzo]
gb|EYU33824.1|  hypothetical protein MIMGU_mgv1a002625mg                225   1e-65   Erythranthe guttata [common monkey flower]
ref|XP_010096508.1|  putative galacturonosyltransferase 4               224   3e-65   
ref|XP_011095865.1|  PREDICTED: probable galacturonosyltransferase 4    224   5e-65   
gb|EYU27625.1|  hypothetical protein MIMGU_mgv1a004359mg                221   6e-65   Erythranthe guttata [common monkey flower]
emb|CDP04556.1|  unnamed protein product                                223   1e-64   Coffea canephora [robusta coffee]
ref|XP_010272524.1|  PREDICTED: probable galacturonosyltransferase 4    222   3e-64   Nelumbo nucifera [Indian lotus]
ref|XP_003630116.1|  Nudix hydrolase                                    223   4e-64   
ref|XP_003630117.1|  Nudix hydrolase                                    223   5e-64   
ref|XP_010910633.1|  PREDICTED: probable galacturonosyltransferas...    220   8e-64   Elaeis guineensis
gb|KDO78639.1|  hypothetical protein CISIN_1g005035mg                   218   1e-63   Citrus sinensis [apfelsine]
ref|XP_006467237.1|  PREDICTED: probable galacturonosyltransferas...    219   1e-63   Citrus sinensis [apfelsine]
gb|KDO78642.1|  hypothetical protein CISIN_1g005035mg                   219   1e-63   Citrus sinensis [apfelsine]
ref|XP_006449976.1|  hypothetical protein CICLE_v10014426mg             219   2e-63   Citrus clementina [clementine]
ref|XP_010052503.1|  PREDICTED: probable galacturonosyltransferas...    219   2e-63   Eucalyptus grandis [rose gum]
ref|XP_010052506.1|  PREDICTED: probable galacturonosyltransferas...    219   2e-63   Eucalyptus grandis [rose gum]
ref|XP_010052508.1|  PREDICTED: probable galacturonosyltransferas...    219   2e-63   
ref|XP_008794742.1|  PREDICTED: probable galacturonosyltransferas...    219   2e-63   Phoenix dactylifera
ref|XP_008794741.1|  PREDICTED: probable galacturonosyltransferas...    219   2e-63   Phoenix dactylifera
ref|XP_008794740.1|  PREDICTED: probable galacturonosyltransferas...    219   3e-63   Phoenix dactylifera
ref|XP_008794739.1|  PREDICTED: probable galacturonosyltransferas...    219   3e-63   Phoenix dactylifera
ref|XP_009374812.1|  PREDICTED: probable galacturonosyltransferase 4    219   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_008794737.1|  PREDICTED: probable galacturonosyltransferas...    219   3e-63   Phoenix dactylifera
ref|XP_008794738.1|  PREDICTED: probable galacturonosyltransferas...    219   3e-63   Phoenix dactylifera
ref|NP_001148932.1|  transferase, transferring glycosyl groups          218   4e-63   Zea mays [maize]
gb|KDO78641.1|  hypothetical protein CISIN_1g005035mg                   219   4e-63   Citrus sinensis [apfelsine]
gb|AFW60920.1|  transferase                                             218   4e-63   
ref|XP_008677252.1|  PREDICTED: transferase, transferring glycosy...    218   4e-63   Zea mays [maize]
ref|XP_006449975.1|  hypothetical protein CICLE_v10014426mg             219   5e-63   
gb|AET04592.2|  CAZy family GT8 glycosyltransferase                     216   7e-63   Medicago truncatula
gb|ABN08854.1|  Glycosyl transferase, family 8                          218   8e-63   Medicago truncatula
ref|XP_008384215.1|  PREDICTED: probable galacturonosyltransferas...    218   9e-63   
ref|XP_008384214.1|  PREDICTED: probable galacturonosyltransferas...    218   9e-63   
ref|XP_003594361.1|  Galacturonosyltransferase                          218   1e-62   Medicago truncatula
ref|XP_007026431.1|  Galacturonosyltransferase 4 isoform 2              217   1e-62   Theobroma cacao [chocolate]
ref|XP_007026430.1|  Galacturonosyltransferase 4 isoform 1              217   1e-62   Theobroma cacao [chocolate]
gb|ACF83776.1|  unknown                                                 204   2e-62   Zea mays [maize]
ref|XP_004499343.1|  PREDICTED: probable galacturonosyltransferas...    217   2e-62   Cicer arietinum [garbanzo]
ref|XP_010910637.1|  PREDICTED: probable galacturonosyltransferas...    214   3e-62   Elaeis guineensis
ref|XP_009363241.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    216   3e-62   Pyrus x bretschneideri [bai li]
gb|EEC83383.1|  hypothetical protein OsI_28798                          215   3e-62   Oryza sativa Indica Group [Indian rice]
gb|KHN40223.1|  Putative galacturonosyltransferase 4                    216   3e-62   Glycine soja [wild soybean]
ref|XP_006584115.1|  PREDICTED: probable galacturonosyltransferas...    216   3e-62   Glycine max [soybeans]
ref|NP_001061555.1|  Os08g0327100                                       216   4e-62   
ref|XP_008349398.1|  PREDICTED: probable galacturonosyltransferase 4    214   4e-62   
ref|XP_007213869.1|  hypothetical protein PRUPE_ppa018681mg             216   4e-62   
ref|XP_004973216.1|  PREDICTED: probable galacturonosyltransferas...    215   5e-62   Setaria italica
ref|XP_003535002.1|  PREDICTED: probable galacturonosyltransferas...    215   5e-62   Glycine max [soybeans]
ref|XP_010686598.1|  PREDICTED: probable galacturonosyltransferase 4    215   6e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN40761.1|  Putative galacturonosyltransferase 4                    215   6e-62   Glycine soja [wild soybean]
ref|XP_010910636.1|  PREDICTED: probable galacturonosyltransferas...    215   7e-62   
gb|KDP29029.1|  hypothetical protein JCGZ_16418                         214   8e-62   Jatropha curcas
ref|XP_002444200.1|  hypothetical protein SORBIDRAFT_07g014890          215   8e-62   Sorghum bicolor [broomcorn]
ref|XP_011460082.1|  PREDICTED: probable galacturonosyltransferas...    214   9e-62   Fragaria vesca subsp. vesca
ref|XP_008440950.1|  PREDICTED: probable galacturonosyltransferas...    214   1e-61   
ref|XP_011460081.1|  PREDICTED: probable galacturonosyltransferas...    214   1e-61   Fragaria vesca subsp. vesca
ref|XP_011460080.1|  PREDICTED: probable galacturonosyltransferas...    214   1e-61   Fragaria vesca subsp. vesca
ref|XP_008358828.1|  PREDICTED: probable galacturonosyltransferase 4    214   1e-61   Malus domestica [apple tree]
ref|XP_002882844.1|  hypothetical protein ARALYDRAFT_478777             213   1e-61   
ref|XP_006597630.1|  PREDICTED: probable galacturonosyltransferas...    214   1e-61   Glycine max [soybeans]
ref|XP_010252974.1|  PREDICTED: probable galacturonosyltransferase 4    215   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008440947.1|  PREDICTED: probable galacturonosyltransferas...    214   1e-61   Cucumis melo [Oriental melon]
gb|KJB67441.1|  hypothetical protein B456_010G190800                    208   2e-61   Gossypium raimondii
gb|EPS65589.1|  hypothetical protein M569_09187                         214   2e-61   Genlisea aurea
ref|XP_010234583.1|  PREDICTED: probable galacturonosyltransferas...    213   2e-61   Brachypodium distachyon [annual false brome]
ref|XP_004134994.1|  PREDICTED: probable galacturonosyltransferas...    213   2e-61   
ref|XP_004158838.1|  PREDICTED: probable galacturonosyltransferas...    213   3e-61   
ref|XP_003573698.1|  PREDICTED: probable galacturonosyltransferas...    213   3e-61   Brachypodium distachyon [annual false brome]
ref|XP_010942295.1|  PREDICTED: probable galacturonosyltransferase 4    214   3e-61   Elaeis guineensis
gb|KHF97487.1|  putative galacturonosyltransferase 4 -like protein      211   3e-61   Gossypium arboreum [tree cotton]
gb|KHN03562.1|  Putative galacturonosyltransferase 4                    213   4e-61   Glycine soja [wild soybean]
ref|XP_006600275.1|  PREDICTED: probable galacturonosyltransferas...    213   5e-61   Glycine max [soybeans]
ref|XP_008384326.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    211   5e-61   
ref|XP_004168876.1|  PREDICTED: probable galacturonosyltransferas...    212   7e-61   
ref|XP_006373556.1|  hypothetical protein POPTR_0016s00360g             212   8e-61   
gb|KJB67439.1|  hypothetical protein B456_010G190800                    211   1e-60   Gossypium raimondii
dbj|BAB11325.1|  unnamed protein product                                211   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KJB67440.1|  hypothetical protein B456_010G190800                    211   1e-60   Gossypium raimondii
ref|NP_568688.1|  probable galacturonosyltransferase 4                  211   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KJB67437.1|  hypothetical protein B456_010G190800                    211   1e-60   Gossypium raimondii
ref|XP_006660049.1|  PREDICTED: probable galacturonosyltransferas...    211   1e-60   
gb|KHG17315.1|  putative galacturonosyltransferase 4 -like protein      211   1e-60   Gossypium arboreum [tree cotton]
gb|KGN65009.1|  hypothetical protein Csa_1G179740                       211   2e-60   Cucumis sativus [cucumbers]
ref|XP_008464310.1|  PREDICTED: probable galacturonosyltransferase 4    211   2e-60   Cucumis melo [Oriental melon]
ref|XP_002525229.1|  Glycosyltransferase QUASIMODO1, putative           211   2e-60   Ricinus communis
ref|XP_004959557.1|  PREDICTED: probable galacturonosyltransferas...    212   2e-60   
ref|XP_007147564.1|  hypothetical protein PHAVU_006G135100g             211   2e-60   Phaseolus vulgaris [French bean]
ref|XP_009107093.1|  PREDICTED: probable galacturonosyltransferase 4    210   3e-60   Brassica rapa
ref|XP_010481270.1|  PREDICTED: probable galacturonosyltransferas...    210   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010481265.1|  PREDICTED: probable galacturonosyltransferas...    210   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010481267.1|  PREDICTED: probable galacturonosyltransferas...    210   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010481273.1|  PREDICTED: probable galacturonosyltransferas...    210   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006279595.1|  hypothetical protein CARUB_v10026096mg             210   3e-60   Capsella rubella
ref|XP_010495019.1|  PREDICTED: probable galacturonosyltransferas...    210   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010495018.1|  PREDICTED: probable galacturonosyltransferas...    210   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006857626.1|  hypothetical protein AMTR_s00061p00126570          211   4e-60   Amborella trichopoda
ref|XP_008224656.1|  PREDICTED: probable galacturonosyltransferase 4    210   5e-60   Prunus mume [ume]
ref|XP_010942525.1|  PREDICTED: probable galacturonosyltransferas...    210   6e-60   Elaeis guineensis
ref|XP_010942526.1|  PREDICTED: probable galacturonosyltransferas...    210   6e-60   Elaeis guineensis
ref|XP_010942524.1|  PREDICTED: probable galacturonosyltransferas...    210   6e-60   Elaeis guineensis
ref|XP_011040102.1|  PREDICTED: probable galacturonosyltransferase 4    209   1e-59   Populus euphratica
ref|XP_011016525.1|  PREDICTED: probable galacturonosyltransferase 4    209   1e-59   Populus euphratica
ref|XP_010441404.1|  PREDICTED: probable galacturonosyltransferas...    208   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010441403.1|  PREDICTED: probable galacturonosyltransferas...    208   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_007154077.1|  hypothetical protein PHAVU_003G088900g             209   2e-59   Phaseolus vulgaris [French bean]
ref|XP_008775901.1|  PREDICTED: probable galacturonosyltransferase 4    208   2e-59   Phoenix dactylifera
ref|XP_007154076.1|  hypothetical protein PHAVU_003G088900g             208   2e-59   Phaseolus vulgaris [French bean]
ref|XP_009101378.1|  PREDICTED: probable galacturonosyltransferase 4    208   2e-59   Brassica rapa
emb|CAJ26362.1|  glycosyl transferase-like protein                      208   3e-59   Brachypodium sylvaticum
emb|CAJ19325.1|  glycosyl transferase-like protein                      208   4e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006398488.1|  hypothetical protein EUTSA_v10000819mg             207   5e-59   Eutrema salsugineum [saltwater cress]
ref|XP_011005782.1|  PREDICTED: probable galacturonosyltransferas...    207   5e-59   Populus euphratica
ref|XP_011005780.1|  PREDICTED: probable galacturonosyltransferas...    207   6e-59   Populus euphratica
ref|XP_002308736.1|  hypothetical protein POPTR_0006s00320g             207   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010647027.1|  PREDICTED: probable galacturonosyltransferas...    207   7e-59   Vitis vinifera
ref|XP_010647025.1|  PREDICTED: probable galacturonosyltransferas...    207   7e-59   Vitis vinifera
ref|XP_004974813.1|  PREDICTED: probable galacturonosyltransferas...    207   8e-59   
ref|XP_009395236.1|  PREDICTED: probable galacturonosyltransferase 4    206   1e-58   
gb|KFK31342.1|  hypothetical protein AALP_AA6G099900                    206   1e-58   Arabis alpina [alpine rockcress]
ref|XP_008782990.1|  PREDICTED: probable galacturonosyltransferase 4    206   1e-58   Phoenix dactylifera
ref|XP_002460421.1|  hypothetical protein SORBIDRAFT_02g027840          206   2e-58   
ref|XP_010647084.1|  PREDICTED: probable galacturonosyltransferase 4    205   2e-58   Vitis vinifera
ref|XP_008670271.1|  PREDICTED: probable galacturonosyltransferase 4    205   5e-58   Zea mays [maize]
gb|EMS45059.1|  putative galacturonosyltransferase 4                    205   6e-58   Triticum urartu
gb|EMT04178.1|  Glycosyltransferase QUASIMODO1                          204   7e-58   
emb|CAN70213.1|  hypothetical protein VITISV_038741                     205   8e-58   Vitis vinifera
ref|XP_003578298.1|  PREDICTED: probable galacturonosyltransferase 4    204   8e-58   Brachypodium distachyon [annual false brome]
ref|XP_006661357.1|  PREDICTED: probable galacturonosyltransferas...    204   9e-58   Oryza brachyantha
dbj|BAK01477.1|  predicted protein                                      203   2e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009390607.1|  PREDICTED: probable galacturonosyltransferas...    201   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390606.1|  PREDICTED: probable galacturonosyltransferas...    201   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390605.1|  PREDICTED: probable galacturonosyltransferas...    201   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390604.1|  PREDICTED: probable galacturonosyltransferas...    201   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398763.1|  PREDICTED: probable galacturonosyltransferas...    200   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398761.1|  PREDICTED: probable galacturonosyltransferas...    200   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398760.1|  PREDICTED: probable galacturonosyltransferas...    200   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538434.1|  PREDICTED: probable galacturonosyltransferase 4    199   6e-56   Tarenaya hassleriana [spider flower]
gb|EPS62143.1|  hypothetical protein M569_12650                         195   1e-55   Genlisea aurea
gb|EMT08109.1|  Glycosyltransferase QUASIMODO1                          197   2e-55   
gb|EMS56269.1|  putative galacturonosyltransferase 4                    198   2e-55   Triticum urartu
gb|EAZ09508.1|  hypothetical protein OsI_31783                          197   3e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001063487.1|  Os09g0480400                                       197   4e-55   
ref|XP_002969595.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    194   4e-55   
gb|EMS57452.1|  putative galacturonosyltransferase 4                    196   5e-55   Triticum urartu
ref|XP_002970865.1|  Glycosyltransferase, CAZy family GT8               192   3e-54   
ref|XP_009407928.1|  PREDICTED: probable galacturonosyltransferase 4    194   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD10126.1|  glycosyltransferase family-like                        194   5e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EEE68930.1|  hypothetical protein OsJ_27797                          194   5e-54   Oryza sativa Japonica Group [Japonica rice]
ref|NP_195540.2|  galacturonosyltransferase 3                           192   2e-53   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00667.1|  hypothetical protein                                   192   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190952.1|  galacturonosyltransferase 3                        192   2e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAB37483.1|  putative protein                                       192   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|EMT19760.1|  Glycosyltransferase QUASIMODO1                          192   3e-53   
gb|KDO85920.1|  hypothetical protein CISIN_1g005683mg                   191   4e-53   Citrus sinensis [apfelsine]
emb|CAJ75629.1|  glycosyl transferase-like protein                      189   5e-53   Brachypodium sylvaticum
ref|XP_006445203.1|  hypothetical protein CICLE_v10019146mg             191   5e-53   Citrus clementina [clementine]
ref|XP_007051985.1|  Galacturonosyltransferase 1                        191   8e-53   
ref|XP_011040798.1|  PREDICTED: probable galacturonosyltransferas...    191   9e-53   Populus euphratica
ref|XP_006285045.1|  hypothetical protein CARUB_v10006353mg             190   1e-52   
ref|XP_010450980.1|  PREDICTED: probable galacturonosyltransferase 3    181   1e-52   
ref|XP_002866790.1|  hypothetical protein ARALYDRAFT_912279             190   2e-52   Arabidopsis lyrata subsp. lyrata
gb|KFK30437.1|  hypothetical protein AALP_AA7G260900                    190   2e-52   Arabis alpina [alpine rockcress]
ref|XP_004229870.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    189   3e-52   Solanum lycopersicum
ref|XP_010235254.1|  PREDICTED: probable galacturonosyltransferase 4    188   3e-52   
gb|KJB09887.1|  hypothetical protein B456_001G172800                    189   3e-52   Gossypium raimondii
ref|XP_010056256.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    189   3e-52   Eucalyptus grandis [rose gum]
ref|XP_006384847.1|  hypothetical protein POPTR_0004s21600g             189   4e-52   
ref|XP_011458092.1|  PREDICTED: probable galacturonosyltransferas...    189   4e-52   Fragaria vesca subsp. vesca
ref|XP_008460145.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    189   4e-52   
ref|XP_006339506.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    189   4e-52   Solanum tuberosum [potatoes]
gb|KJB24655.1|  hypothetical protein B456_004G155600                    188   5e-52   Gossypium raimondii
gb|KHG01394.1|  Alpha-1,4-galacturonosyltransferase 1                   188   5e-52   Gossypium arboreum [tree cotton]
ref|XP_011088710.1|  PREDICTED: probable galacturonosyltransferase 3    188   5e-52   Sesamum indicum [beniseed]
gb|KJB24654.1|  hypothetical protein B456_004G155600                    188   5e-52   Gossypium raimondii
ref|XP_008356326.1|  PREDICTED: probable galacturonosyltransferase 3    188   7e-52   
ref|XP_009101951.1|  PREDICTED: probable galacturonosyltransferas...    188   7e-52   Brassica rapa
ref|XP_009101952.1|  PREDICTED: probable galacturonosyltransferas...    188   7e-52   Brassica rapa
emb|CDY59095.1|  BnaCnng34200D                                          188   8e-52   Brassica napus [oilseed rape]
ref|XP_009373400.1|  PREDICTED: probable galacturonosyltransferas...    188   9e-52   Pyrus x bretschneideri [bai li]
ref|XP_011040799.1|  PREDICTED: probable galacturonosyltransferas...    187   1e-51   Populus euphratica
emb|CDY72039.1|  BnaCnng75670D                                          184   1e-51   Brassica napus [oilseed rape]
ref|XP_004144992.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    187   1e-51   
ref|XP_004172284.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    187   1e-51   
ref|XP_010661600.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    187   1e-51   Vitis vinifera
ref|XP_008382476.1|  PREDICTED: probable galacturonosyltransferase 3    187   1e-51   
ref|XP_007043044.1|  Galacturonosyltransferase 3 isoform 1              187   1e-51   
ref|XP_008235961.1|  PREDICTED: probable galacturonosyltransferas...    187   1e-51   Prunus mume [ume]
ref|XP_008364418.1|  PREDICTED: probable galacturonosyltransferase 3    187   1e-51   
ref|XP_002980359.1|  Glycosyltransferase, CAZy family GT8               185   2e-51   
ref|XP_009589124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    187   2e-51   Nicotiana tomentosiformis
gb|KHG14424.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     187   2e-51   Gossypium arboreum [tree cotton]
ref|XP_002962728.1|  GAUT1, alpha-1,4-galaturonosyltransferase-li...    185   2e-51   
ref|XP_007043046.1|  Galacturonosyltransferase 3 isoform 3              187   2e-51   
gb|KHG01393.1|  Alpha-1,4-galacturonosyltransferase 1                   187   2e-51   Gossypium arboreum [tree cotton]
gb|EEC84934.1|  hypothetical protein OsI_32147                          187   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_010667722.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    187   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001063757.1|  Os09g0531900                                       187   2e-51   
ref|XP_001785716.1|  predicted protein                                  177   3e-51   
ref|XP_010266351.1|  PREDICTED: probable galacturonosyltransferase 3    184   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_011002080.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    186   3e-51   Populus euphratica
ref|XP_010106747.1|  Alpha-1,4-galacturonosyltransferase 1              186   3e-51   Morus notabilis
ref|NP_001131608.1|  uncharacterized protein LOC100192958               177   3e-51   
ref|XP_011002081.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    186   3e-51   Populus euphratica
ref|XP_010436923.1|  PREDICTED: probable galacturonosyltransferas...    184   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009345924.1|  PREDICTED: probable galacturonosyltransferas...    186   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_009373401.1|  PREDICTED: probable galacturonosyltransferas...    186   4e-51   Pyrus x bretschneideri [bai li]
emb|CAN79512.1|  hypothetical protein VITISV_014158                     186   4e-51   Vitis vinifera
ref|XP_011034886.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    186   5e-51   Populus euphratica
ref|XP_011083645.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    186   5e-51   Sesamum indicum [beniseed]
ref|NP_001174992.1|  Os06g0712500                                       174   5e-51   
ref|XP_010111700.1|  putative galacturonosyltransferase 3               186   6e-51   
gb|KJB41168.1|  hypothetical protein B456_007G093500                    185   6e-51   Gossypium raimondii
ref|XP_010431762.1|  PREDICTED: probable galacturonosyltransferase 3    184   6e-51   
ref|XP_002462717.1|  hypothetical protein SORBIDRAFT_02g030820          185   6e-51   Sorghum bicolor [broomcorn]
ref|XP_006660882.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   7e-51   Oryza brachyantha
emb|CDP14496.1|  unnamed protein product                                185   7e-51   Coffea canephora [robusta coffee]
emb|CDP08918.1|  unnamed protein product                                185   8e-51   Coffea canephora [robusta coffee]
ref|XP_009616855.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   8e-51   
ref|XP_004957448.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   9e-51   Setaria italica
ref|XP_009777396.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   9e-51   Nicotiana sylvestris
emb|CDY52336.1|  BnaA09g38850D                                          185   1e-50   Brassica napus [oilseed rape]
emb|CDX71763.1|  BnaC08g31110D                                          185   1e-50   
ref|XP_011014841.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   1e-50   Populus euphratica
ref|XP_011014842.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   1e-50   Populus euphratica
ref|XP_009116771.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   1e-50   Brassica rapa
ref|XP_010645848.1|  PREDICTED: probable galacturonosyltransferase 3    184   1e-50   Vitis vinifera
ref|XP_010918998.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    185   1e-50   Elaeis guineensis
ref|XP_008670346.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   1e-50   Zea mays [maize]
ref|XP_007043045.1|  Galacturonosyltransferase 3 isoform 2              182   1e-50   
ref|XP_010436922.1|  PREDICTED: probable galacturonosyltransferas...    184   1e-50   Camelina sativa [gold-of-pleasure]
gb|KGN56570.1|  hypothetical protein Csa_3G124890                       184   1e-50   Cucumis sativus [cucumbers]
gb|EYU32902.1|  hypothetical protein MIMGU_mgv1a002354mg                184   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_008438127.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   Cucumis melo [Oriental melon]
ref|XP_008438124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   Cucumis melo [Oriental melon]
ref|XP_008438125.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   Cucumis melo [Oriental melon]
ref|XP_004134339.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   
ref|XP_009375839.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_004155869.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    184   2e-50   
ref|XP_008650862.1|  PREDICTED: uncharacterized protein LOC100192...    184   2e-50   
gb|KHG15715.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     184   2e-50   Gossypium arboreum [tree cotton]
ref|XP_011458093.1|  PREDICTED: probable galacturonosyltransferas...    183   2e-50   Fragaria vesca subsp. vesca
ref|XP_010934420.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   
ref|XP_010272612.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    184   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006411618.1|  hypothetical protein EUTSA_v10024734mg             183   3e-50   
ref|XP_011469111.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   3e-50   Fragaria vesca subsp. vesca
ref|XP_010512446.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002963967.1|  Glycosyltransferase, CAZy family GT8               180   3e-50   
gb|KJB79716.1|  hypothetical protein B456_013G063700                    183   3e-50   Gossypium raimondii
ref|XP_010512445.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002511763.1|  transferase, transferring glycosyl groups, p...    183   3e-50   
ref|XP_010512444.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010469034.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010413456.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010512443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   4e-50   Camelina sativa [gold-of-pleasure]
emb|CDY42486.1|  BnaC04g21950D                                          183   4e-50   Brassica napus [oilseed rape]
dbj|BAJ53137.1|  JHL05D22.8                                             183   4e-50   Jatropha curcas
gb|AIL52750.1|  polygalacturonate 4-alpha-galacturonosyltransfera...    183   4e-50   Dendrobium officinale
gb|KDP28715.1|  hypothetical protein JCGZ_14486                         183   4e-50   Jatropha curcas
dbj|BAK02036.1|  predicted protein                                      179   4e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010255603.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    183   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_001779123.1|  predicted protein                                  181   4e-50   
emb|CDX89098.1|  BnaA04g00880D                                          183   5e-50   
gb|KJB12347.1|  hypothetical protein B456_002G013600                    182   5e-50   Gossypium raimondii
ref|XP_008447844.1|  PREDICTED: probable galacturonosyltransferas...    183   5e-50   Cucumis melo [Oriental melon]
ref|XP_009418721.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    182   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935289.1|  PREDICTED: probable galacturonosyltransferas...    182   6e-50   
gb|KHG09589.1|  putative galacturonosyltransferase 3 -like protein      182   6e-50   Gossypium arboreum [tree cotton]
ref|XP_009138790.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    182   6e-50   
ref|XP_001756118.1|  predicted protein                                  180   6e-50   
ref|XP_010255602.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    182   6e-50   Nelumbo nucifera [Indian lotus]
ref|XP_004501287.1|  PREDICTED: probable galacturonosyltransferas...    182   6e-50   Cicer arietinum [garbanzo]
ref|XP_006402518.1|  hypothetical protein EUTSA_v10005820mg             182   6e-50   
ref|XP_008670345.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    182   7e-50   
ref|XP_010255599.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    182   7e-50   
ref|XP_010935288.1|  PREDICTED: probable galacturonosyltransferas...    182   7e-50   
ref|XP_004154763.1|  PREDICTED: probable galacturonosyltransferas...    182   7e-50   
ref|XP_006375320.1|  hypothetical protein POPTR_0014s06970g             179   8e-50   
ref|XP_010918253.1|  PREDICTED: probable galacturonosyltransferase 3    181   8e-50   
ref|XP_004248575.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    182   8e-50   
ref|XP_004144949.1|  PREDICTED: probable galacturonosyltransferas...    182   8e-50   
ref|XP_002967953.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    182   8e-50   
ref|NP_191672.1|  alpha-1,4-galacturonosyltransferase 1                 182   9e-50   
ref|XP_002533896.1|  Glycosyltransferase QUASIMODO1, putative           182   9e-50   
ref|XP_002876594.1|  GAUT1/LGT1                                         182   1e-49   
ref|XP_009623515.1|  PREDICTED: probable galacturonosyltransferas...    182   1e-49   
ref|XP_006290325.1|  hypothetical protein CARUB_v10016785mg             182   1e-49   
gb|KHG03188.1|  putative galacturonosyltransferase 3 -like protein      177   1e-49   
ref|XP_004501286.1|  PREDICTED: probable galacturonosyltransferas...    182   1e-49   
ref|XP_009418719.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    182   1e-49   
ref|XP_009623514.1|  PREDICTED: probable galacturonosyltransferas...    182   1e-49   
ref|XP_008809114.1|  PREDICTED: probable galacturonosyltransferase 3    179   1e-49   
ref|XP_007200300.1|  hypothetical protein PRUPE_ppa003250mg             181   1e-49   
gb|EYU38036.1|  hypothetical protein MIMGU_mgv1a002760mg                181   1e-49   
ref|XP_009382742.1|  PREDICTED: probable galacturonosyltransferase 3    181   1e-49   
ref|XP_009766434.1|  PREDICTED: probable galacturonosyltransferas...    181   1e-49   
ref|XP_002320745.2|  glycosyl transferase family 8 family protein       179   2e-49   
ref|XP_009766433.1|  PREDICTED: probable galacturonosyltransferas...    181   2e-49   
ref|XP_004966516.1|  PREDICTED: probable galacturonosyltransferas...    181   2e-49   
ref|XP_010523706.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    181   2e-49   
ref|XP_008235962.1|  PREDICTED: probable galacturonosyltransferas...    181   2e-49   
gb|EPS65305.1|  hypothetical protein M569_09471                         181   2e-49   
gb|KJB79717.1|  hypothetical protein B456_013G063700                    179   2e-49   
ref|XP_008781317.1|  PREDICTED: probable galacturonosyltransferase 3    181   2e-49   
ref|XP_008776919.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    181   2e-49   
gb|KDP42036.1|  hypothetical protein JCGZ_03099                         181   2e-49   
ref|XP_010239537.1|  PREDICTED: probable galacturonosyltransferas...    180   2e-49   
ref|XP_006341726.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    181   3e-49   
ref|XP_008650863.1|  PREDICTED: uncharacterized protein LOC100192...    180   3e-49   
ref|XP_003603462.1|  Alpha-1,4-galacturonosyltransferase                177   3e-49   
ref|XP_010239532.1|  PREDICTED: probable galacturonosyltransferas...    180   3e-49   
ref|XP_009785495.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    181   3e-49   
ref|XP_008670350.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   4e-49   
ref|XP_010690224.1|  PREDICTED: probable galacturonosyltransferas...    180   4e-49   
ref|XP_009345925.1|  PREDICTED: probable galacturonosyltransferas...    180   4e-49   
ref|XP_008670348.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   4e-49   
ref|XP_008342952.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    180   4e-49   
gb|EMS52040.1|  putative galacturonosyltransferase 3                    179   5e-49   
ref|XP_008650861.1|  PREDICTED: uncharacterized protein LOC100192...    180   5e-49   
ref|XP_010690223.1|  PREDICTED: probable galacturonosyltransferas...    180   5e-49   
ref|XP_008670347.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   5e-49   
gb|AFW67949.1|  hypothetical protein ZEAMMB73_846223                    172   6e-49   
ref|XP_002302550.1|  hypothetical protein POPTR_0002s15270g             179   6e-49   
ref|XP_009375840.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   7e-49   
tpg|DAA40341.1|  TPA: hypothetical protein ZEAMMB73_504957              180   7e-49   
dbj|BAJ86220.1|  predicted protein                                      179   8e-49   
gb|KJB79715.1|  hypothetical protein B456_013G063700                    179   8e-49   
gb|EMS50352.1|  Alpha-1,4-galacturonosyltransferase 1                   177   1e-48   
ref|XP_006656516.1|  PREDICTED: probable galacturonosyltransferas...    177   1e-48   
ref|XP_003525683.1|  PREDICTED: probable galacturonosyltransferas...    179   1e-48   
ref|XP_006579796.1|  PREDICTED: probable galacturonosyltransferas...    179   1e-48   
gb|KHN27481.1|  Putative galacturonosyltransferase 3                    179   1e-48   
ref|XP_008232828.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   1e-48   
ref|XP_008232829.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   1e-48   
gb|EEC81302.1|  hypothetical protein OsI_24438                          178   1e-48   
ref|XP_003578496.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   1e-48   
ref|XP_010231443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    178   1e-48   
ref|NP_001064438.1|  Os10g0363100                                       177   1e-48   
gb|KEH35941.1|  polygalacturonate 4-alpha-galacturonosyltransferase     178   2e-48   
ref|XP_006583368.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    179   2e-48   
gb|KHN04587.1|  Alpha-1,4-galacturonosyltransferase 1                   178   2e-48   
ref|XP_006843539.1|  hypothetical protein AMTR_s00007p00049440          174   2e-48   
ref|XP_006657336.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    177   2e-48   
ref|XP_004510897.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    178   2e-48   
ref|XP_007220901.1|  hypothetical protein PRUPE_ppa002418mg             178   2e-48   
gb|EEC83380.1|  hypothetical protein OsI_28795                          178   2e-48   
gb|AES73713.2|  polygalacturonate 4-alpha-galacturonosyltransferase     178   2e-48   
ref|XP_006656515.1|  PREDICTED: probable galacturonosyltransferas...    177   2e-48   
gb|AFW67950.1|  hypothetical protein ZEAMMB73_846223                    174   3e-48   
ref|XP_002454735.1|  hypothetical protein SORBIDRAFT_04g036420          173   3e-48   
ref|XP_008447845.1|  PREDICTED: probable galacturonosyltransferas...    177   3e-48   
ref|XP_011074569.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    177   3e-48   
gb|EEC81341.1|  hypothetical protein OsI_24527                          179   3e-48   
gb|EMT14751.1|  Glycosyltransferase QUASIMODO1                          177   4e-48   
gb|ACF78990.1|  unknown                                                 171   4e-48   
ref|XP_007134929.1|  hypothetical protein PHAVU_010G087600g             177   4e-48   
ref|XP_004492659.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    177   4e-48   
gb|EPS66373.1|  hypothetical protein M569_08404                         177   4e-48   
gb|EMS51766.1|  Galacturonosyltransferase 8                             170   5e-48   
dbj|BAJ99110.1|  predicted protein                                      176   5e-48   
ref|XP_010028843.1|  PREDICTED: probable galacturonosyltransferase 3    177   5e-48   
gb|KGN43338.1|  hypothetical protein Csa_7G024120                       177   6e-48   
gb|AAM18739.1|AC092548_17  hypothetical protein                         176   6e-48   
ref|XP_006486598.1|  PREDICTED: probable galacturonosyltransferas...    176   6e-48   
ref|XP_006576391.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    177   7e-48   
gb|KHN04100.1|  Alpha-1,4-galacturonosyltransferase 1                   177   7e-48   
ref|XP_003551642.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    177   7e-48   
gb|EAZ15816.1|  hypothetical protein OsJ_31235                          177   8e-48   
gb|AFW67951.1|  hypothetical protein ZEAMMB73_846223                    175   8e-48   
gb|EAY78177.1|  hypothetical protein OsI_33224                          176   9e-48   
gb|ABB47337.1|  Glycosyltransferase QUASIMODO1, putative, expressed     176   9e-48   
ref|XP_002439065.1|  hypothetical protein SORBIDRAFT_10g030870          176   9e-48   
ref|XP_006422429.1|  hypothetical protein CICLE_v10027946mg             176   9e-48   
ref|XP_007139968.1|  hypothetical protein PHAVU_008G074000g             176   9e-48   
ref|XP_001770653.1|  predicted protein                                  175   1e-47   
ref|XP_006486597.1|  PREDICTED: probable galacturonosyltransferas...    176   1e-47   
ref|XP_009386175.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    176   1e-47   
ref|XP_004231097.1|  PREDICTED: probable galacturonosyltransferase 3    176   1e-47   
ref|XP_003533632.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    176   1e-47   
gb|AFW69586.1|  hypothetical protein ZEAMMB73_786543                    176   1e-47   
ref|XP_008645106.1|  PREDICTED: probable galacturonosyltransferas...    176   1e-47   
ref|XP_008645105.1|  PREDICTED: probable galacturonosyltransferas...    176   1e-47   
ref|XP_008645104.1|  PREDICTED: probable galacturonosyltransferas...    176   1e-47   
ref|XP_010555174.1|  PREDICTED: probable galacturonosyltransferas...    176   1e-47   
ref|XP_010555175.1|  PREDICTED: probable galacturonosyltransferas...    176   2e-47   
ref|XP_004982129.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    175   2e-47   
ref|XP_006364356.1|  PREDICTED: probable galacturonosyltransferas...    176   2e-47   
emb|CAB81547.1|  68 kDa protein                                         175   2e-47   
ref|NP_001169332.1|  hypothetical protein precursor                     175   2e-47   
gb|KHN03164.1|  Alpha-1,4-galacturonosyltransferase 1                   174   3e-47   
ref|XP_006828896.1|  hypothetical protein AMTR_s00001p00190810          175   4e-47   
ref|XP_008803497.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    174   4e-47   
ref|XP_007032944.1|  Glycosyltransferase isoform 2                      172   4e-47   
ref|XP_008457595.1|  PREDICTED: galacturonosyltransferase 8-like        174   5e-47   
ref|XP_008671920.1|  PREDICTED: uncharacterized protein LOC100191...    173   6e-47   
tpg|DAA50750.1|  TPA: hypothetical protein ZEAMMB73_194342              173   8e-47   
gb|KHN29422.1|  Alpha-1,4-galacturonosyltransferase 1                   174   8e-47   
ref|XP_007032943.1|  Glycosyltransferase isoform 1                      172   8e-47   
ref|XP_007137299.1|  hypothetical protein PHAVU_009G115700g             173   9e-47   
ref|XP_009404224.1|  PREDICTED: galacturonosyltransferase 8-like        172   1e-46   
ref|NP_001130678.1|  uncharacterized protein LOC100191781 precursor     173   1e-46   
ref|XP_010908797.1|  PREDICTED: galacturonosyltransferase 8-like        172   1e-46   
ref|XP_006373520.1|  hypothetical protein POPTR_0017s144802g            172   1e-46   
ref|XP_011021133.1|  PREDICTED: probable galacturonosyltransferase 9    172   1e-46   
ref|NP_001058636.2|  Os06g0727300                                       173   1e-46   
gb|AES80022.2|  CAZy family GT8 glycosyltransferase                     173   1e-46   
ref|XP_003623804.1|  Alpha-1,4-galacturonosyltransferase                173   1e-46   
ref|XP_002466644.1|  hypothetical protein SORBIDRAFT_01g011560          172   1e-46   
ref|XP_009379995.1|  PREDICTED: galacturonosyltransferase 8-like        172   1e-46   
ref|XP_010913084.1|  PREDICTED: galacturonosyltransferase 8             172   2e-46   
ref|XP_008778166.1|  PREDICTED: galacturonosyltransferase 8-like        172   2e-46   
ref|NP_001168623.1|  uncharacterized protein LOC100382408               166   2e-46   
ref|XP_002530802.1|  Glycosyltransferase QUASIMODO1, putative           171   3e-46   
dbj|BAK03588.1|  predicted protein                                      171   3e-46   
ref|XP_006384242.1|  hypothetical protein POPTR_0004s10980g             171   3e-46   
ref|XP_010257858.1|  PREDICTED: probable galacturonosyltransferase 9    171   5e-46   
gb|ABD65461.1|  transferring glycosyl protein                           162   5e-46   
gb|EMT00930.1|  Glycosyltransferase QUASIMODO1                          173   6e-46   
ref|XP_006648647.1|  PREDICTED: galacturonosyltransferase 8-like        168   8e-46   
gb|KJB48245.1|  hypothetical protein B456_008G059800                    169   9e-46   
ref|XP_010246719.1|  PREDICTED: galacturonosyltransferase 8             170   1e-45   
gb|KDO68337.1|  hypothetical protein CISIN_1g0404351mg                  173   1e-45   
gb|KJB48243.1|  hypothetical protein B456_008G059800                    169   1e-45   
ref|XP_004149774.1|  PREDICTED: galacturonosyltransferase 8-like        169   1e-45   
ref|XP_006841268.1|  hypothetical protein AMTR_s00135p00111710          169   1e-45   
ref|XP_008458050.1|  PREDICTED: galacturonosyltransferase 8             169   1e-45   
ref|XP_006482345.1|  PREDICTED: probable galacturonosyltransferas...    169   2e-45   
ref|XP_006430887.1|  hypothetical protein CICLE_v10011396mg             169   2e-45   
ref|XP_011012259.1|  PREDICTED: probable galacturonosyltransferase 9    169   2e-45   
ref|XP_002310951.2|  hypothetical protein POPTR_0008s01050g             169   2e-45   
ref|XP_004952528.1|  PREDICTED: galacturonosyltransferase 8-like        168   3e-45   
gb|EEC73220.1|  hypothetical protein OsI_07307                          168   3e-45   
gb|EMS57388.1|  Alpha-1,4-galacturonosyltransferase 1                   169   3e-45   
dbj|BAD23465.1|  putative glycosyl transferase                          168   3e-45   
ref|XP_004242412.1|  PREDICTED: galacturonosyltransferase 8-like        169   3e-45   
ref|XP_011033002.1|  PREDICTED: galacturonosyltransferase 8-like        168   3e-45   
ref|NP_001046899.1|  Os02g0498700                                       169   3e-45   
gb|KJB10196.1|  hypothetical protein B456_001G188500                    166   3e-45   
gb|KDP24309.1|  hypothetical protein JCGZ_25605                         169   3e-45   
emb|CBI25666.3|  unnamed protein product                                167   3e-45   
dbj|BAD94466.1|  hypothetical protein                                   161   3e-45   
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like        168   4e-45   
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                   168   4e-45   
ref|XP_009373741.1|  PREDICTED: probable galacturonosyltransferase 9    168   5e-45   
ref|XP_002273962.2|  PREDICTED: galacturonosyltransferase 8             168   5e-45   
ref|XP_002963966.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    169   6e-45   
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg             167   6e-45   
ref|XP_009134662.1|  PREDICTED: probable galacturonosyltransferas...    167   6e-45   
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8             167   6e-45   
gb|AFW71494.1|  hypothetical protein ZEAMMB73_252708                    167   7e-45   
ref|XP_009134660.1|  PREDICTED: probable galacturonosyltransferas...    167   7e-45   
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8             167   8e-45   
gb|KHG26626.1|  putative galacturonosyltransferase 9 -like protein      167   9e-45   
emb|CDX74263.1|  BnaA03g27840D                                          167   9e-45   
emb|CDX91987.1|  BnaC03g32890D                                          167   9e-45   
ref|XP_010100891.1|  putative galacturonosyltransferase 9               167   1e-44   
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8             167   1e-44   
gb|KJB08801.1|  hypothetical protein B456_001G104800                    164   1e-44   
ref|XP_002453869.1|  hypothetical protein SORBIDRAFT_04g020140          166   1e-44   
gb|KHG16505.1|  Galacturonosyltransferase 8 -like protein               167   1e-44   
gb|KFK37701.1|  hypothetical protein AALP_AA3G017600                    167   1e-44   
ref|XP_010523196.1|  PREDICTED: putative galacturonosyltransferase 2    167   1e-44   
ref|XP_009378304.1|  PREDICTED: probable galacturonosyltransferase 9    167   1e-44   
ref|XP_003572545.1|  PREDICTED: galacturonosyltransferase 8-like        166   2e-44   
ref|XP_010476066.1|  PREDICTED: probable galacturonosyltransferase 9    166   2e-44   
gb|KJB10199.1|  hypothetical protein B456_001G188500                    167   2e-44   
gb|KJB10198.1|  hypothetical protein B456_001G188500                    166   2e-44   
ref|XP_010485478.1|  PREDICTED: probable galacturonosyltransferase 9    166   2e-44   
ref|XP_006297346.1|  hypothetical protein CARUB_v10013365mg             166   2e-44   
ref|XP_002987448.1|  Quasimodo1-like protein                            166   2e-44   
ref|XP_010463640.1|  PREDICTED: probable galacturonosyltransferase 9    166   2e-44   
ref|XP_008341825.1|  PREDICTED: probable galacturonosyltransferase 9    166   2e-44   
ref|XP_010104168.1|  Galacturonosyltransferase 8                        166   2e-44   
ref|XP_008379476.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    166   2e-44   
emb|CAJ34814.1|  glycosyltransferase                                    162   2e-44   
gb|KHG21596.1|  Galacturonosyltransferase 8 -like protein               166   2e-44   
ref|XP_009136103.1|  PREDICTED: galacturonosyltransferase 8             166   2e-44   
ref|XP_010918254.1|  PREDICTED: probable galacturonosyltransferase 3    166   2e-44   
gb|AID53187.1|  galacturonosyltransferase 8-like protein                166   2e-44   
gb|KJB10200.1|  hypothetical protein B456_001G188500                    166   2e-44   
ref|XP_011089660.1|  PREDICTED: galacturonosyltransferase 8-like        166   2e-44   
emb|CDX93049.1|  BnaA03g37710D                                          166   2e-44   
ref|XP_008230332.1|  PREDICTED: probable galacturonosyltransferase 9    166   3e-44   
ref|XP_002980055.1|  Quasimodo1-like protein                            166   3e-44   
gb|KDP26352.1|  hypothetical protein JCGZ_17510                         166   3e-44   
ref|XP_009792003.1|  PREDICTED: probable galacturonosyltransferase 9    166   3e-44   
emb|CDY61593.1|  BnaC03g74220D                                          166   3e-44   
emb|CDP02368.1|  unnamed protein product                                166   3e-44   
ref|XP_009603685.1|  PREDICTED: probable galacturonosyltransferase 9    166   3e-44   
ref|XP_008382600.1|  PREDICTED: galacturonosyltransferase 8-like        166   3e-44   
ref|XP_006297348.1|  hypothetical protein CARUB_v10013367mg             166   3e-44   
ref|XP_002863088.1|  hypothetical protein ARALYDRAFT_497166             166   3e-44   
ref|XP_006418657.1|  hypothetical protein EUTSA_v10002465mg             166   3e-44   



>ref|XP_009610681.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
 ref|XP_009610682.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
 ref|XP_009610684.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
Length=681

 Score =   246 bits (627),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL+EWRR+NITEVYHSWQ LN+DRQLWKLGTLPPGLITFW  TYALDR
Sbjct  555  RACGWAFGMNIFDLNEWRRQNITEVYHSWQNLNHDRQLWKLGTLPPGLITFWKRTYALDR  614

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQVFLREC
Sbjct  615  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQVFLREC  673



>ref|XP_004236640.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319210.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Solanum 
lycopersicum]
Length=680

 Score =   240 bits (613),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI+DL+EWRR+NITEVYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDR
Sbjct  554  RACGWAFGMNIIDLNEWRRQNITEVYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDR  613

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  614  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQTFLREC  672



>ref|XP_010319211.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010319212.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Solanum 
lycopersicum]
Length=679

 Score =   240 bits (613),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI+DL+EWRR+NITEVYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDR
Sbjct  553  RACGWAFGMNIIDLNEWRRQNITEVYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDR  612

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  613  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQTFLREC  671



>ref|XP_006350232.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350233.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350234.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X3 [Solanum tuberosum]
Length=680

 Score =   239 bits (610),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 101/119 (85%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI+DL++WRR+NITEVYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDR
Sbjct  554  RACGWAFGMNIIDLNQWRRQNITEVYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDR  613

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  614  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQAFLREC  672



>ref|XP_006350235.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X4 [Solanum tuberosum]
Length=679

 Score =   239 bits (610),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 101/119 (85%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI+DL++WRR+NITEVYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDR
Sbjct  553  RACGWAFGMNIIDLNQWRRQNITEVYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDR  612

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  613  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQAFLREC  671



>ref|XP_009802396.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Nicotiana 
sylvestris]
Length=680

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL+EWRR+NITEVYHSWQ LN+DRQLWKLGTLPPGLITFW  TYALDR
Sbjct  554  RACGWAFGMNIFDLNEWRRQNITEVYHSWQNLNHDRQLWKLGTLPPGLITFWKRTYALDR  613

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQVFLREC
Sbjct  614  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQVFLREC  672



>ref|XP_009802392.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802394.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802395.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
Length=681

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL+EWRR+NITEVYHSWQ LN+DRQLWKLGTLPPGLITFW  TYALDR
Sbjct  555  RACGWAFGMNIFDLNEWRRQNITEVYHSWQNLNHDRQLWKLGTLPPGLITFWKRTYALDR  614

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDI+RAAVIHYNGNLKPWLEISIPKFR+YWS+F++YDQVFLREC
Sbjct  615  SWHVLGLGYNPNVSQKDIQRAAVIHYNGNLKPWLEISIPKFRDYWSKFVDYDQVFLREC  673



>ref|XP_011086294.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
Length=676

 Score =   235 bits (600),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWR++NIT+VYH WQ+LN DR LWKLGTLPPGLITFWN TYALD+
Sbjct  554  RACGWAFGMNIFDLDEWRKQNITDVYHKWQSLNQDRLLWKLGTLPPGLITFWNRTYALDK  613

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDIERAAVIHYNGNLKPWLEI+IPKFRNYW+RF++YD  +LREC
Sbjct  614  SWHVLGLGYNPNVSQKDIERAAVIHYNGNLKPWLEIAIPKFRNYWARFVDYDHQYLREC  672



>ref|XP_004486385.1| PREDICTED: probable galacturonosyltransferase 4-like [Cicer arietinum]
Length=660

 Score =   226 bits (575),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+ ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  538  RACGWAYGMNVFDLVEWKRQKITEVYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNR  597

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPN+ QKDIER+AV+HYNGN+KPWLEISIPKFR+YWS+++ Y+ VFLREC
Sbjct  598  SWHVLGLGYNPNINQKDIERSAVMHYNGNMKPWLEISIPKFRSYWSKYVNYNHVFLREC  656



>gb|EYU33824.1| hypothetical protein MIMGU_mgv1a002625mg [Erythranthe guttata]
Length=653

 Score =   225 bits (574),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWR++NITEVYH WQ LN DR LWKLGTLPPGLITF N TYALD+
Sbjct  531  RACGWAFGMNIFDLDEWRKQNITEVYHKWQNLNEDRLLWKLGTLPPGLITFSNRTYALDK  590

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV  KDIERAAVIHYNGNLKPWLEI +PKFRNYW++F++YD  +LREC
Sbjct  591  SWHVLGLGYNPNVPLKDIERAAVIHYNGNLKPWLEIGLPKFRNYWAKFVDYDHQYLREC  649



>ref|XP_010096508.1| putative galacturonosyltransferase 4 [Morus notabilis]
 gb|EXB64628.1| putative galacturonosyltransferase 4 [Morus notabilis]
Length=657

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+R+ IT+VYHSWQ LN+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  535  RACGWAYGMNIFDLKEWKRQQITDVYHSWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDR  594

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDIERAAVIHYNGN+KPWLEI IPK+RNYW+++++YDQ++LREC
Sbjct  595  SWHVLGLGYNPNVGQKDIERAAVIHYNGNMKPWLEIGIPKYRNYWAKYVDYDQLYLREC  653



>ref|XP_011095865.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095866.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095867.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095868.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
Length=682

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWR++NITEVYH WQ LN+DR LWKLGTLPPGLITFWN TY LD+
Sbjct  560  RACGWAFGMNIFDLDEWRKQNITEVYHKWQNLNHDRLLWKLGTLPPGLITFWNRTYTLDK  619

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGY+PNV QKDIERAAVIHYNGNLKPWLEI IPKFRNYW++F++Y+ ++LREC
Sbjct  620  SWHVLGLGYDPNVPQKDIERAAVIHYNGNLKPWLEIGIPKFRNYWAKFVDYEHIYLREC  678



>gb|EYU27625.1| hypothetical protein MIMGU_mgv1a004359mg [Erythranthe guttata]
Length=531

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL +WR++NIT+VYH WQ LN+DR LWKLGTLPPGLITFWNHTYALD+
Sbjct  409  RACGWAFGMNIFDLDQWRKQNITQVYHKWQNLNHDRLLWKLGTLPPGLITFWNHTYALDK  468

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            +WHVLGLGYNP V Q+DI+RAAVIHYNGNLKPWLEI IPKFR+YW++F++YD V+LREC
Sbjct  469  AWHVLGLGYNPGVAQRDIDRAAVIHYNGNLKPWLEIGIPKFRSYWAKFVDYDHVYLREC  527



>emb|CDP04556.1| unnamed protein product [Coffea canephora]
Length=684

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI+DL EW+R+NITEVYHSWQ LN+DRQLWKLGTLPPGLITFWN TYALDR
Sbjct  562  RACGWAFGMNIVDLDEWKRQNITEVYHSWQNLNHDRQLWKLGTLPPGLITFWNRTYALDR  621

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPN+  K+I+RAAV+HYNGNLKPWLEI IPK+R+YW+++++YDQ++LREC
Sbjct  622  YWHVLGLGYNPNISPKEIDRAAVVHYNGNLKPWLEIGIPKYRSYWAKYVDYDQMYLREC  680



>ref|XP_010272524.1| PREDICTED: probable galacturonosyltransferase 4 [Nelumbo nucifera]
Length=673

 Score =   222 bits (565),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH+WQ LN DRQLWKLGTLPPGLITFWN T+ALDRS
Sbjct  552  ACGWAYGMNIFDLDEWKKQNITEVYHTWQKLNQDRQLWKLGTLPPGLITFWNRTFALDRS  611

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGYNPN+  ++IE+AAVIHYNGN+KPWLEI +P++RNYW++F+ YD+V+LREC
Sbjct  612  WHALGLGYNPNINLEEIEQAAVIHYNGNMKPWLEIGLPQYRNYWAKFVNYDEVYLREC  669



>ref|XP_003630116.1| Nudix hydrolase [Medicago truncatula]
Length=886

 Score =   223 bits (569),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  764  RACGWAYGMNVFDLVEWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNR  823

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDIERAAVIHYNGNLKPWLEISIPKF+ YW+++++Y+  +LREC
Sbjct  824  SWHVLGLGYNPNVNQKDIERAAVIHYNGNLKPWLEISIPKFKGYWTKYVDYESEYLREC  882



>ref|XP_003630117.1| Nudix hydrolase [Medicago truncatula]
Length=868

 Score =   223 bits (569),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  746  RACGWAYGMNVFDLVEWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNR  805

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDIERAAVIHYNGNLKPWLEISIPKF+ YW+++++Y+  +LREC
Sbjct  806  SWHVLGLGYNPNVNQKDIERAAVIHYNGNLKPWLEISIPKFKGYWTKYVDYESEYLREC  864



>ref|XP_010910633.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010910634.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010910635.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
Length=659

 Score =   220 bits (561),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 91/118 (77%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWR++NITE+YHSWQ LN+DR LWKLGTLPPGLITFWN T+ LDRS
Sbjct  538  ACGWAYGMNVFDLAEWRKQNITELYHSWQKLNHDRLLWKLGTLPPGLITFWNRTFPLDRS  597

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+IE+AAVIHYNGN+KPWLEI +PK+RN+WS++I YDQVFL++C
Sbjct  598  WHVLGLGYNPHVVQKEIEQAAVIHYNGNMKPWLEIGMPKYRNHWSKYINYDQVFLQDC  655



>gb|KDO78639.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=588

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  466  RACGWAYGMNIFDLDEWRRQNITDVYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDR  525

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAVIHYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  526  FWHVLGLGYNPSVNQRDIERAAVIHYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  584



>ref|XP_006467237.1| PREDICTED: probable galacturonosyltransferase 4-like [Citrus 
sinensis]
 gb|KDO78640.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=646

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  524  RACGWAYGMNIFDLDEWRRQNITDVYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDR  583

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAVIHYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  584  FWHVLGLGYNPSVNQRDIERAAVIHYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  642



>gb|KDO78642.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=656

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  534  RACGWAYGMNIFDLDEWRRQNITDVYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDR  593

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAVIHYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  594  FWHVLGLGYNPSVNQRDIERAAVIHYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  652



>ref|XP_006449976.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
 gb|ESR63216.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
Length=646

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  524  RACGWAYGMNIFDLDEWRRQNITDVYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDR  583

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAVIHYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  584  FWHVLGLGYNPSVNQRDIERAAVIHYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  642



>ref|XP_010052503.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052504.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052505.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76571.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
 gb|KCW76572.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=659

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFWN T+ LDR
Sbjct  537  RACGWAYGMNVFDLKEWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWNRTHPLDR  596

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV Q+DIERAAVIHYNGNLKPWLEI +PK+RNYW ++++YD V+LREC
Sbjct  597  LWHVLGLGYNPNVNQRDIERAAVIHYNGNLKPWLEIGMPKYRNYWVKYVDYDHVYLREC  655



>ref|XP_010052506.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010052507.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Eucalyptus 
grandis]
 gb|KCW76573.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=654

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFWN T+ LDR
Sbjct  532  RACGWAYGMNVFDLKEWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWNRTHPLDR  591

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV Q+DIERAAVIHYNGNLKPWLEI +PK+RNYW ++++YD V+LREC
Sbjct  592  LWHVLGLGYNPNVNQRDIERAAVIHYNGNLKPWLEIGMPKYRNYWVKYVDYDHVYLREC  650



>ref|XP_010052508.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Eucalyptus 
grandis]
 ref|XP_010052509.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Eucalyptus 
grandis]
 gb|KCW76574.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=653

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFWN T+ LDR
Sbjct  531  RACGWAYGMNVFDLKEWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWNRTHPLDR  590

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV Q+DIERAAVIHYNGNLKPWLEI +PK+RNYW ++++YD V+LREC
Sbjct  591  LWHVLGLGYNPNVNQRDIERAAVIHYNGNLKPWLEIGMPKYRNYWVKYVDYDHVYLREC  649



>ref|XP_008794742.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Phoenix 
dactylifera]
Length=641

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NITEVYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+
Sbjct  520  ACGWAYGMNVFDLVEWRKQNITEVYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRA  579

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V QK+IERAAVIHYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  580  WHILGLGYNPHVAQKEIERAAVIHYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  637



>ref|XP_008794741.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Phoenix 
dactylifera]
Length=642

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NITEVYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+
Sbjct  521  ACGWAYGMNVFDLVEWRKQNITEVYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRA  580

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V QK+IERAAVIHYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  581  WHILGLGYNPHVAQKEIERAAVIHYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  638



>ref|XP_008794740.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Phoenix 
dactylifera]
Length=659

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NITEVYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+
Sbjct  538  ACGWAYGMNVFDLVEWRKQNITEVYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRA  597

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V QK+IERAAVIHYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  598  WHILGLGYNPHVAQKEIERAAVIHYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  655



>ref|XP_008794739.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Phoenix 
dactylifera]
Length=660

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NITEVYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+
Sbjct  539  ACGWAYGMNVFDLVEWRKQNITEVYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRA  598

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V QK+IERAAVIHYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  599  WHILGLGYNPHVAQKEIERAAVIHYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  656



>ref|XP_009374812.1| PREDICTED: probable galacturonosyltransferase 4 [Pyrus x bretschneideri]
Length=671

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  550  ACGWAYGMNIFDLKEWKKQNITEVYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  609

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK I+RAAVIHYNGN+KPWLEI IPK+RNYW++F++YDQ+++REC
Sbjct  610  WHVLGLGYNPSVNQKQIDRAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDQMYMREC  667



>ref|XP_008794737.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Phoenix 
dactylifera]
Length=665

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NITEVYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+
Sbjct  544  ACGWAYGMNVFDLVEWRKQNITEVYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRA  603

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V QK+IERAAVIHYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  604  WHILGLGYNPHVAQKEIERAAVIHYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  661



>ref|XP_008794738.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Phoenix 
dactylifera]
Length=664

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NITEVYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+
Sbjct  543  ACGWAYGMNVFDLVEWRKQNITEVYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRA  602

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V QK+IERAAVIHYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  603  WHILGLGYNPHVAQKEIERAAVIHYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  660



>ref|NP_001148932.1| transferase, transferring glycosyl groups [Zea mays]
 gb|ACG33522.1| transferase, transferring glycosyl groups [Zea mays]
Length=648

 Score =   218 bits (556),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            AC WA GMN+ DL+EWRR+NITE+YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RS
Sbjct  527  ACVWAFGMNVFDLAEWRRQNITEIYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRS  586

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIE AAVIHYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  587  WHVLGLGYNPHVNSRDIEHAAVIHYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  644



>gb|KDO78641.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=717

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  595  RACGWAYGMNIFDLDEWRRQNITDVYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDR  654

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAVIHYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  655  FWHVLGLGYNPSVNQRDIERAAVIHYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  713



>gb|AFW60920.1| transferase [Zea mays]
Length=648

 Score =   218 bits (556),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            AC WA GMN+ DL+EWRR+NITE+YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RS
Sbjct  527  ACVWAFGMNVFDLAEWRRQNITEIYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRS  586

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIE AAVIHYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  587  WHVLGLGYNPHVNSRDIEHAAVIHYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  644



>ref|XP_008677252.1| PREDICTED: transferase, transferring glycosyl groups isoform 
X1 [Zea mays]
 gb|ACN31213.1| unknown [Zea mays]
 gb|AFW60919.1| hypothetical protein ZEAMMB73_694281 [Zea mays]
Length=649

 Score =   218 bits (556),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            AC WA GMN+ DL+EWRR+NITE+YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RS
Sbjct  528  ACVWAFGMNVFDLAEWRRQNITEIYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRS  587

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIE AAVIHYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  588  WHVLGLGYNPHVNSRDIEHAAVIHYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  645



>ref|XP_006449975.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
 gb|ESR63215.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
Length=717

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  595  RACGWAYGMNIFDLDEWRRQNITDVYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDR  654

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAVIHYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  655  FWHVLGLGYNPSVNQRDIERAAVIHYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  713



>gb|AET04592.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=580

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  458  RACGWAYGMNVFDLVEWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNR  517

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDIERAAVIHYNGNLKPWLEISIPKF+ YW+++++Y+  +LREC
Sbjct  518  SWHVLGLGYNPNVNQKDIERAAVIHYNGNLKPWLEISIPKFKGYWTKYVDYESEYLREC  576



>gb|ABN08854.1| Glycosyl transferase, family 8 [Medicago truncatula]
Length=680

 Score =   218 bits (555),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+R+ ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+++
Sbjct  559  ACGWAYGMNVFDLVQWKRQKITEVYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNKA  618

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV QKDI+RAAV+HYNGN+KPWLEISIPKFR YW++++ Y+ V+LREC
Sbjct  619  WHVLGLGYNPNVNQKDIDRAAVMHYNGNMKPWLEISIPKFRGYWTKYVNYNHVYLREC  676



>ref|XP_008384215.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Malus 
domestica]
Length=669

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  548  ACGWAYGMNIFDLKEWKKQNITEVYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  607

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+I+RAAVIHYNGN+KPWLEI IPK+RNYW++F++YDQ+++REC
Sbjct  608  WHVLGLGYNPSVNRKEIDRAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDQMYMREC  665



>ref|XP_008384214.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Malus 
domestica]
Length=671

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  550  ACGWAYGMNIFDLKEWKKQNITEVYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  609

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+I+RAAVIHYNGN+KPWLEI IPK+RNYW++F++YDQ+++REC
Sbjct  610  WHVLGLGYNPSVNRKEIDRAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDQMYMREC  667



>ref|XP_003594361.1| Galacturonosyltransferase [Medicago truncatula]
 gb|AES64612.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=667

 Score =   218 bits (554),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 87/118 (74%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+R+ ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+++
Sbjct  546  ACGWAYGMNVFDLVQWKRQKITEVYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNKA  605

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV QKDI+RAAV+HYNGN+KPWLEISIPKFR YW++++ Y+ V+LREC
Sbjct  606  WHVLGLGYNPNVNQKDIDRAAVMHYNGNMKPWLEISIPKFRGYWTKYVNYNHVYLREC  663



>ref|XP_007026431.1| Galacturonosyltransferase 4 isoform 2 [Theobroma cacao]
 gb|EOY29053.1| Galacturonosyltransferase 4 isoform 2 [Theobroma cacao]
Length=624

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWRR+NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  503  ACGWAYGMNIFDLEEWRRQNITEVYHRWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  562

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q+++ERAAVIHYNGNLKPWLEI IPK++NYW+++++YD ++LR+C
Sbjct  563  WHVLGLGYNPNVNQREVERAAVIHYNGNLKPWLEIGIPKYKNYWAKYVDYDNMYLRDC  620



>ref|XP_007026430.1| Galacturonosyltransferase 4 isoform 1 [Theobroma cacao]
 gb|EOY29052.1| Galacturonosyltransferase 4 isoform 1 [Theobroma cacao]
Length=626

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWRR+NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  505  ACGWAYGMNIFDLEEWRRQNITEVYHRWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  564

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q+++ERAAVIHYNGNLKPWLEI IPK++NYW+++++YD ++LR+C
Sbjct  565  WHVLGLGYNPNVNQREVERAAVIHYNGNLKPWLEIGIPKYKNYWAKYVDYDNMYLRDC  622



>gb|ACF83776.1| unknown [Zea mays]
Length=180

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            AC WA GMN+ DL+EWRR+NITE+YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RS
Sbjct  59   ACVWAFGMNVFDLAEWRRQNITEIYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRS  118

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIE AAVIHYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  119  WHVLGLGYNPHVNSRDIEHAAVIHYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  176



>ref|XP_004499343.1| PREDICTED: probable galacturonosyltransferase 4-like [Cicer arietinum]
Length=658

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL  W+++NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  536  RACGWAYGMNVFDLVGWKKQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNR  595

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPNV QKDIERAAVIHYNGN+KPWLEISIPKFR YW+++++YD V+LREC
Sbjct  596  SWHVLGLGYNPNVNQKDIERAAVIHYNGNMKPWLEISIPKFRAYWTKYVDYDIVYLREC  654



>ref|XP_010910637.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=549

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWR++NITE+YHSWQ LN+DR LWKLGTLPPGLITFWN T+ LDRS
Sbjct  428  ACGWAYGMNVFDLAEWRKQNITELYHSWQKLNHDRLLWKLGTLPPGLITFWNRTFPLDRS  487

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+IE+AAVIHYNGN+KPWLEI +PK+RN+WS++I YDQVFL++C
Sbjct  488  WHVLGLGYNPHVVQKEIEQAAVIHYNGNMKPWLEIGMPKYRNHWSKYINYDQVFLQDC  545



>ref|XP_009363241.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
4 [Pyrus x bretschneideri]
Length=667

 Score =   216 bits (551),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKL TLPPGLITFW  TY LDRS
Sbjct  546  ACGWAYGMNIFDLEEWKKQNITEVYHGWQKLNHDRQLWKLXTLPPGLITFWKRTYPLDRS  605

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+ AAVIHYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  606  WHVLGLGYNPSVNQKEIDGAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  663



>gb|EEC83383.1| hypothetical protein OsI_28798 [Oryza sativa Indica Group]
Length=621

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWRR+NITE+YHSWQ LN DR LWKLGTLPPGLITFWN T  L+RS
Sbjct  500  ACGWAFGMNVFDLAEWRRQNITEIYHSWQKLNQDRLLWKLGTLPPGLITFWNKTLPLNRS  559

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PKFRNYWS +++YDQ FLREC
Sbjct  560  WHVLGLGYNPHVSSRDIERAAVIHYNGNMKPWLEIGLPKFRNYWSAYLDYDQPFLREC  617



>gb|KHN40223.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=664

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL +W+R+NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  542  RACGWAYGMNVFDLVQWKRQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFQLNR  601

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPN+ QK+IERAAVIHYNGN+KPWLEIS PKFR YW+++++YD V+LREC
Sbjct  602  SWHVLGLGYNPNINQKEIERAAVIHYNGNMKPWLEISFPKFRGYWTKYVDYDLVYLREC  660



>ref|XP_006584115.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Glycine max]
 ref|XP_006584116.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Glycine max]
Length=664

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL +W+R+NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+R
Sbjct  542  RACGWAYGMNVFDLVQWKRQNITEVYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFQLNR  601

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPN+ QK+IERAAVIHYNGN+KPWLEIS PKFR YW+++++YD V+LREC
Sbjct  602  SWHVLGLGYNPNINQKEIERAAVIHYNGNMKPWLEISFPKFRGYWTKYVDYDLVYLREC  660



>ref|NP_001061555.1| Os08g0327100 [Oryza sativa Japonica Group]
 dbj|BAD01674.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 dbj|BAD03445.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF23469.1| Os08g0327100 [Oryza sativa Japonica Group]
 gb|EEE68483.1| hypothetical protein OsJ_26894 [Oryza sativa Japonica Group]
Length=643

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWRR+NITE+YHSWQ LN DR LWKLGTLPPGLITFWN T  L+RS
Sbjct  522  ACGWAFGMNVFDLAEWRRQNITEIYHSWQKLNQDRLLWKLGTLPPGLITFWNKTLPLNRS  581

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PKFRNYWS +++YDQ FLREC
Sbjct  582  WHVLGLGYNPHVSSRDIERAAVIHYNGNMKPWLEIGLPKFRNYWSAYLDYDQPFLREC  639



>ref|XP_008349398.1| PREDICTED: probable galacturonosyltransferase 4 [Malus domestica]
Length=554

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  433  ACGWAYGMNIFDLEEWKKQNITEVYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  492

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+ AAVIHYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  493  WHVLGLGYNPSVNQKEIDGAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  550



>ref|XP_007213869.1| hypothetical protein PRUPE_ppa018681mg [Prunus persica]
 gb|EMJ15068.1| hypothetical protein PRUPE_ppa018681mg [Prunus persica]
Length=659

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDR
Sbjct  537  RACGWAYGMNIFDLEEWKKQNITEVYHRWQELNHDRQLWKLGTLPPGLITFWKRTYPLDR  596

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNP+V QK+I+RAAVIHYNGN+KPWLEI IPK+RNYW ++++YD +++REC
Sbjct  597  SWHVLGLGYNPSVNQKEIDRAAVIHYNGNMKPWLEIGIPKYRNYWVKYVDYDHMYMREC  655



>ref|XP_004973216.1| PREDICTED: probable galacturonosyltransferase 4-like [Setaria 
italica]
Length=648

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EW+R+NIT++YHSWQ LN DR LWKLGTLPPGLITFWN T+ L RS
Sbjct  527  ACGWAFGMNVFDLAEWKRQNITQIYHSWQKLNQDRSLWKLGTLPPGLITFWNKTFPLSRS  586

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PKFR+YWSR+++YDQ FLREC
Sbjct  587  WHVLGLGYNPHVNSRDIERAAVIHYNGNMKPWLEIGLPKFRSYWSRYLDYDQHFLREC  644



>ref|XP_003535002.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
1 [Glycine max]
Length=657

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EW+R+NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RS
Sbjct  536  ACGWAYGMNVFDLAEWKRQNITEVYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRS  595

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV Q+DIE++AV+HYNGN+KPWLEISIPKFR YW+ +++YD V+LREC
Sbjct  596  WHILGLGYNPNVNQRDIEQSAVVHYNGNMKPWLEISIPKFRRYWTNYVDYDHVYLREC  653



>ref|XP_010686598.1| PREDICTED: probable galacturonosyltransferase 4 [Beta vulgaris 
subsp. vulgaris]
Length=640

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+R+NIT+VYH+WQ LN+DRQLWKLGTLPPGLITFW  TY LDR 
Sbjct  519  ACGWAYGMNIFDLEEWKRQNITDVYHTWQKLNHDRQLWKLGTLPPGLITFWKTTYPLDRL  578

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI IPK+R YWS++I+YDQV+LREC
Sbjct  579  WHVLGLGYNPSVNSRDIERAAVIHYNGNMKPWLEIGIPKYRGYWSKYIDYDQVYLREC  636



>gb|KHN40761.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=652

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EW+R+NITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RS
Sbjct  531  ACGWAYGMNVFDLAEWKRQNITEVYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRS  590

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV Q+DIE++AV+HYNGN+KPWLEISIPKFR YW+ +++YD V+LREC
Sbjct  591  WHILGLGYNPNVNQRDIEQSAVVHYNGNMKPWLEISIPKFRRYWTNYVDYDHVYLREC  648



>ref|XP_010910636.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Elaeis 
guineensis]
Length=645

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWR++NITE+YHSWQ LN+DR LWKLGTLPPGLITFWN T+ LDRS
Sbjct  524  ACGWAYGMNVFDLAEWRKQNITELYHSWQKLNHDRLLWKLGTLPPGLITFWNRTFPLDRS  583

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+IE+AAVIHYNGN+KPWLEI +PK+RN+WS++I YDQVFL++C
Sbjct  584  WHVLGLGYNPHVVQKEIEQAAVIHYNGNMKPWLEIGMPKYRNHWSKYINYDQVFLQDC  641



>gb|KDP29029.1| hypothetical protein JCGZ_16418 [Jatropha curcas]
Length=644

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EWRR+NIT+VYH+WQ LN+DR LWKLGTLPPGLITFW  TY+L+R
Sbjct  522  RACGWAYGMNIFDLKEWRRQNITDVYHNWQKLNHDRTLWKLGTLPPGLITFWKWTYSLER  581

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNP++ Q++IERAAVIHYNGN+KPWLEI IPK+RNYWS++++YD V+LREC
Sbjct  582  SWHVLGLGYNPSLNQREIERAAVIHYNGNMKPWLEIGIPKYRNYWSKYVDYDHVYLREC  640



>ref|XP_002444200.1| hypothetical protein SORBIDRAFT_07g014890 [Sorghum bicolor]
 gb|EES13695.1| hypothetical protein SORBIDRAFT_07g014890 [Sorghum bicolor]
Length=648

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWRR+NIT++YHSWQ LN DR LWKLGTLPPGLITFWN T+ L RS
Sbjct  527  ACGWAFGMNVFDLAEWRRQNITQIYHSWQKLNEDRSLWKLGTLPPGLITFWNKTFPLSRS  586

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PK+R+YWS++++YDQ FLREC
Sbjct  587  WHVLGLGYNPHVNSRDIERAAVIHYNGNMKPWLEIGLPKYRSYWSKYLDYDQSFLREC  644



>ref|XP_011460082.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=644

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW HTY LDRS
Sbjct  523  ACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDRQLWKLGTLPPGLITFWKHTYPLDRS  582

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+RAAVIHYNGN+KPWLEI IPK+R+YW+++++YD  ++REC
Sbjct  583  WHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEIGIPKYRSYWAKYVDYDHKYMREC  640



>ref|XP_008440950.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Cucumis 
melo]
Length=627

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+R+NITEVYHSWQ LN DRQLWKLGTLPPGLITFW  TY L++S
Sbjct  506  ACGWAYGMNIFDLDEWKRQNITEVYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLNKS  565

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV QK+I+RAAVIHYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  566  WHVLGLGYNPNVGQKEIDRAAVIHYNGNMKPWLEIAIPKYRNYWAKHVDFDNVYLREC  623



>ref|XP_011460081.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=647

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW HTY LDRS
Sbjct  526  ACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDRQLWKLGTLPPGLITFWKHTYPLDRS  585

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+RAAVIHYNGN+KPWLEI IPK+R+YW+++++YD  ++REC
Sbjct  586  WHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEIGIPKYRSYWAKYVDYDHKYMREC  643



>ref|XP_011460080.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=648

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW HTY LDRS
Sbjct  527  ACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDRQLWKLGTLPPGLITFWKHTYPLDRS  586

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+RAAVIHYNGN+KPWLEI IPK+R+YW+++++YD  ++REC
Sbjct  587  WHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEIGIPKYRSYWAKYVDYDHKYMREC  644



>ref|XP_008358828.1| PREDICTED: probable galacturonosyltransferase 4 [Malus domestica]
Length=669

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  548  ACGWAYGMNIFDLEEWKKQNITEVYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRS  607

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+ AAVIHYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  608  WHVLGLGYNPSVNQKEIDGAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  665



>ref|XP_002882844.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59103.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  479  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNRDRELWKLGTLPPGLITFWRRTYPLDR  538

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R++WS+ ++Y+QV+LREC
Sbjct  539  KWHILGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRSFWSKHVDYEQVYLREC  597



>ref|XP_006597630.1| PREDICTED: probable galacturonosyltransferase 4-like [Glycine 
max]
 gb|KHN14400.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=657

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EW+R+NIT VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RS
Sbjct  536  ACGWAYGMNVFDLAEWKRQNITGVYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRS  595

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV Q+DIE++AV+HYNGN+KPWLEISIPKFR+YW+++++YD V+LREC
Sbjct  596  WHILGLGYNPNVNQRDIEQSAVVHYNGNMKPWLEISIPKFRSYWTKYVDYDHVYLREC  653



>ref|XP_010252974.1| PREDICTED: probable galacturonosyltransferase 4 [Nelumbo nucifera]
Length=697

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NIT VYH+WQ LN+DR+LWKLGTLPPGLITFWN T  LDRS
Sbjct  576  ACGWAYGMNIFDLEEWKKQNITGVYHTWQKLNHDRRLWKLGTLPPGLITFWNRTLPLDRS  635

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ QK+IERAAVIHYNGN+KPWLEI IP++RNYW+RFI YDQV+LREC
Sbjct  636  WHVLGLGYNPSMNQKEIERAAVIHYNGNMKPWLEIGIPRYRNYWARFIYYDQVYLREC  693



>ref|XP_008440947.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008440949.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Cucumis 
melo]
Length=641

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+R+NITEVYHSWQ LN DRQLWKLGTLPPGLITFW  TY L++S
Sbjct  520  ACGWAYGMNIFDLDEWKRQNITEVYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLNKS  579

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV QK+I+RAAVIHYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  580  WHVLGLGYNPNVGQKEIDRAAVIHYNGNMKPWLEIAIPKYRNYWAKHVDFDNVYLREC  637



>gb|KJB67441.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=395

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWRR++ITEVYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+S
Sbjct  274  ACGWAYGMNIFDLAEWRRQSITEVYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKS  333

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++I+RAAVIHYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  334  WHVLGLGYNPNVNQREIDRAAVIHYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  391



>gb|EPS65589.1| hypothetical protein M569_09187 [Genlisea aurea]
Length=625

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI+DL  WR+ NIT+VYH WQ LN +RQLWKLGTLPPGLITFWNHT++L++
Sbjct  503  RACGWAFGMNIVDLGAWRKENITQVYHKWQNLNQERQLWKLGTLPPGLITFWNHTFSLEK  562

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGY+P V  KD++RA+VIHYNGNLKPWLE+SIPKFRNYW+++++Y+ V+LREC
Sbjct  563  SWHVLGLGYDPTVAAKDVDRASVIHYNGNLKPWLEVSIPKFRNYWNKYVDYEHVYLREC  621



>ref|XP_010234583.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Brachypodium 
distachyon]
Length=639

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWRR++ITE+YHSWQ LN DR LWKLGTLPPGLITFWN T+ L+RS
Sbjct  518  ACGWAFGMNVFDLAEWRRQDITEIYHSWQKLNEDRLLWKLGTLPPGLITFWNKTFPLNRS  577

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PKFR+YWS+++ YDQ FLREC
Sbjct  578  WHVLGLGYNPHVNSRDIERAAVIHYNGNMKPWLEIGLPKFRSYWSKYLYYDQPFLREC  635



>ref|XP_004134994.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
Length=625

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+R+NITEVYHSWQ LN DRQLWKLGTLPPGLITFW  TY LD+S
Sbjct  504  ACGWAYGMNIFDLDEWKRQNITEVYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLDKS  563

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYN NV QK+I+RAAVIHYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  564  WHVLGLGYNTNVGQKEIDRAAVIHYNGNMKPWLEIAIPKYRNYWTKHVDFDNVYLREC  621



>ref|XP_004158838.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
 gb|KGN49014.1| hypothetical protein Csa_6G510320 [Cucumis sativus]
Length=641

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+R+NITEVYHSWQ LN DRQLWKLGTLPPGLITFW  TY LD+S
Sbjct  520  ACGWAYGMNIFDLDEWKRQNITEVYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLDKS  579

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYN NV QK+I+RAAVIHYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  580  WHVLGLGYNTNVGQKEIDRAAVIHYNGNMKPWLEIAIPKYRNYWTKHVDFDNVYLREC  637



>ref|XP_003573698.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Brachypodium 
distachyon]
Length=660

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWRR++ITE+YHSWQ LN DR LWKLGTLPPGLITFWN T+ L+RS
Sbjct  539  ACGWAFGMNVFDLAEWRRQDITEIYHSWQKLNEDRLLWKLGTLPPGLITFWNKTFPLNRS  598

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PKFR+YWS+++ YDQ FLREC
Sbjct  599  WHVLGLGYNPHVNSRDIERAAVIHYNGNMKPWLEIGLPKFRSYWSKYLYYDQPFLREC  656



>ref|XP_010942295.1| PREDICTED: probable galacturonosyltransferase 4 [Elaeis guineensis]
Length=670

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            +ACGWA GMNI DL+EWR++NITE+YH+WQ LN+DRQLW LG+LPPGLITF+N T ALDR
Sbjct  548  KACGWAYGMNIFDLAEWRKQNITEIYHTWQELNHDRQLWSLGSLPPGLITFYNRTVALDR  607

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGY+P+V Q++IERAAVIHYNGN+KPWLEI +P++RNYWS++++YDQV+LR C
Sbjct  608  SWHVLGLGYDPDVNQREIERAAVIHYNGNMKPWLEIGMPQYRNYWSKYVDYDQVYLRNC  666



>gb|KHF97487.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
 gb|KHG30551.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=569

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWRR+NITEVYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+S
Sbjct  448  ACGWAYGMNIFDLAEWRRQNITEVYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKS  507

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++I+RAAVIHYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  508  WHVLGLGYNPNVNQREIDRAAVIHYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  565



>gb|KHN03562.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=656

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL +W+R+NIT+VYH+WQ +N+DRQLWKLGTLPPGLITFW  T+ L R
Sbjct  534  RACGWAYGMNVFDLVQWKRQNITDVYHNWQKMNHDRQLWKLGTLPPGLITFWKRTFQLHR  593

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPN+ QK+IERAAVIHYNGN+KPWLEISIPKFR YW+++++Y+ V+LREC
Sbjct  594  SWHVLGLGYNPNINQKEIERAAVIHYNGNMKPWLEISIPKFRGYWTKYVDYNLVYLREC  652



>ref|XP_006600275.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Glycine max]
 ref|XP_006600276.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Glycine max]
Length=661

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL +W+R+NIT+VYH WQ +N+DRQLWKLGTLPPGLITFW  T+ L R
Sbjct  539  RACGWAYGMNVFDLVQWKRQNITDVYHKWQKMNHDRQLWKLGTLPPGLITFWKRTFQLHR  598

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNPN+ QK+IERAAVIHYNGN+KPWLEISIPKFR YW+++++Y+ V+LREC
Sbjct  599  SWHVLGLGYNPNINQKEIERAAVIHYNGNMKPWLEISIPKFRGYWTKYVDYNLVYLREC  657



>ref|XP_008384326.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
4 [Malus domestica]
Length=554

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLIT W  TY LDRS
Sbjct  433  ACGWAYGMNIFDLEEWKKQNITEVYHGWQKLNHDRQLWKLGTLPPGLITXWKRTYPLDRS  492

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+I+ AAVIHYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  493  WHVLGLGYNPSVNQKEIDGAAVIHYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  550



>ref|XP_004168876.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
Length=649

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL+EW+R+NIT VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR
Sbjct  527  RACGWAYGMNIFDLNEWKRQNITGVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDR  586

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNP+V QK+IERAAVIHYNGN+KPWLEI+IP++RNYW ++++++Q +LR+C
Sbjct  587  SWHVLGLGYNPSVNQKEIERAAVIHYNGNMKPWLEIAIPRYRNYWMKYVDFNQEYLRQC  645



>ref|XP_006373556.1| hypothetical protein POPTR_0016s00360g [Populus trichocarpa]
 gb|ERP51353.1| hypothetical protein POPTR_0016s00360g [Populus trichocarpa]
Length=665

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+R+NIT+VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR
Sbjct  543  RACGWAYGMNIFDLKEWKRQNITDVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDR  602

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV Q++IERAAVIHYNGN+KPWLEI IPK+R+ W+++++YD  +LREC
Sbjct  603  RWHVLGLGYNPNVSQREIERAAVIHYNGNMKPWLEIGIPKYRSNWAKYVDYDHAYLREC  661



>gb|KJB67439.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=606

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWRR++ITEVYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+S
Sbjct  485  ACGWAYGMNIFDLAEWRRQSITEVYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKS  544

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++I+RAAVIHYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  545  WHVLGLGYNPNVNQREIDRAAVIHYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  602



>dbj|BAB11325.1| unnamed protein product [Arabidopsis thaliana]
Length=615

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  493  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  552

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  553  KWHILGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  611



>gb|KJB67440.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=603

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWRR++ITEVYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+S
Sbjct  482  ACGWAYGMNIFDLAEWRRQSITEVYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKS  541

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++I+RAAVIHYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  542  WHVLGLGYNPNVNQREIDRAAVIHYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  599



>ref|NP_568688.1| probable galacturonosyltransferase 4 [Arabidopsis thaliana]
 sp|Q93ZX7.1|GAUT4_ARATH RecName: Full=Probable galacturonosyltransferase 4; AltName: 
Full=Like glycosyl transferase 3 [Arabidopsis thaliana]
 gb|AAL07051.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14333.1| unknown protein [Arabidopsis thaliana]
 gb|AED95571.1| probable galacturonosyltransferase 4 [Arabidopsis thaliana]
 gb|AHL38587.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=616

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  494  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  553

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  554  KWHILGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  612



>gb|KJB67437.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=620

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWRR++ITEVYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+S
Sbjct  499  ACGWAYGMNIFDLAEWRRQSITEVYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKS  558

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++I+RAAVIHYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  559  WHVLGLGYNPNVNQREIDRAAVIHYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  616



>ref|XP_006660049.1| PREDICTED: probable galacturonosyltransferase 4-like, partial 
[Oryza brachyantha]
Length=616

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWR++NITE+YHSWQ LN DR LWKLGTLPPGLITFWN T+ L+RS
Sbjct  495  ACGWAFGMNVFDLAEWRQQNITEIYHSWQKLNQDRLLWKLGTLPPGLITFWNKTFPLNRS  554

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DI RAAVIHYNGN+KPWLEI +PKFRNYWS +++YDQ FLR+C
Sbjct  555  WHVLGLGYNPHVSSRDIVRAAVIHYNGNMKPWLEIGLPKFRNYWSTYLDYDQPFLRDC  612



>gb|KHG17315.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=611

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWRR+NITEVYH WQ LN+ RQLWKLGTLPPGLITFW   + L+RS
Sbjct  490  ACGWAYGMNIFDLAEWRRQNITEVYHRWQKLNHGRQLWKLGTLPPGLITFWKRIHPLNRS  549

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++IERAAVIHYNGNLKPWLEI IPK+RNYW++++ YD V+LR+C
Sbjct  550  WHVLGLGYNPNVNQREIERAAVIHYNGNLKPWLEIGIPKYRNYWAKYVHYDSVYLRDC  607



>gb|KGN65009.1| hypothetical protein Csa_1G179740 [Cucumis sativus]
Length=649

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL+EW+R+NIT+VYH+WQ LN+DRQLWKLGTLPPGLITFW   + LDR
Sbjct  527  RACGWAYGMNIFDLNEWKRQNITDVYHTWQKLNHDRQLWKLGTLPPGLITFWKRIHPLDR  586

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNP+V QK+IERAAVIHYNGN+KPWLEI+IP++RNYW ++++++Q +LR+C
Sbjct  587  SWHVLGLGYNPSVNQKEIERAAVIHYNGNMKPWLEIAIPRYRNYWMKYVDFNQEYLRQC  645



>ref|XP_008464310.1| PREDICTED: probable galacturonosyltransferase 4 [Cucumis melo]
Length=648

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+R+NIT+VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR
Sbjct  526  RACGWAYGMNIFDLEEWKRQNITDVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDR  585

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGYNP+V QK+IERAAVIHYNGN+KPWLEI+IP++RNYW ++++++  +LR+C
Sbjct  586  SWHVLGLGYNPSVNQKEIERAAVIHYNGNMKPWLEIAIPRYRNYWMKYVDFNHEYLRQC  644



>ref|XP_002525229.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF37195.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=647

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+R+NIT VYH+WQ LN+DR LWKLGTLPPGLITFW  TY++DRS
Sbjct  526  ACGWAYGMNVFDLDQWKRQNITGVYHTWQKLNHDRLLWKLGTLPPGLITFWKQTYSIDRS  585

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q++IERAAVIHYNGNLKPWLEI I K+RNYW+++++YD V+LREC
Sbjct  586  WHVLGLGYNPNVNQREIERAAVIHYNGNLKPWLEIGISKYRNYWAKYVDYDHVYLREC  643



>ref|XP_004959557.1| PREDICTED: probable galacturonosyltransferase 4-like [Setaria 
italica]
Length=753

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DLSEWR++NITEVYH+WQ LN +R LWKLGTLP GL+TFWN T+ LDRS
Sbjct  632  ACGWAYGMNIFDLSEWRKQNITEVYHTWQKLNENRLLWKLGTLPAGLVTFWNRTFPLDRS  691

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGYNPNV +KDI RAAVIHYNGNLKPWLEI +PK+R YWSR +++DQVFLREC
Sbjct  692  WHQLGLGYNPNVNEKDIRRAAVIHYNGNLKPWLEIGLPKYRKYWSRHVDFDQVFLREC  749



>ref|XP_007147564.1| hypothetical protein PHAVU_006G135100g [Phaseolus vulgaris]
 gb|ESW19558.1| hypothetical protein PHAVU_006G135100g [Phaseolus vulgaris]
Length=661

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W+R+ ITEVYH+WQ LN DRQLWKLGTLPPGLITFW  T+ L+RS
Sbjct  540  ACGWAYGMNIFDLVQWKRQKITEVYHNWQHLNRDRQLWKLGTLPPGLITFWKRTFPLNRS  599

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV QKDIE++AV+HYNGN+KPWLEISIPKFR+YW+++++Y+ V+LREC
Sbjct  600  WHVLGLGYNPNVGQKDIEQSAVVHYNGNMKPWLEISIPKFRSYWTKYVDYNHVYLREC  657



>ref|XP_009107093.1| PREDICTED: probable galacturonosyltransferase 4 [Brassica rapa]
Length=631

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR LWKLGTLPPGLITFW  TY LDR
Sbjct  509  RACGWAYGMNVFDLDEWKRQNITEVYHRWQNLNQDRDLWKLGTLPPGLITFWKRTYPLDR  568

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAV+HYNGNLKPWLEI IPK+R  WS+ ++Y  V+LREC
Sbjct  569  KWHVLGLGYNPSVNQRDIERAAVVHYNGNLKPWLEIGIPKYRGLWSKHVDYQHVYLREC  627



>ref|XP_010481270.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Camelina 
sativa]
 ref|XP_010481271.1| PREDICTED: probable galacturonosyltransferase 4 isoform X7 [Camelina 
sativa]
Length=619

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  497  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  556

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  557  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  615



>ref|XP_010481265.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
 ref|XP_010481266.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=620

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  498  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  557

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  558  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  616



>ref|XP_010481267.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Camelina 
sativa]
 ref|XP_010481268.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Camelina 
sativa]
 ref|XP_010481269.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Camelina 
sativa]
Length=619

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  497  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  556

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  557  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  615



>ref|XP_010481273.1| PREDICTED: probable galacturonosyltransferase 4 isoform X8 [Camelina 
sativa]
Length=618

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  496  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  555

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  556  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  614



>ref|XP_006279595.1| hypothetical protein CARUB_v10026096mg [Capsella rubella]
 gb|EOA12493.1| hypothetical protein CARUB_v10026096mg [Capsella rubella]
Length=614

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY L+R
Sbjct  492  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRQTYPLER  551

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  552  KWHILGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  610



>ref|XP_010495019.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=623

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  501  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  560

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  561  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  619



>ref|XP_010495018.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
Length=624

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  502  RACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  561

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  562  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  620



>ref|XP_006857626.1| hypothetical protein AMTR_s00061p00126570 [Amborella trichopoda]
 gb|ERN19093.1| hypothetical protein AMTR_s00061p00126570 [Amborella trichopoda]
Length=672

 Score =   211 bits (536),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++ ITE+YHSWQ LNNDRQLWKLGTLPPGLITF+N T+ L+R 
Sbjct  551  ACGWAFGMNIFDLKEWKKQEITEIYHSWQKLNNDRQLWKLGTLPPGLITFYNRTFPLNRG  610

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P+V Q+DI+RAA IHYNGNLKPWLEI +PKFR YW ++I Y+Q +L++C
Sbjct  611  WHVLGLGYDPSVNQRDIQRAAAIHYNGNLKPWLEIGLPKFRGYWQKYINYNQPYLQDC  668



>ref|XP_008224656.1| PREDICTED: probable galacturonosyltransferase 4 [Prunus mume]
 ref|XP_008224657.1| PREDICTED: probable galacturonosyltransferase 4 [Prunus mume]
Length=658

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+++NITEVYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS
Sbjct  537  ACGWAYGMNIFDLEEWKKQNITEVYHRWQELNHDRQLWKLGTLPPGLITFWKRTYPLDRS  596

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             HVLGLGYNP+V QK+I+RAAVIHYNGN+KPWLEI IPK+RNYW ++++YD +++REC
Sbjct  597  CHVLGLGYNPSVNQKEIDRAAVIHYNGNMKPWLEIGIPKYRNYWVKYVDYDHMYMREC  654



>ref|XP_010942525.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Elaeis 
guineensis]
Length=659

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            +CGWA GMN+ DL+EWR++ ITEVYHSWQ LN+DR LWKLGTLP GLITFWN T+ L+RS
Sbjct  538  SCGWAYGMNVFDLAEWRKQKITEVYHSWQRLNHDRLLWKLGTLPAGLITFWNRTFPLNRS  597

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PK+RNYWS+++ YDQVFLREC
Sbjct  598  WHVLGLGYNPHVAPRDIERAAVIHYNGNMKPWLEIGMPKYRNYWSKYVNYDQVFLREC  655



>ref|XP_010942526.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=659

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            +CGWA GMN+ DL+EWR++ ITEVYHSWQ LN+DR LWKLGTLP GLITFWN T+ L+RS
Sbjct  538  SCGWAYGMNVFDLAEWRKQKITEVYHSWQRLNHDRLLWKLGTLPAGLITFWNRTFPLNRS  597

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PK+RNYWS+++ YDQVFLREC
Sbjct  598  WHVLGLGYNPHVAPRDIERAAVIHYNGNMKPWLEIGMPKYRNYWSKYVNYDQVFLREC  655



>ref|XP_010942524.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
Length=660

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            +CGWA GMN+ DL+EWR++ ITEVYHSWQ LN+DR LWKLGTLP GLITFWN T+ L+RS
Sbjct  539  SCGWAYGMNVFDLAEWRKQKITEVYHSWQRLNHDRLLWKLGTLPAGLITFWNRTFPLNRS  598

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DIERAAVIHYNGN+KPWLEI +PK+RNYWS+++ YDQVFLREC
Sbjct  599  WHVLGLGYNPHVAPRDIERAAVIHYNGNMKPWLEIGMPKYRNYWSKYVNYDQVFLREC  656



>ref|XP_011040102.1| PREDICTED: probable galacturonosyltransferase 4 [Populus euphratica]
Length=660

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+R+NIT+VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR
Sbjct  538  RACGWAYGMNIFDLKEWKRQNITDVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDR  597

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV  ++IERAAVIHYNGN+KPWLEI IPK+R+ W+++++YD  +LREC
Sbjct  598  RWHVLGLGYNPNVSLREIERAAVIHYNGNMKPWLEIGIPKYRSNWAKYVDYDHAYLREC  656



>ref|XP_011016525.1| PREDICTED: probable galacturonosyltransferase 4 [Populus euphratica]
Length=660

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+R+NIT+VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR
Sbjct  538  RACGWAYGMNIFDLKEWKRQNITDVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDR  597

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV  ++IERAAVIHYNGN+KPWLEI IPK+R+ W+++++YD  +LREC
Sbjct  598  RWHVLGLGYNPNVSLREIERAAVIHYNGNMKPWLEIGIPKYRSNWAKYVDYDHAYLREC  656



>ref|XP_010441404.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=613

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R++ITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  491  RACGWAYGMNVFDLDEWKRQHITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  550

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  551  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  609



>ref|XP_010441403.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
Length=613

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R++ITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR
Sbjct  491  RACGWAYGMNVFDLDEWKRQHITEVYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDR  550

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  551  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  609



>ref|XP_007154077.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
 gb|ESW26071.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
Length=663

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W+++NITEVYH+WQ LN+DR+LWKLGTLPPGLITFW  T+ L RS
Sbjct  542  ACGWAYGMNIFDLVQWKKQNITEVYHNWQKLNHDRRLWKLGTLPPGLITFWKRTFPLHRS  601

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPN  QK+IERAAVIHYNGN+KPWLEI+IPKFR YW++++++D V+LREC
Sbjct  602  WHVLGLGYNPNTNQKEIERAAVIHYNGNMKPWLEITIPKFRGYWTKYVDHDLVYLREC  659



>ref|XP_008775901.1| PREDICTED: probable galacturonosyltransferase 4 [Phoenix dactylifera]
Length=654

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL+EWR++NITE+YH WQ LN+DR LW LGTLPPGLITF+N T+ALDRS
Sbjct  533  ACGWAYGMNIFDLAEWRKQNITEIYHFWQELNHDRLLWSLGTLPPGLITFYNRTFALDRS  592

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P+V Q DIERAAVIHYNGN+KPWLEI +P++RNYWS++++YDQ +LR C
Sbjct  593  WHVLGLGYDPDVNQTDIERAAVIHYNGNMKPWLEIVMPQYRNYWSKYVDYDQPYLRAC  650



>ref|XP_007154076.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
 gb|ESW26070.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
Length=655

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W+++NITEVYH+WQ LN+DR+LWKLGTLPPGLITFW  T+ L RS
Sbjct  534  ACGWAYGMNIFDLVQWKKQNITEVYHNWQKLNHDRRLWKLGTLPPGLITFWKRTFPLHRS  593

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPN  QK+IERAAVIHYNGN+KPWLEI+IPKFR YW++++++D V+LREC
Sbjct  594  WHVLGLGYNPNTNQKEIERAAVIHYNGNMKPWLEITIPKFRGYWTKYVDHDLVYLREC  651



>ref|XP_009101378.1| PREDICTED: probable galacturonosyltransferase 4 [Brassica rapa]
Length=634

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NITEVYH WQ LN DR+LWKLGTLPPGLITFW  TY L+R
Sbjct  512  RACGWAYGMNVFDLDEWKRQNITEVYHRWQNLNQDRELWKLGTLPPGLITFWKRTYPLER  571

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V Q+DIERAAV+HYNGNLKPWLEI +PK+R  WS+ ++Y  V+LREC
Sbjct  572  RWHVLGLGYNPSVNQRDIERAAVVHYNGNLKPWLEIGLPKYRGIWSKHVDYQHVYLREC  630



>emb|CAJ26362.1| glycosyl transferase-like protein [Brachypodium sylvaticum]
Length=689

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            +ACGWA GMN+ DLSEWR++NIT+VYH+WQ LN DR LWKLGTLP GL+TFWN T+ LDR
Sbjct  567  QACGWAFGMNMFDLSEWRKQNITDVYHTWQKLNEDRLLWKLGTLPAGLVTFWNRTFPLDR  626

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH+LGLGYNPNV ++DI RA+VIHYNGNLKPWLEI + K+R YWSR++++DQ+FLREC
Sbjct  627  SWHLLGLGYNPNVNERDIRRASVIHYNGNLKPWLEIGLSKYRKYWSRYVDFDQIFLREC  685



>emb|CAJ19325.1| glycosyl transferase-like protein [Triticum aestivum]
Length=697

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DLSEWR++NIT+VYH+WQ LN DR LWKLG+LP GL+TFWNHT+ LDRS
Sbjct  576  ACGWAYGMNMFDLSEWRKQNITDVYHTWQNLNEDRLLWKLGSLPAGLVTFWNHTFPLDRS  635

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV +K+I RA+VIHYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  636  WHLLGLGYNPNVNEKEIRRASVIHYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  693



>ref|XP_006398488.1| hypothetical protein EUTSA_v10000819mg [Eutrema salsugineum]
 gb|ESQ39941.1| hypothetical protein EUTSA_v10000819mg [Eutrema salsugineum]
Length=631

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMNI DL EW+++NITEVYH WQTLN  R+LWKLGTLPPGLITFW  TY LDR
Sbjct  509  RACGWAYGMNIFDLDEWKKQNITEVYHRWQTLNEGRELWKLGTLPPGLITFWRRTYPLDR  568

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGYNP+V Q+DIER AVIHYNGNLKPWLEI IP++R +W++ ++Y+ V+LREC
Sbjct  569  KWHILGLGYNPSVNQRDIERGAVIHYNGNLKPWLEIGIPRYRGFWAKHVDYEHVYLREC  627



>ref|XP_011005782.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Populus 
euphratica]
Length=648

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NIT+VYHSWQ LN+DRQLWKLGTLPPGLIT W  T+ LDR
Sbjct  526  RACGWAYGMNLFDLEEWKRQNITDVYHSWQKLNHDRQLWKLGTLPPGLITLWKRTHPLDR  585

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP V Q +IER AVIHYNGN+KPWLEI IPK+R YW+++++YD V+LREC
Sbjct  586  RWHVLGLGYNPIVSQIEIERGAVIHYNGNMKPWLEIGIPKYRKYWAKYVDYDNVYLREC  644



>ref|XP_011005780.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Populus 
euphratica]
 ref|XP_011005781.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Populus 
euphratica]
Length=655

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NIT+VYHSWQ LN+DRQLWKLGTLPPGLIT W  T+ LDR
Sbjct  533  RACGWAYGMNLFDLEEWKRQNITDVYHSWQKLNHDRQLWKLGTLPPGLITLWKRTHPLDR  592

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP V Q +IER AVIHYNGN+KPWLEI IPK+R YW+++++YD V+LREC
Sbjct  593  RWHVLGLGYNPIVSQIEIERGAVIHYNGNMKPWLEIGIPKYRKYWAKYVDYDNVYLREC  651



>ref|XP_002308736.1| hypothetical protein POPTR_0006s00320g [Populus trichocarpa]
 gb|EEE92259.1| hypothetical protein POPTR_0006s00320g [Populus trichocarpa]
Length=648

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NIT+VYHSWQ LN+DRQLWKLGTLPPGLIT W  T+ LDR
Sbjct  526  RACGWAYGMNLFDLEEWKRQNITDVYHSWQKLNHDRQLWKLGTLPPGLITLWKRTHPLDR  585

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNPNV Q +IER AVIHYNGN+KPWLEI IPK+R YW+++++Y  V+LREC
Sbjct  586  RWHVLGLGYNPNVSQIEIERGAVIHYNGNMKPWLEIGIPKYRKYWAKYVDYVNVYLREC  644



>ref|XP_010647027.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Vitis 
vinifera]
Length=637

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W++++ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ +DRS
Sbjct  516  ACGWAYGMNIFDLDQWKKQHITEVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTFPIDRS  575

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +++IERAAVIHYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  576  WHVLGLGYNPSVNRREIERAAVIHYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  633



>ref|XP_010647025.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010647026.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Vitis 
vinifera]
 emb|CBI18781.3| unnamed protein product [Vitis vinifera]
Length=638

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W++++ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ +DRS
Sbjct  517  ACGWAYGMNIFDLDQWKKQHITEVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTFPIDRS  576

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +++IERAAVIHYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  577  WHVLGLGYNPSVNRREIERAAVIHYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  634



>ref|XP_004974813.1| PREDICTED: probable galacturonosyltransferase 4-like [Setaria 
italica]
Length=687

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWR++NIT+ YH WQ LN +RQLWKLGTLP GL+TFWNHT+ LDR
Sbjct  565  RACGWAYGMNMFDLSEWRKQNITDAYHYWQNLNANRQLWKLGTLPAGLVTFWNHTFPLDR  624

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH+LGLGY PNV Q+DIERAAV+HYNGN KPWLEI +P++R +WS+++ +D VFLREC
Sbjct  625  SWHLLGLGYKPNVNQRDIERAAVVHYNGNRKPWLEIGLPRYRQFWSKYVNFDHVFLREC  683



>ref|XP_009395236.1| PREDICTED: probable galacturonosyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=636

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR++NI ++YH WQTLN DR LWKLGTLPPGLITFW  TY LDRS
Sbjct  515  ACGWAFGMNVFDLDEWRKQNIIDIYHHWQTLNEDRLLWKLGTLPPGLITFWKRTYPLDRS  574

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV Q+DIE AA IHYNGN+KPWLEI + K+ NYWS+++ YDQV+LR+C
Sbjct  575  WHVLGLGYNPNVNQQDIEGAAAIHYNGNMKPWLEIGMAKYHNYWSKYVNYDQVYLRDC  632



>gb|KFK31342.1| hypothetical protein AALP_AA6G099900 [Arabis alpina]
Length=651

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EW+R+NIT+VYH WQ LN DR+LWKLGTLPPGLITFW  TY +DR
Sbjct  529  RACGWAYGMNVFDLDEWKRQNITDVYHRWQDLNQDRELWKLGTLPPGLITFWKRTYPIDR  588

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH LGLGYNP+V Q+DIERAAVIHYNGNLKPWLEI +P++R +WS+ ++Y  V+LREC
Sbjct  589  KWHTLGLGYNPSVNQRDIERAAVIHYNGNLKPWLEIGLPRYRGFWSKHVDYGHVYLREC  647



>ref|XP_008782990.1| PREDICTED: probable galacturonosyltransferase 4 [Phoenix dactylifera]
Length=659

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EWR++NITE+YHSWQ LN+DR LWKLGTLPPGLITFW  T+ LD+S
Sbjct  538  ACGWAYGMNVFDLAEWRKQNITELYHSWQKLNHDRLLWKLGTLPPGLITFWKRTFPLDQS  597

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V QK+IE+AAVIHYN NLKPWLEI + K+RNYWS++I YDQVFL++C
Sbjct  598  WHVLGLGYNPHVDQKEIEQAAVIHYNRNLKPWLEIGMLKYRNYWSKYINYDQVFLQDC  655



>ref|XP_002460421.1| hypothetical protein SORBIDRAFT_02g027840 [Sorghum bicolor]
 gb|EER96942.1| hypothetical protein SORBIDRAFT_02g027840 [Sorghum bicolor]
Length=705

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DLSEWR++NITEVYH+WQ LN +R LWKLGTLP GL+TFWN T+ LD S
Sbjct  584  ACGWAYGMNMFDLSEWRKQNITEVYHTWQKLNENRLLWKLGTLPAGLVTFWNRTFPLDHS  643

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGYNPNV +KDI RAAVIHYNGNLKPWLEI +PK+R YWS  + YDQVFLREC
Sbjct  644  WHQLGLGYNPNVNEKDIRRAAVIHYNGNLKPWLEIGLPKYRKYWSAHVNYDQVFLREC  701



>ref|XP_010647084.1| PREDICTED: probable galacturonosyltransferase 4 [Vitis vinifera]
Length=638

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W++++ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T  +DRS
Sbjct  517  ACGWAYGMNIFDLDQWKKQHITEVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTLPIDRS  576

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +++IERAAVIHYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  577  WHVLGLGYNPSVNRREIERAAVIHYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  634



>ref|XP_008670271.1| PREDICTED: probable galacturonosyltransferase 4 [Zea mays]
 tpg|DAA40342.1| TPA: hypothetical protein ZEAMMB73_504957 [Zea mays]
Length=713

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DLS+WR++NITEVYH+WQ LN +R LWKLGTLP GL+TFWN T+ LDRS
Sbjct  592  ACGWAYGMNMFDLSDWRKQNITEVYHTWQKLNENRLLWKLGTLPAGLVTFWNRTFPLDRS  651

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGYNPNV  KDI RAAVIHYNGNLKPWLEI +PK+R YWS  + YDQVFLREC
Sbjct  652  WHQLGLGYNPNVNVKDIRRAAVIHYNGNLKPWLEIGLPKYRKYWSAHVNYDQVFLREC  709



>gb|EMS45059.1| putative galacturonosyltransferase 4 [Triticum urartu]
Length=674

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DLSEWR++NIT+VYH+WQ LN DR LWKLG+LP GL+TFWN T+ LDRS
Sbjct  553  ACGWAYGMNMFDLSEWRKQNITDVYHTWQNLNEDRLLWKLGSLPAGLVTFWNRTFPLDRS  612

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV +K+I RA+VIHYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  613  WHLLGLGYNPNVNEKEIRRASVIHYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  670



>gb|EMT04178.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=670

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DLSEWR++NIT+VYH+WQ LN DR LWKLG+LP GL+TFWN T+ LDRS
Sbjct  549  ACGWAYGMNMFDLSEWRKQNITDVYHTWQNLNEDRLLWKLGSLPAGLVTFWNRTFPLDRS  608

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV +K+I RA+VIHYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  609  WHLLGLGYNPNVNEKEIRRASVIHYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  666



>emb|CAN70213.1| hypothetical protein VITISV_038741 [Vitis vinifera]
Length=759

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W++++ITEVYH+WQ LN+DRQLWKLGTLPPGLITFW  T  +DRS
Sbjct  638  ACGWAYGMNIFDLDQWKKQHITEVYHTWQKLNHDRQLWKLGTLPPGLITFWKRTXPIDRS  697

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +++IERAAVIHYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  698  WHVLGLGYNPSVNRREIERAAVIHYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  755



>ref|XP_003578298.1| PREDICTED: probable galacturonosyltransferase 4 [Brachypodium 
distachyon]
Length=696

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWR++NIT+VYH+WQ LN DR LWKLGTLP GL+TFWN T+ LD 
Sbjct  574  RACGWAYGMNMFDLSEWRKQNITDVYHTWQKLNEDRLLWKLGTLPAGLVTFWNRTFPLDS  633

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH+LGLGYN NV ++DI RA+VIHYNGNLKPWLEI + K+R YWSR++++DQ+FLREC
Sbjct  634  SWHLLGLGYNTNVNERDIRRASVIHYNGNLKPWLEIGLSKYRKYWSRYVDFDQIFLREC  692



>ref|XP_006661357.1| PREDICTED: probable galacturonosyltransferase 4-like [Oryza brachyantha]
Length=688

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWRR+ IT VYH+WQ LN +RQLWKLGTLP GL+TFWN T+ LD 
Sbjct  566  RACGWAYGMNLFDLSEWRRQKITNVYHNWQRLNENRQLWKLGTLPAGLVTFWNRTFPLDH  625

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH LGLGYNPN+ +KDI RA+VIHYNGNLKPWLEI + K+R YWS++I++DQVFLR+C
Sbjct  626  SWHQLGLGYNPNINEKDIRRASVIHYNGNLKPWLEIGLAKYRKYWSKYIDFDQVFLRDC  684



>dbj|BAK01477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=697

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            +CGWA GMN+ DLSEWR++NIT+VYH+WQ LN DR LWKLG+LP GL+TFWN T+ LDRS
Sbjct  576  SCGWAYGMNMFDLSEWRKQNITDVYHTWQNLNEDRLLWKLGSLPAGLVTFWNRTFPLDRS  635

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNPNV +K+I RA+VIHYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  636  WHLLGLGYNPNVNEKEIRRASVIHYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  693



>ref|XP_009390607.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+++NIT+VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RS
Sbjct  495  ACGWAYGMNVFDLDEWKKQNITDVYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERS  554

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+ NV QKD+E AAVIHYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  555  WHVLGLGYSLNVEQKDVEAAAVIHYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  612



>ref|XP_009390606.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+++NIT+VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RS
Sbjct  495  ACGWAYGMNVFDLDEWKKQNITDVYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERS  554

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+ NV QKD+E AAVIHYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  555  WHVLGLGYSLNVEQKDVEAAAVIHYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  612



>ref|XP_009390605.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+++NIT+VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RS
Sbjct  495  ACGWAYGMNVFDLDEWKKQNITDVYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERS  554

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+ NV QKD+E AAVIHYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  555  WHVLGLGYSLNVEQKDVEAAAVIHYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  612



>ref|XP_009390604.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=617

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+++NIT+VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RS
Sbjct  496  ACGWAYGMNVFDLDEWKKQNITDVYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERS  555

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+ NV QKD+E AAVIHYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  556  WHVLGLGYSLNVEQKDVEAAAVIHYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  613



>ref|XP_009398763.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=663

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EWR++ +TEVYH WQ LN DRQLWKLG+LPPGLITF+N T ++DR
Sbjct  541  RACGWAYGMNVFDLDEWRKQKVTEVYHYWQNLNIDRQLWKLGSLPPGLITFYNRTLSIDR  600

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V  KDIE+AAVIHYNGN+KPWL+I IP++R YWS+ ++Y+ +FLREC
Sbjct  601  RWHVLGLGYNPHVDHKDIEQAAVIHYNGNMKPWLDIGIPQYRGYWSKNVDYNHIFLREC  659



>ref|XP_009398761.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=675

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EWR++ +TEVYH WQ LN DRQLWKLG+LPPGLITF+N T ++DR
Sbjct  553  RACGWAYGMNVFDLDEWRKQKVTEVYHYWQNLNIDRQLWKLGSLPPGLITFYNRTLSIDR  612

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V  KDIE+AAVIHYNGN+KPWL+I IP++R YWS+ ++Y+ +FLREC
Sbjct  613  RWHVLGLGYNPHVDHKDIEQAAVIHYNGNMKPWLDIGIPQYRGYWSKNVDYNHIFLREC  671



>ref|XP_009398760.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EWR++ +TEVYH WQ LN DRQLWKLG+LPPGLITF+N T ++DR
Sbjct  562  RACGWAYGMNVFDLDEWRKQKVTEVYHYWQNLNIDRQLWKLGSLPPGLITFYNRTLSIDR  621

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WHVLGLGYNP+V  KDIE+AAVIHYNGN+KPWL+I IP++R YWS+ ++Y+ +FLREC
Sbjct  622  RWHVLGLGYNPHVDHKDIEQAAVIHYNGNMKPWLDIGIPQYRGYWSKNVDYNHIFLREC  680



>ref|XP_010538434.1| PREDICTED: probable galacturonosyltransferase 4 [Tarenaya hassleriana]
Length=649

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW+R+NITEVYH WQ LN DR LWKLGTLPPGLITFW  T+ LDR+
Sbjct  528  ACGWAYGMNIFDLDEWKRQNITEVYHRWQNLNQDRSLWKLGTLPPGLITFWKRTHPLDRN  587

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V  +DI RAAVIHYNGNLKPWLEI I ++R YWS++++Y+  ++REC
Sbjct  588  WHVLGLGYNPSVNPRDIGRAAVIHYNGNLKPWLEIGITRYRGYWSKYVDYEHEYMREC  645



>gb|EPS62143.1| hypothetical protein M569_12650, partial [Genlisea aurea]
Length=475

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EWRR+NIT +YH WQ LN +R LWKLGTLPPGL+TFWN ++AL++
Sbjct  354  RACGWAFGMNVFDLREWRRQNITRIYHRWQELNEERLLWKLGTLPPGLLTFWNRSFALEK  413

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWHVLGLGY+     +DIERAAVIHYNGN KPWLEI I KFR+YW+++++YDQ +LR+C
Sbjct  414  SWHVLGLGYDAKTSTRDIERAAVIHYNGNAKPWLEIGIAKFRSYWTKYVDYDQRYLRDC  472



>gb|EMT08109.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=660

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            AC WA GMN+ DL+EWRR+NITE+YH WQ LN D  L KLGTLP GL+TFWN T+ LDRS
Sbjct  539  ACVWAFGMNMFDLAEWRRQNITEIYHFWQKLNEDGSLRKLGTLPLGLVTFWNKTFPLDRS  598

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V   D+ERAAVIHYNGN+KPWLEI +PKFR+YWS +++YDQ FLREC
Sbjct  599  WHVLGLGYNPHVSSGDLERAAVIHYNGNMKPWLEIGLPKFRSYWSEYLDYDQPFLREC  656



>gb|EMS56269.1| putative galacturonosyltransferase 4 [Triticum urartu]
Length=689

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            AC WA GMN+ DL+EWRR+NITE+YH WQ LN D  LWKLGTLP GL+TFWN T+ LDRS
Sbjct  568  ACVWAFGMNLFDLAEWRRQNITEIYHFWQKLNEDGLLWKLGTLPLGLVTFWNKTFPLDRS  627

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGYNP+V    +ERAAVIHYNGN+KPWLEI +PKFR+YWS +++YDQ FLREC
Sbjct  628  WHILGLGYNPHVSSSGLERAAVIHYNGNMKPWLEIGLPKFRSYWSEYLDYDQPFLREC  685



>gb|EAZ09508.1| hypothetical protein OsI_31783 [Oryza sativa Indica Group]
Length=679

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWRR+ IT+VYH+WQ LN +R LWKLGTLP GL+TFWN T+ L  
Sbjct  557  RACGWAYGMNVFDLSEWRRQKITDVYHNWQRLNENRILWKLGTLPAGLVTFWNRTFPLHH  616

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH LGLGYNPN+ +KDI RA+VIHYNGNLKPWLEI + ++R YWS+++++DQVFLR+C
Sbjct  617  SWHQLGLGYNPNINEKDIRRASVIHYNGNLKPWLEIGLSRYRKYWSKYVDFDQVFLRDC  675



>ref|NP_001063487.1| Os09g0480400 [Oryza sativa Japonica Group]
 dbj|BAD33390.1| glycosyltransferase family-like [Oryza sativa Japonica Group]
 dbj|BAD46337.1| glycosyltransferase family-like [Oryza sativa Japonica Group]
 dbj|BAF25401.1| Os09g0480400 [Oryza sativa Japonica Group]
 dbj|BAG94697.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69919.1| hypothetical protein OsJ_29771 [Oryza sativa Japonica Group]
Length=707

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWRR+ IT+VYH+WQ LN +R LWKLGTLP GL+TFWN T+ L  
Sbjct  585  RACGWAYGMNVFDLSEWRRQKITDVYHNWQRLNENRILWKLGTLPAGLVTFWNRTFPLHH  644

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH LGLGYNPN+ +KDI RA+VIHYNGNLKPWLEI + ++R YWS+++++DQVFLR+C
Sbjct  645  SWHQLGLGYNPNINEKDIRRASVIHYNGNLKPWLEIGLSRYRKYWSKYVDFDQVFLRDC  703



>ref|XP_002969595.1| GAUT1, alpha-1,4-galacturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ29683.1| GAUT1, alpha-1,4-galacturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=525

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++R+IT +YH WQT+N DR LWKLGTLPPGLITF+N TY LD+S
Sbjct  405  ACGWAYGMNIFDLEEWKKRDITGIYHKWQTMNKDRTLWKLGTLPPGLITFYNLTYPLDKS  464

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP V  +DI+ AAV+HYNGNLKPWLEI + +F+ YWSR+++YD  +L+EC
Sbjct  465  WHVLGLGYNPGVEPEDIDAAAVVHYNGNLKPWLEIGLSRFKGYWSRYVKYDHPYLQEC  522



>gb|EMS57452.1| putative galacturonosyltransferase 4 [Triticum urartu]
Length=643

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWRR+NIT VYH WQ  N  R LWKLGTLP GL+TFWN+T+ LDR
Sbjct  521  RACGWAYGMNMFDLSEWRRQNITAVYHYWQEQNEHRLLWKLGTLPAGLVTFWNNTFPLDR  580

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH+LGLGY  NV  KDIE+AAVIHYNGNLKPWLE+ +PK+RNYWS+++ +D  F+REC
Sbjct  581  SWHLLGLGYKRNVNPKDIEQAAVIHYNGNLKPWLEVGLPKYRNYWSKYVIFDHAFIREC  639



>ref|XP_002970865.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ28191.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=525

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++R+IT +YH WQT+N DR LWKLGTLPPGLITF+N TY LD+S
Sbjct  405  ACGWAYGMNIFDLEEWKKRDITGIYHKWQTMNKDRTLWKLGTLPPGLITFYNLTYPLDKS  464

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP V  ++I+ AAV+HYNGNLKPWLEI + +F+ YWSR+++YD  +L+EC
Sbjct  465  WHVLGLGYNPGVDPEEIDAAAVVHYNGNLKPWLEIGLSRFKGYWSRYVKYDHPYLQEC  522



>ref|XP_009407928.1| PREDICTED: probable galacturonosyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=661

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DL EWR++ IT+VYH WQ LN DRQLW+LG+LPPGLITF+NHT  +D 
Sbjct  539  RACGWAYGMNVFDLDEWRKQKITQVYHYWQNLNIDRQLWRLGSLPPGLITFYNHTIPIDH  598

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGYN  V  KDIE AAVIHYNGN+KPWL+I +PK+R YWS+++ YD +F+R+C
Sbjct  599  RWHILGLGYNAQVDLKDIESAAVIHYNGNMKPWLDIGMPKYRGYWSKYVNYDHIFIRDC  657



>dbj|BAD10126.1| glycosyltransferase family-like [Oryza sativa Japonica Group]
 gb|EEC83808.1| hypothetical protein OsI_29736 [Oryza sativa Indica Group]
Length=726

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWR+RNIT+VYH WQ  N  R LWKLGTLP GL+TFWN T+ LD 
Sbjct  604  RACGWAYGMNMFDLSEWRKRNITDVYHYWQEQNEHRLLWKLGTLPAGLVTFWNQTFPLDH  663

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGY PNV QKDIE AAVIHYNGN KPWLEI++ K+R YWS+++ +D VF+R+C
Sbjct  664  KWHLLGLGYKPNVNQKDIEGAAVIHYNGNRKPWLEIAMAKYRKYWSKYVNFDNVFIRQC  722



>gb|EEE68930.1| hypothetical protein OsJ_27797 [Oryza sativa Japonica Group]
Length=723

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWR+RNIT+VYH WQ  N  R LWKLGTLP GL+TFWN T+ LD 
Sbjct  601  RACGWAYGMNMFDLSEWRKRNITDVYHYWQEQNEHRLLWKLGTLPAGLVTFWNQTFPLDH  660

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
             WH+LGLGY PNV QKDIE AAVIHYNGN KPWLEI++ K+R YWS+++ +D VF+R+C
Sbjct  661  KWHLLGLGYKPNVNQKDIEGAAVIHYNGNRKPWLEIAMAKYRKYWSKYVNFDNVFIRQC  719



>ref|NP_195540.2| galacturonosyltransferase 3 [Arabidopsis thaliana]
 sp|Q0WQD2.2|GAUT3_ARATH RecName: Full=Probable galacturonosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE86907.1| galacturonosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38654.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=680

 Score =   192 bits (489),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRS
Sbjct  559  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRS  618

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  619  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  676



>dbj|BAF00667.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   192 bits (488),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRS
Sbjct  559  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRS  618

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  619  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  676



>ref|NP_001190952.1| galacturonosyltransferase 3 [Arabidopsis thaliana]
 gb|AEE86908.1| galacturonosyltransferase 3 [Arabidopsis thaliana]
Length=676

 Score =   192 bits (488),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRS
Sbjct  555  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRS  614

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  615  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  672



>emb|CAB37483.1| putative protein [Arabidopsis thaliana]
 emb|CAB80492.1| putative protein [Arabidopsis thaliana]
Length=658

 Score =   192 bits (487),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRS
Sbjct  537  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRS  596

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  597  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  654



>gb|EMT19760.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=671

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DLSEWRR+NIT VYH WQ  N  R LWKLGTLP GL+TFWN+T+ LDRS
Sbjct  550  ACGWAYGMNMFDLSEWRRQNITAVYHYWQEQNEHRLLWKLGTLPAGLVTFWNNTFPLDRS  609

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH+LGLGY  NV   DIE+AAVIHYNGNLKPWLE+ +PK+R+YWS+++ +D  F+REC
Sbjct  610  WHLLGLGYKRNVNPMDIEQAAVIHYNGNLKPWLEVGLPKYRSYWSKYVNFDHAFIREC  667



>gb|KDO85920.1| hypothetical protein CISIN_1g005683mg [Citrus sinensis]
 gb|KDO85921.1| hypothetical protein CISIN_1g005683mg [Citrus sinensis]
Length=683

 Score =   191 bits (486),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+N T+ L++S
Sbjct  562  ACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRTLWKLGTLPPGLITFYNLTHPLEKS  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + +IE AAV+HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  622  WHVLGLGYNPSVDRSEIENAAVVHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRNC  679



>emb|CAJ75629.1| glycosyl transferase-like protein [Brachypodium sylvaticum]
Length=501

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWRR+NIT+VYH WQ  N  R LWKLGTLP GL+TFWN T+ LDR
Sbjct  379  RACGWAYGMNMFDLSEWRRQNITDVYHYWQEQNEHRLLWKLGTLPAGLVTFWNRTFPLDR  438

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH+LGLGY  NV  +DIERAAVIHYNGNLKPWLE+ + K+R YW++++  DQ F+R C
Sbjct  439  SWHLLGLGYKQNVNPEDIERAAVIHYNGNLKPWLEVGLSKYRKYWTKYVNSDQAFIRGC  497



>ref|XP_006445203.1| hypothetical protein CICLE_v10019146mg [Citrus clementina]
 ref|XP_006490965.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Citrus sinensis]
 gb|ESR58443.1| hypothetical protein CICLE_v10019146mg [Citrus clementina]
Length=683

 Score =   191 bits (486),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+N T+ L++S
Sbjct  562  ACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRTLWKLGTLPPGLITFYNLTHPLEKS  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + +IE AAV+HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  622  WHVLGLGYNPSVDRSEIENAAVVHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRNC  679



>ref|XP_007051985.1| Galacturonosyltransferase 1 [Theobroma cacao]
 gb|EOX96142.1| Galacturonosyltransferase 1 [Theobroma cacao]
Length=676

 Score =   191 bits (484),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  555  ACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKS  614

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +++I+RAAVIHYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  615  WHVLGLGYNPSVDRREIDRAAVIHYNGNMKPWLELAMTKYRPYWAKYIKYDHPYLRSC  672



>ref|XP_011040798.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Populus 
euphratica]
Length=683

 Score =   191 bits (484),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+R NIT +YH WQ LN DR LWKLGTLPPGLITF+N TY LDRS
Sbjct  561  ACGWAFGMNMFDLKQWKRSNITGIYHHWQDLNEDRTLWKLGTLPPGLITFYNLTYPLDRS  620

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAV+HYNGN KPWL++++ K++ YWSR+++YD  +L++C
Sbjct  621  WHVLGLGYDPALNQTEIENAAVVHYNGNYKPWLDLAVAKYKPYWSRYVQYDNPYLQQC  678



>ref|XP_006285045.1| hypothetical protein CARUB_v10006353mg [Capsella rubella]
 gb|EOA17943.1| hypothetical protein CARUB_v10006353mg [Capsella rubella]
Length=694

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  573  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  632

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  633  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKLYWSKYVEYDNPYLRRC  690



>ref|XP_010450980.1| PREDICTED: probable galacturonosyltransferase 3, partial [Camelina 
sativa]
Length=264

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  143  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  202

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  203  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  260



>ref|XP_002866790.1| hypothetical protein ARALYDRAFT_912279 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43049.1| hypothetical protein ARALYDRAFT_912279 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  559  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  618

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  619  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  676



>gb|KFK30437.1| hypothetical protein AALP_AA7G260900 [Arabis alpina]
Length=685

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ LN DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  564  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMERS  623

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS++++YD  +LR C
Sbjct  624  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKTYWSKYVQYDNPYLRLC  681



>ref|XP_004229870.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Solanum lycopersicum]
Length=688

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ LD+S
Sbjct  567  ACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLDKS  626

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + DIE AAV+HYNGN+KPWLE+++ K+R YW+++I++D  ++R C
Sbjct  627  WHVLGLGYNPSIDRSDIENAAVVHYNGNMKPWLELAMTKYRPYWTKYIKFDHPYMRSC  684



>ref|XP_010235254.1| PREDICTED: probable galacturonosyltransferase 4 [Brachypodium 
distachyon]
Length=607

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -3

Query  645  RACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDR  466
            RACGWA GMN+ DLSEWRR+NIT+VYH WQ  N  R LWKLGTLP GL+TFWN T+ LDR
Sbjct  485  RACGWAYGMNMFDLSEWRRQNITDVYHYWQGQNEHRLLWKLGTLPAGLVTFWNRTFPLDR  544

Query  465  SWHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            SWH+LGLGY  NV  KDIERAAVIHYNGNLKPWLE+ + K+  YW++++  DQ F+R C
Sbjct  545  SWHLLGLGYKQNVTPKDIERAAVIHYNGNLKPWLEVGLSKYHKYWTKYVNSDQAFIRGC  603



>gb|KJB09887.1| hypothetical protein B456_001G172800 [Gossypium raimondii]
Length=676

 Score =   189 bits (480),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL  WR+++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +S
Sbjct  555  ACGWAYGMNMFDLKVWRKKDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLQKS  614

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV +K+IE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +L  C
Sbjct  615  WHVLGLGYNPNVDKKEIESAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLHSC  672



>ref|XP_010056256.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Eucalyptus grandis]
 gb|KCW72890.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
 gb|KCW72891.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
Length=675

 Score =   189 bits (480),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ LD+S
Sbjct  554  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLDKS  613

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + DI+ AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  614  WHVLGLGYNPSVDRSDIDNAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRTC  671



>ref|XP_006384847.1| hypothetical protein POPTR_0004s21600g [Populus trichocarpa]
 gb|ERP62644.1| hypothetical protein POPTR_0004s21600g [Populus trichocarpa]
Length=655

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+R NIT +YH WQ LN DR LWKLG+LPPGLITF+N TY LDRS
Sbjct  533  ACGWAFGMNMFDLKQWKRSNITGIYHHWQDLNEDRTLWKLGSLPPGLITFYNLTYPLDRS  592

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAV+HYNGN KPWL++++ K++ YWSR+++YD  +L++C
Sbjct  593  WHVLGLGYDPALNQTEIENAAVVHYNGNYKPWLDLAVAKYKPYWSRYVQYDNPYLKQC  650



>ref|XP_011458092.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=686

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RN+T VYH WQ +N +R LWKLGTLPPGLITF+N TY LDR 
Sbjct  565  ACGWAFGMNMFDLKEWRKRNMTGVYHKWQDMNEERTLWKLGTLPPGLITFYNLTYPLDRG  624

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  IE AAVIHYNGN KPWL+++I K++NYWS+++ YD  +LR C
Sbjct  625  WHSLGLGYDPALNQTAIENAAVIHYNGNYKPWLDLAISKYKNYWSKYVMYDNPYLRIC  682



>ref|XP_008460145.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis melo]
Length=679

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ LN +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  558  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEERLLWKLGTLPPGLITFYGLTHPLDKS  617

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE AAVIHYNGN+KPWLE+++ K+R YW+++I+Y+  +LR+C
Sbjct  618  WHVLGLGYNPSIDKSEIENAAVIHYNGNMKPWLELAMTKYRGYWTKYIKYNHPYLRQC  675



>ref|XP_006339506.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Solanum tuberosum]
Length=688

 Score =   189 bits (479),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ LD+S
Sbjct  567  ACGWAYGMNMFDLKEWKKQDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLDKS  626

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + DIE AAV+HYNGN+KPWLE+++ K+R YW+++I++D  ++R C
Sbjct  627  WHVLGLGYNPSIDRSDIENAAVVHYNGNMKPWLELAMTKYRPYWTKYIKFDHPYMRSC  684



>gb|KJB24655.1| hypothetical protein B456_004G155600 [Gossypium raimondii]
 gb|KJB24656.1| hypothetical protein B456_004G155600 [Gossypium raimondii]
Length=672

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  551  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKS  610

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+IE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  611  WHVLGLGYNPSVDKKEIEHAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  668



>gb|KHG01394.1| Alpha-1,4-galacturonosyltransferase 1 [Gossypium arboreum]
Length=691

 Score =   188 bits (478),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL  WR+++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +S
Sbjct  565  ACGWAYGMNMFDLKVWRKKDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLQKS  624

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV +K+IE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +L  C
Sbjct  625  WHVLGLGYNPNVDKKEIESAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLHSC  682



>ref|XP_011088710.1| PREDICTED: probable galacturonosyltransferase 3 [Sesamum indicum]
Length=680

 Score =   188 bits (478),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+R+IT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDRS
Sbjct  559  ACGWAFGMNIFDLREWRKRDITGIYHHWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRS  618

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAV+HYNGN KPWL+++I K+++YWSR++ +D  +++ C
Sbjct  619  WHVLGLGYDPALNQTEIENAAVVHYNGNYKPWLDLAIAKYKSYWSRYVMFDNYYVQLC  676



>gb|KJB24654.1| hypothetical protein B456_004G155600 [Gossypium raimondii]
Length=668

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  547  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKS  606

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+IE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  607  WHVLGLGYNPSVDKKEIEHAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  664



>ref|XP_008356326.1| PREDICTED: probable galacturonosyltransferase 3 [Malus domestica]
Length=687

 Score =   188 bits (477),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  566  ACGWAYGMNIFDLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRG  625

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  I+ AAVIHYNGN KPWL+++I K++ YWS+++ +D  +LR C
Sbjct  626  WHALGLGYDPALNQTAIKNAAVIHYNGNYKPWLDLAISKYKAYWSKYVMFDNPYLRLC  683



>ref|XP_009101951.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Brassica 
rapa]
 emb|CDY54799.1| BnaA06g40930D [Brassica napus]
Length=686

 Score =   188 bits (477),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  565  ACGWAFGMNMFDLREWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  624

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  625  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRLC  682



>ref|XP_009101952.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Brassica 
rapa]
Length=685

 Score =   188 bits (477),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  564  ACGWAFGMNMFDLREWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  623

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  624  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRLC  681



>emb|CDY59095.1| BnaCnng34200D [Brassica napus]
Length=679

 Score =   188 bits (477),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  558  ACGWAFGMNMFDLREWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  617

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  618  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRLC  675



>ref|XP_009373400.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Pyrus 
x bretschneideri]
Length=687

 Score =   188 bits (477),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  566  ACGWAYGMNIFDLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRG  625

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  I+ AAVIHYNGN KPWL+++I K++ YWS+++ +D  +LR C
Sbjct  626  WHALGLGYDPALNQTAIKNAAVIHYNGNYKPWLDLAISKYKAYWSKYVMFDNPYLRLC  683



>ref|XP_011040799.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Populus 
euphratica]
Length=615

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W+R NIT +YH WQ LN DR LWKLGTLPPGLITF+N TY LDRS
Sbjct  493  ACGWAFGMNMFDLKQWKRSNITGIYHHWQDLNEDRTLWKLGTLPPGLITFYNLTYPLDRS  552

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAV+HYNGN KPWL++++ K++ YWSR+++YD  +L++C
Sbjct  553  WHVLGLGYDPALNQTEIENAAVVHYNGNYKPWLDLAVAKYKPYWSRYVQYDNPYLQQC  610



>emb|CDY72039.1| BnaCnng75670D, partial [Brassica napus]
Length=442

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  321  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKS  380

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ +KDI+ AAV+HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  381  WHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  438



>ref|XP_004144992.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
 ref|XP_004153994.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
 gb|KGN46221.1| hypothetical protein Csa_6G075210 [Cucumis sativus]
Length=679

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ LN +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  558  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEERLLWKLGTLPPGLITFYGLTHPLDKS  617

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAVIHYNGN+KPWLE+++ K+R YW+++I+Y+  +LR+C
Sbjct  618  WHVLGLGYNPSIDKSEIDNAAVIHYNGNMKPWLELAMTKYRGYWTKYIKYNHPYLRQC  675



>ref|XP_004172284.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
Length=679

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ LN +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  558  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEERLLWKLGTLPPGLITFYGLTHPLDKS  617

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAVIHYNGN+KPWLE+++ K+R YW+++I+Y+  +LR+C
Sbjct  618  WHVLGLGYNPSIDKSEIDNAAVIHYNGNMKPWLELAMTKYRGYWTKYIKYNHPYLRQC  675



>ref|XP_010661600.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Vitis vinifera]
 emb|CBI38820.3| unnamed protein product [Vitis vinifera]
Length=681

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW RR+IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ +++S
Sbjct  560  ACGWAYGMNIFDLKEWTRRDITGIYHKWQNMNEDRTLWKLGTLPPGLITFYKLTHPIEKS  619

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + DIE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  620  WHVLGLGYNPSIDKSDIENAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  677



>ref|XP_008382476.1| PREDICTED: probable galacturonosyltransferase 3 [Malus domestica]
Length=685

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  564  ACGWAFGMNIFDLXEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRG  623

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + +  IE AAVIHYNGN KPWL+++I K++ YWSR++  D  +LR C
Sbjct  624  WHALGLGYDPALNKTAIENAAVIHYNGNYKPWLDLAISKYKAYWSRYVMSDNPYLRLC  681



>ref|XP_007043044.1| Galacturonosyltransferase 3 isoform 1 [Theobroma cacao]
 gb|EOX98875.1| Galacturonosyltransferase 3 isoform 1 [Theobroma cacao]
Length=665

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI  L EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  544  ACGWAFGMNIFYLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRK  603

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAVIHYNGN KPWL+++I K+++YWS++++ D  +LR C
Sbjct  604  WHVLGLGYDPALNQTEIENAAVIHYNGNYKPWLDLAIAKYKSYWSKYVKVDNYYLRLC  661



>ref|XP_008235961.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Prunus 
mume]
Length=677

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N T+ LDR 
Sbjct  556  ACGWAFGMNIFDLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTHPLDRG  615

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  IE AAVIHYNGN KPWL+++I K++ YWS+++ +D  +LR C
Sbjct  616  WHALGLGYDPALNQTAIENAAVIHYNGNYKPWLDLAISKYKAYWSKYVMFDNPYLRLC  673



>ref|XP_008364418.1| PREDICTED: probable galacturonosyltransferase 3 [Malus domestica]
Length=661

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  540  ACGWAYGMNIFDLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRG  599

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  I+ AAVIHYNGN KPWL+++I K++ YWS+++ +D  +LR C
Sbjct  600  WHALGLGYDPALNQTAIKNAAVIHYNGNYKPWLDLAISKYKAYWSKYVMFDNPYLRLC  657



>ref|XP_002980359.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ18619.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=533

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+RR+IT +YH WQ +N DR LWKLGTLPPGLITF+N T+ LD+S
Sbjct  412  ACGWAYGMNVFDLKEWKRRDITGIYHKWQNMNEDRLLWKLGTLPPGLITFYNLTHPLDKS  471

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + D++ AAV+HYNGNLKPWL+I + ++++YW+R++ YD  +L++C
Sbjct  472  WHVLGLGYNPSIDKADMDAAAVVHYNGNLKPWLDIGLSRYKSYWTRYVSYDHPYLQQC  529



>ref|XP_009589124.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nicotiana tomentosiformis]
Length=687

 Score =   187 bits (475),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  566  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKS  625

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE AAVIHYNGN+KPWLE+++ K+R+YW+++I++D  ++R C
Sbjct  626  WHVLGLGYNPSIDRSEIENAAVIHYNGNMKPWLELAMTKYRSYWTKYIKFDHPYIRSC  683



>gb|KHG14424.1| Alpha-1,4-galacturonosyltransferase 1 -like protein [Gossypium 
arboreum]
Length=672

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+ R+IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  551  ACGWAYGMNMFDLKEWKNRDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKS  610

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+IE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  611  WHVLGLGYNPSVDKKEIEHAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  668



>ref|XP_002962728.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ36191.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=533

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW+RR+IT +YH WQ +N DR LWKLGTLPPGLITF+N T+ LD+S
Sbjct  412  ACGWAYGMNVFDLKEWKRRDITGIYHKWQNMNEDRLLWKLGTLPPGLITFYNLTHPLDKS  471

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + D++ AAV+HYNGNLKPWL+I + ++++YW+R++ YD  +L++C
Sbjct  472  WHVLGLGYNPSIDKADMDAAAVVHYNGNLKPWLDIGLSRYKSYWTRYVSYDHPYLQQC  529



>ref|XP_007043046.1| Galacturonosyltransferase 3 isoform 3 [Theobroma cacao]
 gb|EOX98877.1| Galacturonosyltransferase 3 isoform 3 [Theobroma cacao]
Length=666

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI  L EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  545  ACGWAFGMNIFYLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRK  604

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAVIHYNGN KPWL+++I K+++YWS++++ D  +LR C
Sbjct  605  WHVLGLGYDPALNQTEIENAAVIHYNGNYKPWLDLAIAKYKSYWSKYVKVDNYYLRLC  662



>gb|KHG01393.1| Alpha-1,4-galacturonosyltransferase 1 [Gossypium arboreum]
Length=752

 Score =   187 bits (475),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL  WR+++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +S
Sbjct  626  ACGWAYGMNMFDLKVWRKKDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLQKS  685

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNPNV +K+IE AAVIHYNGN+KPWLE+++ K+R+YW+++I+YD  +L  C
Sbjct  686  WHVLGLGYNPNVDKKEIESAAVIHYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLHSC  743



>gb|EEC84934.1| hypothetical protein OsI_32147 [Oryza sativa Indica Group]
Length=695

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ++N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  574  ACGWAYGMNIFDLKEWKKKDITGIYHKWQSMNEDRVLWKLGTLPPGLLTFYKLTHPLDKS  633

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  634  WHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  691



>ref|XP_010667722.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Beta vulgaris subsp. vulgaris]
Length=684

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L+++
Sbjct  563  ACGWAYGMNLFDLKEWKKKDITGIYHKWQNMNEDRTLWKLGTLPPGLITFYGLTHPLEKT  622

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE+AAV+HYNGN+KPWLEI++ K+R+ W+++I+YD  +LR C
Sbjct  623  WHVLGLGYNPSIDKSEIEKAAVVHYNGNMKPWLEIAMTKYRSVWTKYIKYDHPYLRRC  680



>ref|NP_001063757.1| Os09g0531900 [Oryza sativa Japonica Group]
 dbj|BAD46018.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD46265.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF25671.1| Os09g0531900 [Oryza sativa Japonica Group]
 gb|EEE70102.1| hypothetical protein OsJ_30110 [Oryza sativa Japonica Group]
Length=695

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ++N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  574  ACGWAYGMNIFDLKEWKKKDITGIYHKWQSMNEDRVLWKLGTLPPGLLTFYKLTHPLDKS  633

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  634  WHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  691



>ref|XP_001785716.1| predicted protein [Physcomitrella patens]
 gb|EDQ49475.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL +W++ +IT +YH WQ+LN DR LWKLGTLPPGLITF+N T  L++S
Sbjct  107  ACGWAYGMNVFDLKQWKKEDITGIYHRWQSLNEDRTLWKLGTLPPGLITFYNLTQPLEKS  166

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP + + +IE AAVIH+NGN+KPWLEI + KF+ YW++F++Y+  FL++C
Sbjct  167  WHVLGLGYNPAIEESEIETAAVIHWNGNMKPWLEIGMVKFKPYWTKFVKYNHPFLQQC  224



>ref|XP_010266351.1| PREDICTED: probable galacturonosyltransferase 3 [Nelumbo nucifera]
Length=519

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++R+IT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDRS
Sbjct  398  ACGWAFGMNIFDLKEWKKRDITGIYHHWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRS  457

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +I+ AAV+HYNGN KPWL++++ K+++YWSR++ YD  +L+ C
Sbjct  458  WHVLGLGYDPALNQTEIDNAAVVHYNGNYKPWLDLAVTKYKSYWSRYVMYDNPYLQRC  515



>ref|XP_011002080.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Populus euphratica]
Length=686

 Score =   186 bits (473),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL  W++++IT +YH WQ +N DR+LWKLGTLPPGLITF+N T  L+++
Sbjct  565  ACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRELWKLGTLPPGLITFYNLTNPLEKT  624

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  625  WHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRSC  682



>ref|XP_010106747.1| Alpha-1,4-galacturonosyltransferase 1 [Morus notabilis]
 gb|EXC11714.1| Alpha-1,4-galacturonosyltransferase 1 [Morus notabilis]
Length=678

 Score =   186 bits (473),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +S
Sbjct  557  ACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLAKS  616

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + +I+ AAVIHYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  617  WHVLGLGYNPSVDRSEIDNAAVIHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRNC  674



>ref|NP_001131608.1| uncharacterized protein LOC100192958 [Zea mays]
 gb|ACF80095.1| unknown [Zea mays]
Length=228

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  107  ACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKS  166

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  167  WHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  224



>ref|XP_011002081.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Populus euphratica]
Length=683

 Score =   186 bits (472),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL  W++++IT +YH WQ +N DR+LWKLGTLPPGLITF+N T  L+++
Sbjct  562  ACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRELWKLGTLPPGLITFYNLTNPLEKT  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  622  WHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRSC  679



>ref|XP_010436923.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Camelina 
sativa]
Length=544

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  423  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  482

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  483  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  540



>ref|XP_009345924.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Pyrus 
x bretschneideri]
Length=685

 Score =   186 bits (472),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  564  ACGWAFGMNIFDLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRG  623

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + +  IE AAVIHYNGN KPWL+++I K++ YWS+++  D  +LR C
Sbjct  624  WHALGLGYDPALNKTAIENAAVIHYNGNYKPWLDLAISKYKAYWSKYVMSDNPYLRLC  681



>ref|XP_009373401.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Pyrus 
x bretschneideri]
Length=647

 Score =   186 bits (471),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  526  ACGWAYGMNIFDLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRG  585

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  I+ AAVIHYNGN KPWL+++I K++ YWS+++ +D  +LR C
Sbjct  586  WHALGLGYDPALNQTAIKNAAVIHYNGNYKPWLDLAISKYKAYWSKYVMFDNPYLRLC  643



>emb|CAN79512.1| hypothetical protein VITISV_014158 [Vitis vinifera]
Length=648

 Score =   186 bits (471),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RN+T +YH WQ +N DR LWKLG+LPPGLITF+N TY LDRS
Sbjct  527  ACGWAFGMNMFDLKEWRKRNMTGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYPLDRS  586

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +I+ AAV+HYNGN KPWLE++I K+++YWSR++  D  +L+ C
Sbjct  587  WHVLGLGYDPQLNQTEIDNAAVVHYNGNYKPWLELAIAKYKSYWSRYVMPDNPYLQLC  644



>ref|XP_011034886.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Populus euphratica]
Length=686

 Score =   186 bits (471),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 74/118 (63%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL  W++++IT +YH WQ +N DR LWKLGTLPPGLITF+N T+ L +S
Sbjct  565  ACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYNLTHPLQKS  624

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHV GLGYNP++ + +IE AAV+HYNGN+KPWLE+++ K+R YW+R+I+YD  +LR C
Sbjct  625  WHVPGLGYNPSIDRSEIESAAVVHYNGNMKPWLELAMTKYRQYWTRYIKYDHPYLRNC  682



>ref|XP_011083645.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Sesamum indicum]
 ref|XP_011083646.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Sesamum indicum]
Length=685

 Score =   186 bits (471),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  564  ACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKS  623

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE AAVIHYNGN+KPWLE+++ K++ YW+++I+YD  ++R C
Sbjct  624  WHVLGLGYNPSIDRSEIENAAVIHYNGNMKPWLELAMTKYKPYWTKYIKYDHPYIRNC  681



>ref|NP_001174992.1| Os06g0712500 [Oryza sativa Japonica Group]
 dbj|BAH93720.1| Os06g0712500, partial [Oryza sativa Japonica Group]
Length=147

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N +R LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  26   ACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLLWKLGTLPPGLLTFYKLTHPLDKS  85

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAVIHYNGN+KPWLEI++ K+R YW+++I Y+  ++R C
Sbjct  86   WHVLGLGYNPSIERSEIDNAAVIHYNGNMKPWLEIAMSKYRPYWTKYINYEHTYVRGC  143



>ref|XP_010111700.1| putative galacturonosyltransferase 3 [Morus notabilis]
 gb|EXC31539.1| putative galacturonosyltransferase 3 [Morus notabilis]
Length=709

 Score =   186 bits (471),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++RNIT +YH WQ  N DR LWKLGTLPPGLITF+N T+ LDR 
Sbjct  588  ACGWAYGMNIFDLKEWKKRNITGIYHRWQDANEDRTLWKLGTLPPGLITFYNLTHPLDRG  647

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAVIHYNGN KPWL+++I K+++YWS+++ +D  +L+ C
Sbjct  648  WHVLGLGYDPALNQTAIENAAVIHYNGNYKPWLDLAISKYKSYWSKYVMFDNPYLQNC  705



>gb|KJB41168.1| hypothetical protein B456_007G093500 [Gossypium raimondii]
Length=676

 Score =   185 bits (470),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL  W++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  555  ACGWAYGMNMFDLRVWKKKDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKS  614

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+IE AAVIHYNGN+KPWL++++ K+R YW+++++YD  +LR C
Sbjct  615  WHVLGLGYNPSVHKKEIEHAAVIHYNGNMKPWLDLAMTKYRPYWTKYVKYDHYYLRSC  672



>ref|XP_010431762.1| PREDICTED: probable galacturonosyltransferase 3 [Camelina sativa]
Length=598

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  477  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  536

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  537  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  594



>ref|XP_002462717.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
 gb|EER99238.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
Length=683

 Score =   185 bits (470),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ LN DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  562  ACGWAYGMNIFDLREWKKKDITGIYHKWQNLNEDRALWKLGTLPPGLLTFYKLTHPLDKS  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  622  WHVLGLGYNPSIDRSEIDSAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  679



>ref|XP_006660882.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Oryza brachyantha]
Length=693

 Score =   185 bits (470),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  572  ACGWAYGMNIFDLKEWKKKDITGIYHRWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKS  631

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  632  WHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  689



>emb|CDP14496.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   185 bits (470),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N +R LWKLGTLPPGLITF+N TY L+RS
Sbjct  541  ACGWAFGMNVFDLKEWRKRNITGIYHHWQEMNEERALWKLGTLPPGLITFYNLTYPLERS  600

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  I+ AAV+HYNGN KPWL+++I K+++YWS ++ +D  +LR C
Sbjct  601  WHVLGLGYDPALNQTAIQNAAVVHYNGNYKPWLDLAIAKYKSYWSAYVMFDNPYLRLC  658



>emb|CDP08918.1| unnamed protein product [Coffea canephora]
Length=683

 Score =   185 bits (470),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 74/118 (63%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  559  ACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKS  618

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + +I+ AAVIHYNGN+KPWLE+++ K+R+YW+++I +D  +LR C
Sbjct  619  WHVLGLGYNPSVDRSEIDGAAVIHYNGNMKPWLELAMTKYRSYWTKYIMFDHPYLRNC  676



>ref|XP_009616855.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nicotiana tomentosiformis]
Length=668

 Score =   185 bits (469),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++R+IT +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  547  ACGWAYGMNIFDLKEWKKRDITGIYHKWQNMNEDRVLWKLGTLPPGLMTFYGLTHPLDKS  606

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P++ + +IE AAVIHYNGN+KPWLE+++ K+R+YW+++I++D  ++  C
Sbjct  607  WHVLGLGYSPSIDRSEIENAAVIHYNGNMKPWLELAMTKYRSYWAKYIKFDHPYIHSC  664



>ref|XP_004957448.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Setaria italica]
Length=682

 Score =   185 bits (469),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  561  ACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKS  620

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  621  WHVLGLGYNPSIDRSEIDGAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  678



>ref|XP_009777396.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nicotiana sylvestris]
 ref|XP_009777397.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nicotiana sylvestris]
Length=668

 Score =   185 bits (469),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++R+IT +YH WQ +N DR LWKLGTLPPGL+TF+  T+ L++S
Sbjct  547  ACGWAYGMNIFDLKEWKKRDITGIYHKWQNMNEDRVLWKLGTLPPGLMTFYGLTHPLNKS  606

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P++ + +IE AAVIHYNGN+KPWLE+++ K+R+YW+++I++D  ++R C
Sbjct  607  WHVLGLGYSPSIDRSEIENAAVIHYNGNMKPWLELAMTKYRSYWAKYIKFDHPYIRSC  664



>emb|CDY52336.1| BnaA09g38850D [Brassica napus]
Length=671

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  550  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKS  609

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ +KDI+ AAV+HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  610  WHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  667



>emb|CDX71763.1| BnaC08g31110D [Brassica napus]
Length=673

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  552  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKS  611

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ +KDI+ AAV+HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  612  WHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  669



>ref|XP_011014841.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Populus euphratica]
Length=686

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL  W++++IT +YH WQ +N DR+LWKLGTLPPGLITF+N T  L+++
Sbjct  565  ACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRELWKLGTLPPGLITFYNLTNPLEKT  624

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE A+V+HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  625  WHVLGLGYNPSIDRAEIESASVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRSC  682



>ref|XP_011014842.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Populus euphratica]
Length=683

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL  W++++IT +YH WQ +N DR+LWKLGTLPPGLITF+N T  L+++
Sbjct  562  ACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRELWKLGTLPPGLITFYNLTNPLEKT  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE A+V+HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  622  WHVLGLGYNPSIDRAEIESASVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRSC  679



>ref|XP_009116771.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Brassica rapa]
Length=671

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++R+IT +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+S
Sbjct  550  ACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKS  609

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ +KDI+ AAV+HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  610  WHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  667



>ref|XP_010645848.1| PREDICTED: probable galacturonosyltransferase 3 [Vitis vinifera]
 emb|CBI37745.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   184 bits (468),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RN+T +YH WQ +N DR LWKLG+LPPGLITF+N TY LDRS
Sbjct  563  ACGWAFGMNMFDLKEWRKRNMTGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYPLDRS  622

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +I+ AAV+HYNGN KPWLE++I K+++YWSR++  D  +L+ C
Sbjct  623  WHVLGLGYDPQLNQTEIDNAAVVHYNGNYKPWLELAIAKYKSYWSRYVMPDNPYLQLC  680



>ref|XP_010918998.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Elaeis guineensis]
Length=701

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL+EW++++IT +YH WQ+LN +R LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  580  ACGWAYGMNMFDLNEWKKKDITGIYHKWQSLNENRALWKLGTLPPGLLTFYKLTHPLDKS  639

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +IE AAVIHYNGNLKPWLEI + K+RNYW+R+I+YD  +++ C
Sbjct  640  WHVLGLGYNPSIDRSEIENAAVIHYNGNLKPWLEIGMTKYRNYWTRYIKYDHPYVKIC  697



>ref|XP_008670346.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Zea mays]
 tpg|DAA40616.1| TPA: hypothetical protein ZEAMMB73_629807 [Zea mays]
Length=684

 Score =   184 bits (468),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N  R LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  563  ACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGRVLWKLGTLPPGLLTFYKLTHPLDKS  622

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + +I+ AAV+HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  623  WHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  680



>ref|XP_007043045.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 ref|XP_007043048.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 ref|XP_007043049.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 gb|EOX98876.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 gb|EOX98879.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 gb|EOX98880.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
Length=495

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI  L EWR+RNIT +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR 
Sbjct  374  ACGWAFGMNIFYLKEWRKRNITGIYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRK  433

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q +IE AAVIHYNGN KPWL+++I K+++YWS++++ D  +LR C
Sbjct  434  WHVLGLGYDPALNQTEIENAAVIHYNGNYKPWLDLAIAKYKSYWSKYVKVDNYYLRLC  491



>ref|XP_010436922.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Camelina 
sativa]
Length=634

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RNIT +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RS
Sbjct  513  ACGWAFGMNMFDLKEWRKRNITGIYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERS  572

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGY+P + Q  IE AAV+HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  573  WHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  630



>gb|KGN56570.1| hypothetical protein Csa_3G124890 [Cucumis sativus]
Length=655

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++RN+T VYH+WQ LN DR LWKLGTLPPGL+TF+  TY+LD+S
Sbjct  534  ACGWAYGMNIFDLKEWKKRNLTGVYHTWQNLNEDRLLWKLGTLPPGLMTFYGLTYSLDKS  593

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++   +IE AAVIHYNGN+KPW+E+++ K+R YW ++I+++  +LR+C
Sbjct  594  WHVLGLGYNPSINPLEIENAAVIHYNGNMKPWMEMAMTKYRPYWRKYIDFNHPYLRQC  651



>gb|EYU32902.1| hypothetical protein MIMGU_mgv1a002354mg [Erythranthe guttata]
Length=684

 Score =   184 bits (468),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L+++
Sbjct  563  ACGWAYGMNMFDLVEWKKQDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKT  622

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V + DIE AAV+HYNGN+KPWLE+++ K++ YW+++I+YD  ++R C
Sbjct  623  WHVLGLGYNPSVDRSDIENAAVVHYNGNMKPWLELAMTKYKPYWTKYIKYDHPYIRNC  680



>ref|XP_008438127.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Cucumis melo]
Length=652

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  639  CGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSW  460
            CGWA GMNI DL EW++RN+T VYH+WQ LN DR LWKLGTLPPGL+TF+  TY+LD+SW
Sbjct  532  CGWAFGMNIFDLKEWKKRNLTAVYHTWQNLNEDRSLWKLGTLPPGLMTFYGLTYSLDKSW  591

Query  459  HVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            HVLGLGYNP++   +IE AAVIHYNGN+KPW+E+++ K+R YW ++I+++  +LR+C
Sbjct  592  HVLGLGYNPSISPLEIENAAVIHYNGNMKPWMEMAMTKYRPYWRKYIDFNHPYLRQC  648



>ref|XP_008438124.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Cucumis melo]
Length=654

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  639  CGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSW  460
            CGWA GMNI DL EW++RN+T VYH+WQ LN DR LWKLGTLPPGL+TF+  TY+LD+SW
Sbjct  534  CGWAFGMNIFDLKEWKKRNLTAVYHTWQNLNEDRSLWKLGTLPPGLMTFYGLTYSLDKSW  593

Query  459  HVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            HVLGLGYNP++   +IE AAVIHYNGN+KPW+E+++ K+R YW ++I+++  +LR+C
Sbjct  594  HVLGLGYNPSISPLEIENAAVIHYNGNMKPWMEMAMTKYRPYWRKYIDFNHPYLRQC  650



>ref|XP_008438125.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Cucumis melo]
Length=653

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  639  CGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSW  460
            CGWA GMNI DL EW++RN+T VYH+WQ LN DR LWKLGTLPPGL+TF+  TY+LD+SW
Sbjct  533  CGWAFGMNIFDLKEWKKRNLTAVYHTWQNLNEDRSLWKLGTLPPGLMTFYGLTYSLDKSW  592

Query  459  HVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            HVLGLGYNP++   +IE AAVIHYNGN+KPW+E+++ K+R YW ++I+++  +LR+C
Sbjct  593  HVLGLGYNPSISPLEIENAAVIHYNGNMKPWMEMAMTKYRPYWRKYIDFNHPYLRQC  649



>ref|XP_004134339.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
Length=697

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++RN+T VYH+WQ LN DR LWKLGTLPPGL+TF+  TY+LD+S
Sbjct  576  ACGWAYGMNIFDLKEWKKRNLTGVYHTWQNLNEDRLLWKLGTLPPGLMTFYGLTYSLDKS  635

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++   +IE AAVIHYNGN+KPW+E+++ K+R YW ++I+++  +LR+C
Sbjct  636  WHVLGLGYNPSINPLEIENAAVIHYNGNMKPWMEMAMTKYRPYWRKYIDFNHPYLRQC  693



>ref|XP_009375839.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X1 [Pyrus x bretschneideri]
Length=683

 Score =   184 bits (467),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EW++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +S
Sbjct  562  ACGWAYGMNMFDLREWKKKDITGIYHKWQNMNEDRTLWKLGTLPPGLITFYGLTHPLQKS  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  622  WHVLGLGYNPSLDRAEIDNAAVVHYNGNMKPWLELAMTKYRGYWTKYIKYDHPYLRSC  679



>ref|XP_004155869.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
Length=697

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++RN+T VYH+WQ LN DR LWKLGTLPPGL+TF+  TY+LD+S
Sbjct  576  ACGWAYGMNIFDLKEWKKRNLTGVYHTWQNLNEDRLLWKLGTLPPGLMTFYGLTYSLDKS  635

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++   +IE AAVIHYNGN+KPW+E+++ K+R YW ++I+++  +LR+C
Sbjct  636  WHVLGLGYNPSINPLEIENAAVIHYNGNMKPWMEMAMTKYRPYWRKYIDFNHPYLRQC  693



>ref|XP_008650862.1| PREDICTED: uncharacterized protein LOC100192958 isoform X2 [Zea 
mays]
 tpg|DAA62449.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea mays]
Length=683

 Score =   184 bits (467),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL EW++++IT +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+S
Sbjct  562  ACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKS  621

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP++ + +I+ AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  622  WHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  679



>gb|KHG15715.1| Alpha-1,4-galacturonosyltransferase 1 -like protein [Gossypium 
arboreum]
Length=702

 Score =   184 bits (467),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL  W++++IT +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++S
Sbjct  581  ACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKS  640

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP+V +K+IE AAVIHYNGN+KPWL++++ K+R YW+++++YD  +LR C
Sbjct  641  WHVLGLGYNPSVDKKEIEHAAVIHYNGNMKPWLDLAMTKYRPYWTKYVKYDHHYLRSC  698



>ref|XP_011458093.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=604

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMN+ DL EWR+RN+T VYH WQ +N +R LWKLGTLPPGLITF+N TY LDR 
Sbjct  483  ACGWAFGMNMFDLKEWRKRNMTGVYHKWQDMNEERTLWKLGTLPPGLITFYNLTYPLDRG  542

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WH LGLGY+P + Q  IE AAVIHYNGN KPWL+++I K++NYWS+++ YD  +LR C
Sbjct  543  WHSLGLGYDPALNQTAIENAAVIHYNGNYKPWLDLAISKYKNYWSKYVMYDNPYLRIC  600



>ref|XP_010934420.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Elaeis guineensis]
Length=716

 Score =   184 bits (467),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  642  ACGWAXGMNILDLSEWRRRNITEVYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRS  463
            ACGWA GMNI DL +W++++IT +YH WQ +N DR LWKLGTLPPGL+TF+  TY L +S
Sbjct  595  ACGWAYGMNIFDLKQWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTYPLGKS  654

Query  462  WHVLGLGYNPNVRQKDIERAAVIHYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  289
            WHVLGLGYNP + + +IE AAV+HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  655  WHVLGLGYNPGIDRSEIENAAVVHYNGNMKPWLELAMTKYRPYWTKYIKYDDRYVRGC  712



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000