BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026A20

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU21599.1|  hypothetical protein MIMGU_mgv1a009096mg                173   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_002885098.1|  transducin family protein                          173   5e-63   
ref|XP_011040004.1|  PREDICTED: serine-threonine kinase receptor-...    179   9e-63   Populus euphratica
ref|XP_010688097.1|  PREDICTED: serine-threonine kinase receptor-...    173   2e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG15168.1|  Serine-threonine kinase receptor-associated             180   2e-62   Gossypium arboreum [tree cotton]
gb|KCW68995.1|  hypothetical protein EUGRSUZ_F02555                     173   2e-62   Eucalyptus grandis [rose gum]
ref|XP_010061947.1|  PREDICTED: serine-threonine kinase receptor-...    173   3e-62   Eucalyptus grandis [rose gum]
ref|XP_011035638.1|  PREDICTED: serine-threonine kinase receptor-...    178   3e-62   Populus euphratica
ref|NP_566519.1|  transducin/WD40 domain-containing protein             171   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006854996.1|  hypothetical protein AMTR_s00052p00205770          172   4e-62   Amborella trichopoda
ref|XP_002303265.1|  transducin family protein                          177   4e-62   Populus trichocarpa [western balsam poplar]
ref|XP_004515599.1|  PREDICTED: serine-threonine kinase receptor-...    175   5e-62   Cicer arietinum [garbanzo]
ref|XP_011081111.1|  PREDICTED: serine-threonine kinase receptor-...    171   5e-62   Sesamum indicum [beniseed]
ref|XP_010098976.1|  Serine-threonine kinase receptor-associated ...    176   5e-62   Morus notabilis
ref|XP_002517562.1|  serine-threonine kinase receptor-associated ...    174   5e-62   Ricinus communis
gb|KJB13093.1|  hypothetical protein B456_002G056400                    177   5e-62   Gossypium raimondii
ref|XP_002298116.1|  transducin family protein                          178   6e-62   Populus trichocarpa [western balsam poplar]
gb|KDP37150.1|  hypothetical protein JCGZ_06206                         175   7e-62   Jatropha curcas
gb|KJB13091.1|  hypothetical protein B456_002G056400                    177   7e-62   Gossypium raimondii
gb|KJB70541.1|  hypothetical protein B456_011G079800                    179   7e-62   Gossypium raimondii
emb|CDY62165.1|  BnaA05g35670D                                          172   9e-62   Brassica napus [oilseed rape]
gb|KJB70540.1|  hypothetical protein B456_011G079800                    179   1e-61   Gossypium raimondii
ref|XP_009144818.1|  PREDICTED: serine-threonine kinase receptor-...    172   1e-61   Brassica rapa
gb|KJB70542.1|  hypothetical protein B456_011G079800                    179   1e-61   Gossypium raimondii
ref|XP_002529368.1|  serine-threonine kinase receptor-associated ...    174   1e-61   Ricinus communis
ref|XP_010465533.1|  PREDICTED: serine-threonine kinase receptor-...    172   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006427175.1|  hypothetical protein CICLE_v10025975mg             174   1e-61   Citrus clementina [clementine]
ref|XP_010487393.1|  PREDICTED: serine-threonine kinase receptor-...    172   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010654727.1|  PREDICTED: serine-threonine kinase receptor-...    173   1e-61   Vitis vinifera
emb|CDY61819.1|  BnaC06g41840D                                          171   2e-61   Brassica napus [oilseed rape]
ref|XP_007013329.1|  Transducin/WD40 repeat-like superfamily prot...    171   2e-61   
ref|XP_007013330.1|  Transducin/WD40 repeat-like superfamily prot...    171   2e-61   
gb|KHN27398.1|  Serine-threonine kinase receptor-associated protein     172   2e-61   Glycine soja [wild soybean]
ref|XP_003524526.1|  PREDICTED: serine-threonine kinase receptor-...    172   2e-61   Glycine max [soybeans]
ref|XP_002285272.1|  PREDICTED: serine-threonine kinase receptor-...    172   2e-61   Vitis vinifera
ref|XP_010545787.1|  PREDICTED: serine-threonine kinase receptor-...    172   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_008785422.1|  PREDICTED: serine-threonine kinase receptor-...    175   2e-61   Phoenix dactylifera
ref|XP_007154947.1|  hypothetical protein PHAVU_003G160500g             173   2e-61   Phaseolus vulgaris [French bean]
ref|XP_006451011.1|  hypothetical protein CICLE_v10008796mg             172   3e-61   Citrus clementina [clementine]
ref|XP_006298067.1|  hypothetical protein CARUB_v10014111mg             172   3e-61   Capsella rubella
ref|XP_004287375.1|  PREDICTED: serine-threonine kinase receptor-...    172   3e-61   Fragaria vesca subsp. vesca
gb|KHG21144.1|  Serine-threonine kinase receptor-associated             174   4e-61   Gossypium arboreum [tree cotton]
gb|KDO52915.1|  hypothetical protein CISIN_1g018784mg                   172   5e-61   Citrus sinensis [apfelsine]
ref|XP_007202311.1|  hypothetical protein PRUPE_ppa008052mg             172   5e-61   Prunus persica
ref|XP_006465394.1|  PREDICTED: serine-threonine kinase receptor-...    172   5e-61   Citrus sinensis [apfelsine]
gb|ACU23446.1|  unknown                                                 171   6e-61   Glycine max [soybeans]
ref|XP_002284993.1|  PREDICTED: serine-threonine kinase receptor-...    168   6e-61   Vitis vinifera
ref|XP_010249966.1|  PREDICTED: serine-threonine kinase receptor-...    172   8e-61   Nelumbo nucifera [Indian lotus]
gb|KEH37967.1|  Serine/Threonine kinase receptor-associated-like ...    174   8e-61   Medicago truncatula
gb|KJB64820.1|  hypothetical protein B456_010G066700                    168   8e-61   Gossypium raimondii
ref|XP_010254304.1|  PREDICTED: serine-threonine kinase receptor-...    172   9e-61   Nelumbo nucifera [Indian lotus]
ref|XP_011072259.1|  PREDICTED: serine-threonine kinase receptor-...    169   9e-61   Sesamum indicum [beniseed]
emb|CDX89958.1|  BnaA10g01240D                                          170   1e-60   
ref|XP_008385948.1|  PREDICTED: serine-threonine kinase receptor-...    172   1e-60   
ref|XP_008343948.1|  PREDICTED: serine-threonine kinase receptor-...    172   1e-60   
ref|XP_007023961.1|  Transducin/WD40 repeat-like superfamily protein    175   1e-60   
ref|XP_009347464.1|  PREDICTED: serine-threonine kinase receptor-...    171   2e-60   Pyrus x bretschneideri [bai li]
gb|KFK38907.1|  hypothetical protein AALP_AA3G176400                    169   2e-60   Arabis alpina [alpine rockcress]
ref|XP_003549786.1|  PREDICTED: serine-threonine kinase receptor-...    172   2e-60   Glycine max [soybeans]
ref|XP_006392876.1|  hypothetical protein EUTSA_v10011626mg             171   2e-60   Eutrema salsugineum [saltwater cress]
gb|AFK46987.1|  unknown                                                 169   2e-60   Lotus japonicus
emb|CDY40132.1|  BnaC06g05570D                                          169   2e-60   Brassica napus [oilseed rape]
ref|XP_008242709.1|  PREDICTED: serine-threonine kinase receptor-...    169   3e-60   Prunus mume [ume]
ref|XP_010925262.1|  PREDICTED: serine-threonine kinase receptor-...    174   3e-60   Elaeis guineensis
ref|XP_010503217.1|  PREDICTED: serine-threonine kinase receptor-...    168   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010542265.1|  PREDICTED: serine-threonine kinase receptor-...    165   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_009147669.1|  PREDICTED: serine-threonine kinase receptor-...    170   5e-60   Brassica rapa
gb|KDP32349.1|  hypothetical protein JCGZ_13274                         173   5e-60   Jatropha curcas
ref|XP_008464982.1|  PREDICTED: serine-threonine kinase receptor-...    173   5e-60   Cucumis melo [Oriental melon]
ref|XP_008792113.1|  PREDICTED: serine-threonine kinase receptor-...    176   5e-60   Phoenix dactylifera
gb|KHG01497.1|  Serine-threonine kinase receptor-associated             171   6e-60   Gossypium arboreum [tree cotton]
ref|XP_004146293.1|  PREDICTED: serine-threonine kinase receptor-...    173   6e-60   Cucumis sativus [cucumbers]
gb|KJB54108.1|  hypothetical protein B456_009G020900                    171   6e-60   Gossypium raimondii
ref|XP_004167839.1|  PREDICTED: serine-threonine kinase receptor-...    173   7e-60   
gb|KGN65408.1|  hypothetical protein Csa_1G418250                       173   7e-60   Cucumis sativus [cucumbers]
ref|NP_849800.1|  transducin/WD-40 repeat-containing protein            171   7e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891712.1|  transducin family protein                          171   7e-60   
ref|XP_010500889.1|  PREDICTED: serine-threonine kinase receptor-...    171   8e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006406945.1|  hypothetical protein EUTSA_v10021071mg             167   9e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006305259.1|  hypothetical protein CARUB_v10009632mg             170   9e-60   Capsella rubella
gb|AFK34417.1|  unknown                                                 169   1e-59   Medicago truncatula
ref|XP_009602512.1|  PREDICTED: serine-threonine kinase receptor-...    169   1e-59   Nicotiana tomentosiformis
ref|XP_008337419.1|  PREDICTED: serine-threonine kinase receptor-...    173   2e-59   
gb|AGT15994.1|  hypothetical protein SHCRBa_159_J23_F_580               170   2e-59   Saccharum hybrid cultivar R570
ref|XP_004965966.1|  PREDICTED: serine-threonine kinase receptor-...    170   2e-59   Setaria italica
ref|XP_010914940.1|  PREDICTED: serine-threonine kinase receptor-...    173   2e-59   Elaeis guineensis
ref|XP_009402893.1|  PREDICTED: serine-threonine kinase receptor-...    171   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009770768.1|  PREDICTED: serine-threonine kinase receptor-...    166   3e-59   Nicotiana sylvestris
ref|XP_008337340.1|  PREDICTED: serine-threonine kinase receptor-...    172   3e-59   
ref|XP_009374067.1|  PREDICTED: serine-threonine kinase receptor-...    172   4e-59   Pyrus x bretschneideri [bai li]
gb|EYU24671.1|  hypothetical protein MIMGU_mgv1a010043mg                172   4e-59   Erythranthe guttata [common monkey flower]
ref|XP_009770767.1|  PREDICTED: serine-threonine kinase receptor-...    166   6e-59   Nicotiana sylvestris
ref|XP_002438635.1|  hypothetical protein SORBIDRAFT_10g023300          170   6e-59   Sorghum bicolor [broomcorn]
ref|XP_006341669.1|  PREDICTED: serine-threonine kinase receptor-...    167   1e-58   Solanum tuberosum [potatoes]
emb|CDP03398.1|  unnamed protein product                                165   1e-58   Coffea canephora [robusta coffee]
gb|EPS74468.1|  hypothetical protein M569_00279                         170   1e-58   Genlisea aurea
ref|XP_009596073.1|  PREDICTED: serine-threonine kinase receptor-...    166   1e-58   Nicotiana tomentosiformis
ref|XP_009760123.1|  PREDICTED: serine-threonine kinase receptor-...    165   2e-58   Nicotiana sylvestris
ref|NP_001046249.1|  Os02g0205400                                       169   2e-58   
ref|XP_009596074.1|  PREDICTED: serine-threonine kinase receptor-...    166   2e-58   Nicotiana tomentosiformis
emb|CDO98105.1|  unnamed protein product                                172   2e-58   Coffea canephora [robusta coffee]
ref|NP_001288531.1|  uncharacterized protein LOC103629787               169   4e-58   Zea mays [maize]
gb|AFW87112.1|  serine-threonine kinase receptor-associated protein     170   4e-58   
ref|NP_001142332.1|  LOC100274502                                       170   5e-58   Zea mays [maize]
dbj|BAE46565.1|  putative WD-40 repeat protein                          165   5e-58   Nicotiana glutinosa
ref|XP_004235719.1|  PREDICTED: serine-threonine kinase receptor-...    164   6e-58   Solanum lycopersicum
ref|XP_004951509.1|  PREDICTED: serine-threonine kinase receptor-...    166   6e-58   Setaria italica
ref|XP_003563679.1|  PREDICTED: serine-threonine kinase receptor-...    168   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_002451748.1|  hypothetical protein SORBIDRAFT_04g007180          163   2e-57   Sorghum bicolor [broomcorn]
gb|ACG31749.1|  serine-threonine kinase receptor-associated protein     168   2e-57   Zea mays [maize]
ref|XP_006647058.1|  PREDICTED: serine-threonine kinase receptor-...    164   3e-57   Oryza brachyantha
ref|XP_006656206.1|  PREDICTED: serine-threonine kinase receptor-...    166   3e-57   Oryza brachyantha
gb|KFK35774.1|  hypothetical protein AALP_AA4G034300                    162   3e-57   Arabis alpina [alpine rockcress]
ref|XP_009388533.1|  PREDICTED: serine-threonine kinase receptor-...    164   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT09457.1|  hypothetical protein F775_27621                         165   4e-57   
ref|NP_001057997.1|  Os06g0598900                                       166   5e-57   
dbj|BAD32940.1|  putative WD-40 repeat protein                          165   7e-57   Oryza sativa Japonica Group [Japonica rice]
gb|KEH23437.1|  3-ketoacyl-CoA synthase                                 170   9e-57   Medicago truncatula
gb|EEC80916.1|  hypothetical protein OsI_23591                          164   2e-56   Oryza sativa Indica Group [Indian rice]
dbj|BAJ92707.1|  predicted protein                                      164   4e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT15935.1|  hypothetical protein F775_06783                         165   6e-56   
ref|XP_006305313.1|  hypothetical protein CARUB_v10009691mg             166   1e-55   Capsella rubella
ref|XP_006416902.1|  hypothetical protein EUTSA_v10008159mg             164   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010497185.1|  PREDICTED: serine-threonine kinase receptor-...    164   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010537963.1|  PREDICTED: serine-threonine kinase receptor-...    166   2e-55   Tarenaya hassleriana [spider flower]
ref|NP_563978.1|  transducin/WD40 repeat-like superfamily protein       165   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537966.1|  PREDICTED: serine-threonine kinase receptor-...    166   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_009596072.1|  PREDICTED: serine-threonine kinase receptor-...    167   3e-55   Nicotiana tomentosiformis
emb|CDY55992.1|  BnaA09g56870D                                          164   3e-55   Brassica napus [oilseed rape]
ref|XP_010476637.1|  PREDICTED: serine-threonine kinase receptor-...    164   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002890105.1|  transducin family protein                          165   4e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_009148941.1|  PREDICTED: serine-threonine kinase receptor-...    164   4e-55   Brassica rapa
emb|CDY39650.1|  BnaC05g11790D                                          164   6e-55   Brassica napus [oilseed rape]
ref|XP_009596070.1|  PREDICTED: serine-threonine kinase receptor-...    166   7e-55   Nicotiana tomentosiformis
ref|XP_009117826.1|  PREDICTED: serine-threonine kinase receptor-...    162   9e-55   Brassica rapa
ref|XP_009596071.1|  PREDICTED: serine-threonine kinase receptor-...    166   1e-54   Nicotiana tomentosiformis
ref|XP_010459083.1|  PREDICTED: serine-threonine kinase receptor-...    163   1e-54   Camelina sativa [gold-of-pleasure]
gb|KHG29669.1|  Serine-threonine kinase receptor-associated             163   3e-54   Gossypium arboreum [tree cotton]
emb|CDX81717.1|  BnaC08g38840D                                          162   3e-54   
gb|KJB27111.1|  hypothetical protein B456_004G278600                    161   9e-54   Gossypium raimondii
gb|KCW68993.1|  hypothetical protein EUGRSUZ_F02555                     182   6e-53   Eucalyptus grandis [rose gum]
gb|AFK43194.1|  unknown                                                 139   7e-50   Medicago truncatula
ref|XP_006427174.1|  hypothetical protein CICLE_v10025975mg             172   1e-49   
emb|CAN67314.1|  hypothetical protein VITISV_014120                     128   2e-49   Vitis vinifera
ref|XP_001756882.1|  predicted protein                                  141   3e-49   
gb|KCW68994.1|  hypothetical protein EUGRSUZ_F02555                     172   3e-49   Eucalyptus grandis [rose gum]
ref|XP_008785435.1|  PREDICTED: serine-threonine kinase receptor-...    134   4e-49   Phoenix dactylifera
gb|KDO52916.1|  hypothetical protein CISIN_1g018784mg                   171   5e-49   Citrus sinensis [apfelsine]
ref|XP_006465395.1|  PREDICTED: serine-threonine kinase receptor-...    171   5e-49   
gb|KDO52917.1|  hypothetical protein CISIN_1g018784mg                   171   5e-49   Citrus sinensis [apfelsine]
ref|XP_008385958.1|  PREDICTED: serine-threonine kinase receptor-...    171   8e-49   
ref|XP_001777192.1|  predicted protein                                  135   4e-48   
ref|XP_002977277.1|  hypothetical protein SELMODRAFT_151778             134   3e-47   Selaginella moellendorffii
ref|XP_002992164.1|  hypothetical protein SELMODRAFT_186588             134   3e-47   Selaginella moellendorffii
gb|EMS49047.1|  Serine-threonine kinase receptor-associated protein     166   2e-46   Triticum urartu
dbj|BAJ97958.1|  predicted protein                                      166   4e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR25578.1|  serine-threonine kinase receptor-associated protein     122   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_005650326.1|  WD40 repeat-like protein                           105   2e-36   Coccomyxa subellipsoidea C-169
ref|XP_007023909.1|  Transducin/WD40 repeat-like superfamily protein    128   4e-35   
ref|XP_003081517.1|  WD40 repeat protein (ISS)                          105   7e-34   
emb|CEF99303.1|  G-protein beta WD-40 repeat                            105   2e-33   Ostreococcus tauri
ref|XP_001419915.1|  predicted protein                                99.8    8e-32   Ostreococcus lucimarinus CCE9901
ref|XP_007510202.1|  predicted protein                                99.4    1e-30   Bathycoccus prasinos
ref|XP_003055628.1|  predicted protein                                99.8    2e-30   Micromonas pusilla CCMP1545
ref|XP_006385489.1|  hypothetical protein POPTR_0003s05820g           87.4    4e-30   
ref|XP_002503507.1|  predicted protein                                89.0    3e-29   Micromonas commoda
ref|XP_005849411.1|  hypothetical protein CHLNCDRAFT_143924           83.2    1e-28   Chlorella variabilis
ref|XP_001691265.1|  hypothetical protein CHLREDRAFT_128295           85.9    7e-26   Chlamydomonas reinhardtii
gb|AFK49343.1|  unknown                                               87.0    9e-26   Lotus japonicus
gb|ESA22835.1|  hypothetical protein GLOINDRAFT_342473                71.2    8e-25   
ref|XP_637742.1|  WD40 repeat-containing protein                      80.1    1e-24   Dictyostelium discoideum AX4
gb|ACO09706.1|  Serine-threonine kinase receptor-associated protein   75.9    4e-24   Osmerus mordax
gb|KFH62158.1|  hypothetical protein MVEG_11797                       68.9    7e-24   Mortierella verticillata NRRL 6337
ref|XP_004564827.1|  PREDICTED: serine-threonine kinase receptor-...  74.3    1e-23   Maylandia zebra
gb|EXX68237.1|  Tif34p                                                71.2    1e-23   Rhizophagus irregularis DAOM 197198w
ref|NP_956598.1|  serine-threonine kinase receptor-associated pro...  75.5    1e-23   Danio rerio [leopard danio]
ref|XP_008314236.1|  PREDICTED: serine-threonine kinase receptor-...  73.2    2e-23   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007577214.1|  PREDICTED: serine-threonine kinase receptor-...  72.8    3e-23   Poecilia formosa
ref|XP_005454109.1|  PREDICTED: serine-threonine kinase receptor-...  72.4    3e-23   
ref|XP_010740062.1|  PREDICTED: serine-threonine kinase receptor-...  71.6    8e-23   Larimichthys crocea [croceine croaker]
gb|AAK01368.1|  serine-threonine kinase receptor-associated protein   73.6    8e-23   Carassius gibelio [gibel carp]
ref|XP_008399465.1|  PREDICTED: serine-threonine kinase receptor-...  71.2    9e-23   Poecilia reticulata
gb|KFM64458.1|  Serine-threonine kinase receptor-associated protein   73.2    1e-22   Stegodyphus mimosarum
ref|XP_003402993.1|  PREDICTED: serine-threonine kinase receptor-...  72.8    1e-22   Bombus terrestris [large earth bumblebee]
ref|XP_003487985.1|  PREDICTED: serine-threonine kinase receptor-...  72.8    1e-22   Bombus impatiens
ref|XP_005805514.1|  PREDICTED: serine-threonine kinase receptor-...  70.9    1e-22   
ref|XP_006633224.1|  PREDICTED: serine-threonine kinase receptor-...  71.2    2e-22   Lepisosteus oculatus
ref|XP_002949849.1|  hypothetical protein VOLCADRAFT_80852            67.0    2e-22   Volvox carteri f. nagariensis
emb|CDQ67406.1|  unnamed protein product                              71.6    2e-22   Oncorhynchus mykiss
ref|XP_004082930.1|  PREDICTED: serine-threonine kinase receptor-...  71.2    2e-22   Oryzias latipes [Japanese rice fish]
ref|NP_001279558.1|  serine/threonine kinase receptor associated ...  68.9    2e-22   Callorhinchus milii [Australian ghost shark]
gb|EFA79493.1|  WD40 repeat-containing protein                        72.4    2e-22   Heterostelium album PN500
ref|XP_008288513.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    3e-22   Stegastes partitus
ref|XP_008288505.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    3e-22   Stegastes partitus
ref|XP_004564826.1|  PREDICTED: serine-threonine kinase receptor-...  74.3    4e-22   Maylandia zebra
ref|XP_010773038.1|  PREDICTED: serine-threonine kinase receptor-...  69.7    6e-22   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010882092.1|  PREDICTED: serine-threonine kinase receptor-...  70.1    6e-22   Esox lucius
ref|XP_003972671.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    7e-22   Takifugu rubripes [tiger puffer]
gb|KDR13003.1|  Serine-threonine kinase receptor-associated protein   69.3    9e-22   Zootermopsis nevadensis
ref|XP_010885258.1|  PREDICTED: serine-threonine kinase receptor-...  69.3    1e-21   Esox lucius
ref|NP_001090526.1|  serine/threonine kinase receptor associated ...  65.5    1e-21   Xenopus laevis [clawed frog]
ref|XP_011335793.1|  PREDICTED: serine-threonine kinase receptor-...  68.6    1e-21   Ooceraea biroi
ref|XP_006006111.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    1e-21   Latimeria chalumnae
ref|XP_396504.1|  PREDICTED: serine-threonine kinase receptor-ass...  68.9    2e-21   Apis mellifera [bee]
ref|XP_001959831.1|  GF11838                                          69.3    2e-21   Drosophila ananassae
ref|XP_011052618.1|  PREDICTED: serine-threonine kinase receptor-...  67.8    2e-21   Acromyrmex echinatior
ref|XP_005179104.1|  PREDICTED: serine-threonine kinase receptor-...  70.5    2e-21   Musca domestica
ref|XP_005179105.1|  PREDICTED: serine-threonine kinase receptor-...  70.1    2e-21   Musca domestica
gb|KIZ04267.1|  serine-threonine kinase receptor-associated protein   94.0    2e-21   Monoraphidium neglectum
ref|XP_011150584.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    2e-21   Harpegnathos saltator
ref|XP_001361095.1|  GA17804                                          68.9    3e-21   Drosophila pseudoobscura pseudoobscura
ref|XP_011396442.1|  Serine-threonine kinase receptor-associated ...  72.0    3e-21   Auxenochlorella protothecoides
ref|XP_003705564.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    3e-21   Megachile rotundata
ref|XP_004360523.1|  WD40 repeat-containing protein                   76.3    4e-21   Cavenderia fasciculata
gb|EKC40117.1|  Serine-threonine kinase receptor-associated protein   64.3    4e-21   Crassostrea gigas
ref|XP_011434029.1|  PREDICTED: serine-threonine kinase receptor-...  64.3    5e-21   Crassostrea gigas
ref|XP_008544371.1|  PREDICTED: serine-threonine kinase receptor-...  67.4    5e-21   Microplitis demolitor
ref|XP_001624518.1|  predicted protein                                68.6    5e-21   Nematostella vectensis
ref|XP_002732021.1|  PREDICTED: serine-threonine kinase receptor-...  64.3    7e-21   Saccoglossus kowalevskii
ref|NP_001087814.1|  serine/threonine kinase receptor associated ...  63.9    8e-21   Xenopus laevis [clawed frog]
ref|XP_005761541.1|  hypothetical protein EMIHUDRAFT_428205           63.5    8e-21   Emiliania huxleyi CCMP1516
ref|NP_001120495.1|  serine/threonine kinase receptor associated ...  64.3    9e-21   Xenopus tropicalis [western clawed frog]
ref|XP_002074661.1|  GK23046                                          67.8    1e-20   Drosophila willistoni
ref|XP_011263567.1|  PREDICTED: serine-threonine kinase receptor-...  64.7    1e-20   Camponotus floridanus
ref|XP_008473381.1|  PREDICTED: serine-threonine kinase receptor-...  67.4    1e-20   
ref|XP_011498271.1|  PREDICTED: serine-threonine kinase receptor-...  73.9    2e-20   Ceratosolen solmsi marchali
ref|XP_007060631.1|  PREDICTED: serine-threonine kinase receptor-...  64.3    2e-20   
ref|XP_969569.1|  PREDICTED: serine-threonine kinase receptor-ass...  65.9    2e-20   Tribolium castaneum [rust-red flour beetle]
gb|EMP35054.1|  Serine-threonine kinase receptor-associated protein   64.3    2e-20   Chelonia mydas [green seaturtle]
ref|XP_001986592.1|  GH20440                                          66.2    3e-20   Drosophila grimshawi
ref|XP_011156221.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    3e-20   Solenopsis invicta [imported red fire ant]
gb|EFZ20290.1|  hypothetical protein SINV_00798                       63.9    3e-20   
ref|XP_001976425.1|  GG20020                                          65.9    3e-20   Drosophila erecta
dbj|GAM26537.1|  hypothetical protein SAMD00019534_097120             66.2    4e-20   Acytostelium subglobosum LB1
gb|EPQ08116.1|  Serine-threonine kinase receptor-associated protein   63.5    4e-20   Myotis brandtii
ref|XP_004932595.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    4e-20   
ref|XP_005866835.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    4e-20   
ref|XP_006084353.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    4e-20   Myotis lucifugus
ref|XP_005287566.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    4e-20   Chrysemys picta bellii
ref|XP_002898038.1|  WD domain-containing protein, putative           67.8    4e-20   Phytophthora infestans T30-4
gb|EFX76037.1|  hypothetical protein DAPPUDRAFT_306319                65.1    5e-20   Daphnia pulex
ref|XP_003294375.1|  WD40 repeat-containing protein                   71.2    5e-20   Dictyostelium purpureum
ref|XP_001950349.1|  PREDICTED: serine-threonine kinase receptor-...  62.4    5e-20   Acyrthosiphon pisum
ref|NP_611804.1|  wing morphogenesis defect, isoform A                65.1    6e-20   Drosophila melanogaster
gb|EHJ68792.1|  putative serine-threonine kinase receptor-associa...  62.0    6e-20   
ref|XP_010212611.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    7e-20   Tinamus guttatus
gb|KGL77017.1|  Serine-threonine kinase receptor-associated protein   63.9    7e-20   Tinamus guttatus
gb|ENN71163.1|  hypothetical protein YQE_12093                        65.5    8e-20   Dendroctonus ponderosae
ref|XP_006773325.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    8e-20   Myotis davidii
ref|XP_011301387.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    8e-20   Fopius arisanus
gb|ETE62118.1|  Serine-threonine kinase receptor-associated protein   63.2    8e-20   Ophiophagus hannah
ref|XP_004460359.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    9e-20   Dasypus novemcinctus
ref|XP_004460360.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    1e-19   Dasypus novemcinctus
ref|XP_005835567.1|  hypothetical protein GUITHDRAFT_86025            62.8    1e-19   Guillardia theta CCMP2712
ref|XP_004900757.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    1e-19   
ref|XP_008138676.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    1e-19   Eptesicus fuscus
ref|XP_004525970.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    1e-19   Ceratitis capitata [medfly]
gb|EHB13154.1|  Serine-threonine kinase receptor-associated protein   63.2    1e-19   Heterocephalus glaber [naked mole rat]
ref|XP_007527681.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    1e-19   Erinaceus europaeus [common hedgehog]
ref|XP_008854253.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    2e-19   Nannospalax galili
gb|AAC98300.1|  serine-threonine kinase receptor-associated protein   62.8    2e-19   Mus musculus [mouse]
ref|NP_035629.2|  serine-threonine kinase receptor-associated pro...  62.8    2e-19   Mus musculus [mouse]
ref|XP_001600320.1|  PREDICTED: serine-threonine kinase receptor-...  64.7    2e-19   Nasonia vitripennis
ref|XP_011207556.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011207555.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   Bactrocera dorsalis [papaya fruit fly]
ref|NP_001006247.2|  serine-threonine kinase receptor-associated ...  63.5    2e-19   Gallus gallus [bantam]
ref|NP_001011969.1|  serine-threonine kinase receptor-associated ...  63.2    2e-19   Rattus norvegicus [brown rat]
ref|XP_011190917.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   Zeugodacus cucurbitae [melon fruit fly]
gb|ETI37286.1|  hypothetical protein F443_16714                       67.8    2e-19   Phytophthora parasitica P1569
ref|XP_005017139.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
gb|ETM37382.1|  hypothetical protein L914_16063                       67.8    2e-19   Phytophthora parasitica
ref|XP_002004424.1|  GI19623                                          63.2    2e-19   Drosophila mojavensis
emb|CAG31560.1|  hypothetical protein RCJMB04_7p19                    63.2    2e-19   Gallus gallus [bantam]
ref|XP_008911963.1|  hypothetical protein PPTG_15500                  67.8    2e-19   Phytophthora parasitica INRA-310
ref|XP_008642236.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   Corvus brachyrhynchos
ref|XP_009901096.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   Picoides pubescens
ref|XP_009498489.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   Phalacrocorax carbo [common cormorant]
ref|XP_010283534.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   Phaethon lepturus
ref|XP_009647020.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   Egretta garzetta
ref|XP_009469303.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
ref|XP_010160441.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
ref|XP_009986298.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
gb|KFV69096.1|  Serine-threonine kinase receptor-associated protein   63.5    2e-19   
ref|XP_009960882.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
ref|XP_008504145.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
ref|XP_010078294.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
ref|XP_005234771.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
ref|XP_010564424.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
ref|XP_009941305.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
ref|XP_010150775.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    2e-19   
ref|XP_009093404.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    2e-19   
ref|XP_005481923.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    2e-19   
gb|KFW77589.1|  Serine-threonine kinase receptor-associated protein   63.5    2e-19   
ref|XP_010300389.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
ref|XP_010402481.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    2e-19   
ref|XP_005148197.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
gb|KFO54453.1|  Serine-threonine kinase receptor-associated protein   63.5    2e-19   
ref|XP_009941306.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    2e-19   
gb|KFW96058.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFR03659.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFQ43384.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|EOB03138.1|  Serine-threonine kinase receptor-associated protein   63.2    3e-19   
gb|KFV93538.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFZ52756.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_010001239.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    3e-19   
ref|XP_009093405.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
ref|XP_005481924.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
gb|KFQ66986.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_010196813.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    3e-19   
ref|XP_002192073.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
gb|KFU93601.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFV00111.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFP46563.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_005425359.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
gb|EMC81744.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFM07331.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|ELR47822.1|  Serine-threonine kinase receptor-associated protein   63.2    3e-19   
gb|KFV39167.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_009568933.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    3e-19   
gb|KFR17334.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFV79686.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFV02551.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|KFO10719.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_009927393.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    3e-19   
gb|KFP10993.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
gb|ELU00352.1|  hypothetical protein CAPTEDRAFT_229092                61.2    3e-19   
gb|KFP77957.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_008918070.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
ref|XP_009871765.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    3e-19   
ref|XP_005207035.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
gb|KFP30380.1|  Serine-threonine kinase receptor-associated protein   63.5    3e-19   
ref|XP_005040456.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    3e-19   
gb|KFO70957.1|  Serine-threonine kinase receptor-associated protein   63.2    3e-19   
ref|XP_002059888.1|  GJ14989                                          62.4    3e-19   
ref|XP_003386567.1|  PREDICTED: serine-threonine kinase receptor-...  68.2    3e-19   
gb|KFZ45992.1|  Serine-threonine kinase receptor-associated protein   63.2    3e-19   
ref|XP_006030930.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    4e-19   
ref|XP_005072957.1|  PREDICTED: serine-threonine kinase receptor-...  63.9    4e-19   
gb|EFB27992.1|  hypothetical protein PANDA_007277                     63.2    4e-19   
ref|XP_006130331.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    4e-19   
ref|XP_009072405.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    4e-19   
ref|XP_006130330.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    4e-19   
ref|XP_009670239.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    4e-19   
ref|XP_002120914.1|  PREDICTED: serine-threonine kinase receptor-...  61.6    4e-19   
ref|XP_007423037.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    4e-19   
gb|KFP70262.1|  Serine-threonine kinase receptor-associated protein   63.5    4e-19   
ref|XP_004713826.1|  PREDICTED: serine-threonine kinase receptor-...  63.5    5e-19   
emb|CEG64490.1|  hypothetical protein RMATCC62417_01451               70.9    5e-19   
ref|XP_006958851.1|  WD40 repeat-like protein                         74.7    6e-19   
gb|EIE82147.1|  hypothetical protein RO3G_06852                       68.6    6e-19   
ref|XP_003226007.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    6e-19   
emb|CEP16447.1|  hypothetical protein                                 65.9    6e-19   
ref|XP_004626155.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    7e-19   
gb|KFQ24876.1|  Serine-threonine kinase receptor-associated protein   63.2    7e-19   
emb|CEG64489.1|  hypothetical protein RMATCC62417_01451               70.5    7e-19   
ref|XP_010188075.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    7e-19   
ref|XP_005072956.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    8e-19   
ref|XP_002607713.1|  hypothetical protein BRAFLDRAFT_82840            62.4    8e-19   
ref|XP_004636879.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    8e-19   
ref|XP_007639831.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    9e-19   
gb|EGW07522.1|  Serine-threonine kinase receptor-associated protein   63.5    1e-18   
dbj|BAC36834.1|  unnamed protein product                              60.1    1e-18   
ref|XP_001363811.1|  PREDICTED: serine-threonine kinase receptor-...  60.5    1e-18   
ref|XP_006976563.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    1e-18   
ref|XP_002155180.2|  PREDICTED: serine-threonine kinase receptor-...  61.6    1e-18   
ref|XP_009697962.1|  PREDICTED: LOW QUALITY PROTEIN: serine-threo...  63.9    1e-18   
ref|XP_003771228.1|  PREDICTED: serine-threonine kinase receptor-...  60.5    1e-18   
emb|CEG82446.1|  hypothetical protein RMATCC62417_16515               69.3    2e-18   
emb|CEG82445.1|  hypothetical protein RMATCC62417_16515               68.9    2e-18   
ref|XP_005364593.1|  PREDICTED: serine-threonine kinase receptor-...  62.8    2e-18   
gb|AEW08684.1|  hypothetical protein CL1186Contig1_01                 86.3    2e-18   
ref|XP_007128060.1|  PREDICTED: serine-threonine kinase receptor-...  63.2    2e-18   
ref|XP_009059987.1|  hypothetical protein LOTGIDRAFT_182822           62.0    3e-18   
ref|XP_004664503.1|  PREDICTED: serine-threonine kinase receptor-...  62.4    3e-18   
ref|XP_001652721.1|  AAEL007382-PA                                    59.7    3e-18   
ref|XP_009527981.1|  hypothetical protein PHYSODRAFT_501150           66.6    4e-18   
dbj|GAC99227.1|  hypothetical protein PHSY_006827                     72.8    5e-18   
ref|XP_007881347.1|  hypothetical protein PFL1_05622                  69.3    5e-18   
ref|XP_005108804.1|  PREDICTED: serine-threonine kinase receptor-...  60.8    6e-18   
ref|XP_009009309.1|  hypothetical protein HELRODRAFT_184835           60.5    7e-18   
gb|EST04926.1|  serine/threonine kinase receptor-associated protein   67.8    8e-18   
ref|XP_001868161.1|  serine-threonine kinase receptor-associated ...  58.5    1e-17   
gb|KIR57708.1|  serine-threonine kinase receptor-associated protein   62.4    1e-17   
gb|KIR37578.1|  serine-threonine kinase receptor-associated protein   62.4    1e-17   
gb|KIR44979.1|  serine-threonine kinase receptor-associated protein   62.4    1e-17   
gb|KGB80355.1|  serine/threonine kinase receptor associated protein   62.4    1e-17   
gb|KIR83390.1|  serine-threonine kinase receptor-associated protein   62.4    1e-17   
gb|AFR93022.1|  serine-threonine kinase receptor-associated protein   62.4    1e-17   
ref|XP_003192460.1|  serine/threonine kinase receptor associated ...  62.4    1e-17   
gb|EJT48331.1|  serine/threonine kinase receptor associated protein   60.5    2e-17   
ref|XP_568762.1|  serine/threonine kinase receptor associated pro...  62.4    2e-17   
emb|CCJ29855.1|  unnamed protein product                              62.4    3e-17   
gb|KIM32040.1|  hypothetical protein M408DRAFT_327394                 62.4    3e-17   
ref|XP_011389730.1|  hypothetical protein UMAG_03336                  69.3    3e-17   
emb|CCF52049.1|  related to UNR-interacting protein STRAP (serine...  69.3    4e-17   
gb|ETN67896.1|  serine-threonine kinase receptor-associated protein   57.0    5e-17   
emb|CCI45985.1|  unnamed protein product                              72.8    8e-17   
gb|EJT96784.1|  WD40 repeat-like protein                              70.9    1e-16   
ref|XP_007875269.1|  hypothetical protein PNEG_03206                  62.8    1e-16   
gb|EPB83379.1|  hypothetical protein HMPREF1544_09854                 64.7    1e-16   
ref|XP_004052881.1|  PREDICTED: serine-threonine kinase receptor-...  62.8    1e-16   
emb|CBQ73736.1|  related to UNR-interacting protein STRAP (serine...  65.9    1e-16   
gb|ETS59931.1|  hypothetical protein PaG_05912                        67.8    1e-16   
emb|CCA21517.1|  WD domaincontaining protein putative                 73.6    2e-16   
gb|KDN52909.1|  WD40 repeat-like protein                              66.2    2e-16   
gb|KFO83365.1|  Serine-threonine kinase receptor-associated protein   63.9    2e-16   
gb|ACO12171.1|  Serine-threonine kinase receptor-associated protein   60.1    3e-16   
ref|XP_004333795.1|  WD domain containing protein                     55.8    3e-16   
ref|XP_794772.3|  PREDICTED: serine-threonine kinase receptor-ass...  60.8    3e-16   
gb|KFB48346.1|  AGAP005029-PA-like protein                            56.6    3e-16   
dbj|GAC75073.1|  serine/threonine kinase receptor-associated protein  67.4    3e-16   
gb|ETL84191.1|  hypothetical protein L917_15952                       67.4    4e-16   
emb|CCO30117.1|  Serine-threonine kinase receptor-associated protein  65.9    4e-16   
ref|XP_011114217.1|  hypothetical protein H072_8512                   59.3    6e-16   
ref|XP_001688468.1|  AGAP005029-PA                                    57.0    7e-16   
dbj|GAK64649.1|  serine/threonine kinase receptor associated protein  67.8    8e-16   
emb|CEL54246.1|  Serine-threonine kinase receptor-associated prot...  64.3    1e-15   
gb|ERL83460.1|  hypothetical protein D910_00452                       65.5    1e-15   
ref|XP_008861257.1|  hypothetical protein H310_00302                  59.7    1e-15   
gb|KDO33140.1|  hypothetical protein SPRG_01952                       59.3    2e-15   
ref|XP_002425236.1|  serine-threonine kinase receptor-associated ...  58.5    2e-15   
gb|KEP54234.1|  Serine/Threonine kinase receptor-associated protein   63.9    2e-15   
gb|EUC57330.1|  Serine/Threonine kinase receptor associated protein   63.9    2e-15   
ref|XP_002182271.1|  predicted protein                                67.4    3e-15   
ref|XP_009495076.1|  hypothetical protein H696_02906                  58.2    3e-15   
emb|CCX05695.1|  Similar to Serine-threonine kinase receptor-asso...  54.7    3e-15   
ref|XP_007004398.1|  hypothetical protein TREMEDRAFT_71584            60.1    3e-15   
gb|KDN44821.1|  hypothetical protein RSAG8_05294                      64.7    4e-15   
gb|KIO34763.1|  hypothetical protein M407DRAFT_240566                 65.1    4e-15   
ref|XP_009845437.1|  hypothetical protein H257_18127                  58.5    4e-15   
gb|EWC48094.1|  hypothetical protein DRE_02673                        58.9    6e-15   
ref|XP_010131791.1|  PREDICTED: serine-threonine kinase receptor-...  64.3    7e-15   
emb|CAF96754.1|  unnamed protein product                              79.3    9e-15   
ref|XP_002111133.1|  hypothetical protein TRIADDRAFT_22326            58.2    2e-14   
gb|KIK80785.1|  hypothetical protein PAXRUDRAFT_833338                60.8    2e-14   
ref|XP_003740623.1|  PREDICTED: serine-threonine kinase receptor-...  53.5    2e-14   
gb|KDQ14584.1|  hypothetical protein BOTBODRAFT_32715                 59.3    3e-14   
ref|XP_008728113.1|  hypothetical protein G647_05564                  53.9    3e-14   
ref|XP_011125340.1|  hypothetical protein AOL_s00112g8                55.8    3e-14   
gb|KIX09453.1|  hypothetical protein Z518_00533                       52.8    3e-14   
ref|XP_009265946.1|  Serine-threonine kinase receptor-associated ...  70.9    4e-14   
gb|KIW70741.1|  hypothetical protein PV04_02982                       54.3    4e-14   
gb|KIJ17342.1|  hypothetical protein PAXINDRAFT_168034                61.6    4e-14   
emb|CDO76530.1|  hypothetical protein BN946_scf184750.g10             62.4    5e-14   
ref|XP_007321316.1|  hypothetical protein SERLADRAFT_474003           60.1    6e-14   
gb|ELU40310.1|  serine/threonine kinase receptor associated protein   53.1    7e-14   
ref|XP_009542396.1|  hypothetical protein HETIRDRAFT_448621           60.5    7e-14   
gb|KII88736.1|  hypothetical protein PLICRDRAFT_41955                 60.5    7e-14   
gb|KDR73463.1|  hypothetical protein GALMADRAFT_251138                61.2    8e-14   
ref|XP_007364499.1|  serine/threonine kinase receptor associated ...  62.4    9e-14   
ref|XP_007301394.1|  WD40 repeat-like protein                         59.3    1e-13   
ref|XP_008036866.1|  WD40 repeat-like protein                         60.8    1e-13   
gb|KIM60620.1|  hypothetical protein SCLCIDRAFT_16276                 59.7    1e-13   
gb|KIM48866.1|  hypothetical protein M413DRAFT_438038                 60.8    1e-13   
gb|KIK59670.1|  hypothetical protein GYMLUDRAFT_44108                 60.5    1e-13   
ref|XP_007764799.1|  WD40 repeat-like protein                         61.6    2e-13   
emb|CCM02868.1|  predicted protein                                    61.6    2e-13   
gb|KDQ33599.1|  hypothetical protein PLEOSDRAFT_1061246               60.5    2e-13   
ref|XP_007735744.1|  hypothetical protein A1O3_07446                  53.1    3e-13   
gb|KIV91268.1|  hypothetical protein, variant                         52.0    3e-13   
gb|EMS25429.1|  serine/threonine kinase receptor associated protein   63.2    3e-13   
dbj|GAE00086.1|  WD repeat protein                                    55.1    3e-13   
gb|KIV91267.1|  hypothetical protein PV10_05826                       52.0    3e-13   
ref|XP_007755033.1|  hypothetical protein A1O7_02813                  50.8    3e-13   
gb|EPT05868.1|  hypothetical protein FOMPIDRAFT_41601                 60.8    5e-13   
ref|XP_001833643.1|  serine/threonine kinase receptor associated ...  60.5    6e-13   
ref|XP_003035103.1|  hypothetical protein SCHCODRAFT_74444            58.5    6e-13   
gb|KDD74316.1|  hypothetical protein H632_c1406p0                     73.9    7e-13   
gb|KIK45869.1|  hypothetical protein CY34DRAFT_801026                 61.2    7e-13   
ref|XP_010537967.1|  PREDICTED: serine-threonine kinase receptor-...  73.6    8e-13   
ref|XP_005715596.1|  WD40-repeat containing protein                   55.5    8e-13   
gb|KFQ36127.1|  Serine-threonine kinase receptor-associated protein   63.5    9e-13   
ref|XP_007722870.1|  hypothetical protein A1O1_03780                  51.6    9e-13   
ref|XP_004564824.1|  PREDICTED: serine-threonine kinase receptor-...  74.7    1e-12   
gb|KIW27584.1|  hypothetical protein PV07_07313                       52.0    1e-12   
gb|EKG15110.1|  hypothetical protein MPH_07707                        57.8    1e-12   
ref|XP_008945315.1|  PREDICTED: LOW QUALITY PROTEIN: serine-threo...  63.2    1e-12   
gb|KIY61833.1|  WD40 repeat-like protein                              58.9    1e-12   
ref|XP_007854807.1|  serine threonine kinase receptor associated ...  60.1    1e-12   
ref|XP_007264053.1|  serine/threonine kinase receptor associated ...  58.9    1e-12   
ref|XP_006458453.1|  hypothetical protein AGABI2DRAFT_134184          60.5    1e-12   
gb|KIJ44358.1|  hypothetical protein M422DRAFT_30496                  55.1    2e-12   
ref|XP_007396048.1|  hypothetical protein PHACADRAFT_184501           61.6    2e-12   
gb|KIW76219.1|  hypothetical protein Z517_10965                       52.4    2e-12   
gb|EMD38657.1|  hypothetical protein CERSUDRAFT_82933                 61.6    2e-12   
gb|KIV76963.1|  hypothetical protein PV11_08807                       52.4    2e-12   
ref|XP_007749498.1|  hypothetical protein A1O5_10733                  52.4    3e-12   
gb|KJA27444.1|  hypothetical protein HYPSUDRAFT_198202                60.8    3e-12   
gb|KIX96661.1|  hypothetical protein Z520_07380                       52.4    3e-12   
gb|KIY51101.1|  WD40 repeat-like protein                              58.5    3e-12   
gb|ETO15642.1|  hypothetical protein RFI_21722                        51.2    3e-12   
ref|XP_009159609.1|  translation initiation factor eIF-3 subunit 2    53.1    4e-12   
gb|KIK06469.1|  hypothetical protein K443DRAFT_2957                   60.5    4e-12   
gb|KDQ59466.1|  hypothetical protein JAAARDRAFT_33037                 57.4    5e-12   
ref|XP_007863632.1|  WD40 repeat-like protein                         60.1    5e-12   
gb|KFX43279.1|  Dolichyl-phosphate beta-glucosyltransferase           56.2    6e-12   
gb|EPS34650.1|  hypothetical protein PDE_09614                        56.2    6e-12   
ref|XP_001823552.2|  WD repeat protein                                53.9    8e-12   
dbj|BAE62419.1|  unnamed protein product                              53.9    8e-12   
gb|KEF60662.1|  hypothetical protein A1O9_02223                       52.0    8e-12   



>gb|EYU21599.1| hypothetical protein MIMGU_mgv1a009096mg [Erythranthe guttata]
Length=353

 Score =   173 bits (439),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+AWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTIAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCVVESASLEPKYGNKFIAGGEDM  250


 Score = 99.8 bits (247),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            +R+FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP+   +     
Sbjct  252  IRVFDFHTGEEVGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPSNNAEQEGSS  311

Query  69   PKPXVXKDVNXEXXKLHIAKGAK  1
                V +++  E   +HI+   +
Sbjct  312  TVKDVSEEITREIENVHISSAQE  334



>ref|XP_002885098.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61357.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   173 bits (439),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+AWLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLAWLHGDQTILSSCTDIGGVRLWDMRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  250


 Score = 94.7 bits (234),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VRLFDFH GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP    + +   
Sbjct  252  VRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEENNESK  311

Query  69   PKPXVXKDVNXEXXKLHIAKGAK  1
            PK  V  +V  +    HI K  K
Sbjct  312  PKQSV-DEVTRKIEGFHINKEGK  333



>ref|XP_011040004.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Populus euphratica]
Length=350

 Score =   179 bits (455),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+FG +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGGEDM  250


 Score = 87.8 bits (216),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH GEQ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  252  IHVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_010688097.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Beta vulgaris subsp. vulgaris]
Length=352

 Score =   173 bits (439),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+R+ ++VRTL+TKSSVTSAEVS+DG YITT D
Sbjct  147  SVRTVAWLHSDQTILSSCTDIGGVRLWDVRNGQIVRTLETKSSVTSAEVSQDGRYITTCD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  207  GTSVKFWDANYFGLVKSYEMPCTVESASLEPKYGNKFVAGGEDM  250


 Score = 92.4 bits (228),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VR+FDFH GE+  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP
Sbjct  252  VRMFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>gb|KHG15168.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=339

 Score =   180 bits (456),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSCSDTSGVRLWDLRS ++V+TL++KS VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSCSDTSGVRLWDLRSGKIVQTLESKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  207  GSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGNKFIAGGEDM  250


 Score = 85.9 bits (211),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH G++ GCNKGHHGP+H VRF+PGG    SGSEDGTIRIW T P    ++ A P
Sbjct  252  VHVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVP  311

Query  69   ---PKPXV  55
               P P V
Sbjct  312  GNAPNPKV  319



>gb|KCW68995.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=308

 Score =   173 bits (438),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS+EVS+DG YITTAD
Sbjct  104  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSSEVSQDGRYITTAD  163

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGG DM
Sbjct  164  GSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDM  207


 Score = 92.8 bits (229),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    +  A P
Sbjct  209  VHIFDFHTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPANNVEGDANP  268



>ref|XP_010061947.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Eucalyptus grandis]
 gb|KCW68992.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=351

 Score =   173 bits (438),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS+EVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDM  250


 Score = 92.8 bits (229),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    +  A P
Sbjct  252  VHIFDFHTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPANNVEGDANP  311



>ref|XP_011035638.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Populus euphratica]
Length=350

 Score =   178 bits (452),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCADIGGVRLWDIRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+FG +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGGEDM  250


 Score = 87.0 bits (214),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            + +FDFH GEQ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ  P    +  + P
Sbjct  252  IHVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLSPASHDENDSLP  311

Query  69   ---PKPXV---XKDVNXEXXKLHIAKGAK  1
               P   V     DV  +   LH++K  K
Sbjct  312  GNGPTGKVKVSADDVAQKIEVLHVSKEGK  340



>ref|NP_566519.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB02292.1| WD-40 repeat protein-like [Arabidopsis thaliana]
 gb|AAN72058.1| expressed protein [Arabidopsis thaliana]
 gb|AAO30083.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE75702.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=341

 Score =   171 bits (433),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  250


 Score = 94.4 bits (233),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VRLFDFH G++ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP    + S   
Sbjct  252  VRLFDFHTGKEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEISESK  311

Query  69   PKPXVXKDVNXEXXKLHIAKGAK  1
            PK  V  +V  +    HI K  K
Sbjct  312  PKQSV-DEVARKIEGFHINKEGK  333



>ref|XP_006854996.1| hypothetical protein AMTR_s00052p00205770 [Amborella trichopoda]
 gb|ERN16463.1| hypothetical protein AMTR_s00052p00205770 [Amborella trichopoda]
Length=351

 Score =   172 bits (436),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++VRTLDTKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSAKIVRTLDTKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G +VKFWDAN F LVKSY MPC VESASLEP+ G +F+AGG DM
Sbjct  207  GCTVKFWDANHFGLVKSYTMPCTVESASLEPKLGNKFVAGGEDM  250


 Score = 92.8 bits (229),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 52/86 (60%), Gaps = 7/86 (8%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VRLFDFH GE+  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQT P   +D S   
Sbjct  252  VRLFDFHTGEEIACNKGHHGPVHCVRFSPLGDSYASGSEDGTIRIWQTQPTTGSDESEAL  311

Query  69   PK-------PXVXKDVNXEXXKLHIA  13
            P          V +DV  +    HIA
Sbjct  312  PANGPSAKIKVVAEDVVHKIEGFHIA  337



>ref|XP_002303265.1| transducin family protein [Populus trichocarpa]
 gb|EEE78244.1| transducin family protein [Populus trichocarpa]
Length=350

 Score =   177 bits (449),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKLGNKFVAGGEDM  250


 Score = 87.8 bits (216),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH GEQ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  252  IHVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_004515599.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cicer arietinum]
Length=353

 Score =   175 bits (443),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TSAEVS+DG YITTAD
Sbjct  147  SVRSVAWLHSDQTILSSCTDKGGVRLWDVRTGKIVQTLDTKSPMTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPCNVESASLEP+FG +FIAGG D+
Sbjct  207  GSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFIAGGEDL  250


 Score = 90.1 bits (222),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    ++    
Sbjct  252  VHVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLGHDESEGLS  311

Query  69   PKPXVXK-------DVNXEXXKLHIAKGAK  1
            P   + K       DV+      HIA+ AK
Sbjct  312  PNGSIEKVKANAEEDVSRRIEGFHIAEEAK  341



>ref|XP_011081111.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Sesamum indicum]
Length=340

 Score =   171 bits (432),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+AWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTLAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVK YDMPC +ESASLEP+FG +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKRYDMPCIMESASLEPKFGNKFIAGGEDM  250


 Score = 94.0 bits (232),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            + +FDFH G + GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP + + A+ GP
Sbjct  252  IHVFDFHTGAEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPEQDSCAANGP  311

Query  69   PK--PXVXKDVNXEXXKLHIAKGAK  1
             +    V  +V  +   + IA+  K
Sbjct  312  SQNIKDVVNEVTNQMRNVLIAEEEK  336



>ref|XP_010098976.1| Serine-threonine kinase receptor-associated protein [Morus notabilis]
 gb|EXB76278.1| Serine-threonine kinase receptor-associated protein [Morus notabilis]
Length=350

 Score =   176 bits (445),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDLGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCTVESASLEPKYGNKFIAGGEDM  250


 Score = 89.0 bits (219),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDA  82
            +R+FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP  NE T+ 
Sbjct  252  IRVFDFHTGNEITCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTNEDTEV  309



>ref|XP_002517562.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
 gb|EEF44726.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
Length=336

 Score =   174 bits (442),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDMGGVRLWDIRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCNVESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCNVESASLEPKLGNKFVAGGEDM  250


 Score = 89.7 bits (221),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN  97
            + +FDFH GEQ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQTGP 
Sbjct  252  IHVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPQ  302



>gb|KJB13093.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
 gb|KJB13094.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
Length=350

 Score =   177 bits (449),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQ ILSSC+DT+GVRLWDLRS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQMILSSCTDTNGVRLWDLRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGGEDM  250


 Score = 87.4 bits (215),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQT P
Sbjct  252  VHVFDFHTGEELGCNKGHHGPVHCVRFSPGGGSFASGSEDGTIRIWQTSP  301



>ref|XP_002298116.1| transducin family protein [Populus trichocarpa]
 gb|EEE82921.1| transducin family protein [Populus trichocarpa]
Length=350

 Score =   178 bits (452),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCADIGGVRLWDIRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+FG +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGGEDM  250


 Score = 85.9 bits (211),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH GEQ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ  P
Sbjct  252  IHVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLSP  301



>gb|KDP37150.1| hypothetical protein JCGZ_06206 [Jatropha curcas]
Length=350

 Score =   175 bits (444),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDIRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN ESASLEP+FG +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCNTESASLEPKFGNKFVAGGEDM  250


 Score = 89.4 bits (220),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDF+ GEQ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP
Sbjct  252  IHIFDFNTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>gb|KJB13091.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
 gb|KJB13092.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
Length=307

 Score =   177 bits (449),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQ ILSSC+DT+GVRLWDLRS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  104  SIRTVAWLHSDQMILSSCTDTNGVRLWDLRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  163

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  164  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGGEDM  207


 Score = 87.0 bits (214),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQT P
Sbjct  209  VHVFDFHTGEELGCNKGHHGPVHCVRFSPGGGSFASGSEDGTIRIWQTSP  258



>gb|KJB70541.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=228

 Score =   179 bits (455),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  36   SIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  95

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  96   GSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGGEDM  139


 Score = 84.7 bits (208),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH G++ GCNKGHHGP+H VRF+PGG    SGSEDGTIRIW T P    ++ A P
Sbjct  141  VHVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVP  200



>emb|CDY62165.1| BnaA05g35670D [Brassica napus]
Length=330

 Score =   172 bits (436),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G++F+AGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGEKFVAGGEDM  250


 Score = 91.7 bits (226),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT PN + D  A
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNHSVDEVA  309



>gb|KJB70540.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=339

 Score =   179 bits (454),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  207  GSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGGEDM  250


 Score = 84.7 bits (208),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH G++ GCNKGHHGP+H VRF+PGG    SGSEDGTIRIW T P    ++ A P
Sbjct  252  VHVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVP  311



>ref|XP_009144818.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brassica rapa]
Length=330

 Score =   172 bits (436),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G++F+AGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGEKFVAGGEDM  250


 Score = 91.7 bits (226),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT PN + D  A
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNHSVDEVA  309



>gb|KJB70542.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70543.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70544.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70545.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=296

 Score =   179 bits (454),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  104  SIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  163

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  164  GSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGGEDM  207


 Score = 84.3 bits (207),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDFH G++ GCNKGHHGP+H VRF+PGG    SGSEDGTIRIW T P    ++ A P
Sbjct  209  VHVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVP  268



>ref|XP_002529368.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
 gb|EEF33035.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
Length=350

 Score =   174 bits (442),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITT D
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTCD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCTVESASLEPKYGNKFIAGGEDM  250


 Score = 89.0 bits (219),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 55/90 (61%), Gaps = 8/90 (9%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-------NEA  91
            + +FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP         A
Sbjct  252  IHVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLIQDDTEGLA  311

Query  90   TDASAGPPKPXVXKDVNXEXXKLHIAKGAK  1
             + S G  K    ++V  +    HIA G K
Sbjct  312  ANGSVGKVK-VTAEEVTHKIEGFHIADGGK  340



>ref|XP_010465533.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=341

 Score =   172 bits (435),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  250


 Score = 91.3 bits (225),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VRLFDFH GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP    +     
Sbjct  252  VRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVTPEEIIESK  311

Query  69   PKPXVXKDVNXEXXKLHIAKGAK  1
             K  V  +V  +    HI K  K
Sbjct  312  SKQNV-DEVTRKIEGFHINKEGK  333



>ref|XP_006427175.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
 gb|ESR40415.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
Length=350

 Score =   174 bits (440),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYNMPCNTESASLEPKLGNIFIAGGEDM  250


 Score = 89.4 bits (220),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GEQ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQT P
Sbjct  252  VHVFDFHTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTNP  301



>ref|XP_010487393.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=342

 Score =   172 bits (435),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  250


 Score = 91.3 bits (225),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VRLFDFH GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP    +     
Sbjct  252  VRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEIIESK  311

Query  69   PKPXVXKDVNXEXXKLHIAKGAK  1
             K  V  +V  +    HI K  K
Sbjct  312  SKQNV-DEVTRKIEGFHINKEGK  333



>ref|XP_010654727.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Vitis vinifera]
Length=356

 Score =   173 bits (438),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+R+ ++V TL+TKS VTSAEVS+DG YITTAD
Sbjct  157  SIRTVAWLHSDQTILSSCTDNGGVRLWDVRTGKIVHTLETKSPVTSAEVSQDGRYITTAD  216

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++VKFWDAN + LVKSY+MPCN+ESASLEP+FG +FIAGG DM
Sbjct  217  GTTVKFWDANHYGLVKSYNMPCNMESASLEPKFGNKFIAGGEDM  260


 Score = 90.1 bits (222),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN--EATDASA  76
            + +FDF+ GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP   E  D+  
Sbjct  262  IHMFDFNTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPQNLEEPDSFV  321

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
                  V  +V  +    H+ K  K
Sbjct  322  SGKVKVVVDEVTRKVEGFHVGKDGK  346



>emb|CDY61819.1| BnaC06g41840D [Brassica napus]
Length=330

 Score =   171 bits (433),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTIL+SC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILTSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 92.0 bits (227),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT PN + D  A
Sbjct  252  VRMFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNHSVDEVA  309



>ref|XP_007013329.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30948.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=349

 Score =   171 bits (432),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAW+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS DG YITTAD
Sbjct  147  SVRTVAWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSLDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKS++MPC VESASLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSHNMPCTVESASLEPKYGNKFVAGGEDM  250


 Score = 92.4 bits (228),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VR+FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    DA +  
Sbjct  252  VRVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDDAESMA  311

Query  69   PKPXV------XKDVNXEXXKLHIAKGAK  1
                V       ++V+ +    HIA+  K
Sbjct  312  ANGSVGQVKVSAEEVSRKIEGFHIAEEVK  340



>ref|XP_007013330.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY30949.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=303

 Score =   171 bits (432),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAW+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS DG YITTAD
Sbjct  101  SVRTVAWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSLDGRYITTAD  160

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKS++MPC VESASLEP++G +F+AGG DM
Sbjct  161  GSTVKFWDANHFGLVKSHNMPCTVESASLEPKYGNKFVAGGEDM  204


 Score = 92.4 bits (228),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VR+FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    DA +  
Sbjct  206  VRVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDDAESMA  265

Query  69   PKPXV------XKDVNXEXXKLHIAKGAK  1
                V       ++V+ +    HIA+  K
Sbjct  266  ANGSVGQVKVSAEEVSRKIEGFHIAEEVK  294



>gb|KHN27398.1| Serine-threonine kinase receptor-associated protein [Glycine 
soja]
Length=352

 Score =   172 bits (436),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPC VES SLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGGEDM  250


 Score = 90.5 bits (223),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VR+FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    D+    
Sbjct  252  VRVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDDSETVS  311

Query  69   PKPXVXK  49
                V K
Sbjct  312  ANGSVDK  318



>ref|XP_003524526.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Glycine max]
Length=352

 Score =   172 bits (436),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPC VES SLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGGEDM  250


 Score = 90.5 bits (223),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VR+FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    D+    
Sbjct  252  VRVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDDSETVS  311

Query  69   PKPXVXK  49
                V K
Sbjct  312  ANGSVDK  318



>ref|XP_002285272.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Vitis vinifera]
 emb|CBI36243.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   172 bits (437),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+R+ ++V TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDNGGVRLWDVRTGKIVHTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++VKFWDAN + LVKSY+MPCN+ESASLEP+FG +FIAGG DM
Sbjct  207  GTTVKFWDANHYGLVKSYNMPCNMESASLEPKFGNKFIAGGEDM  250


 Score = 90.1 bits (222),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN--EATDASA  76
            + +FDF+ GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP   E  D+  
Sbjct  252  IHMFDFNTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPQNLEEPDSFV  311

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
                  V  +V  +    H+ K  K
Sbjct  312  SGKVKVVVDEVTRKVEGFHVGKDGK  336



>ref|XP_010545787.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
Length=341

 Score =   172 bits (435),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+T+SSVTSAEVS+DG YITTAD
Sbjct  147  SIRTVTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETESSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKFGNKFVAGGEDM  250


 Score = 90.9 bits (224),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD--ASA  76
            VR+FDFH GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT P+   D   S 
Sbjct  252  VRVFDFHSGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTAPSNPEDNKTST  311

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
            G  K  V ++V  +    H+ K  K
Sbjct  312  GRAKQTV-EEVARKIEGFHMNKEGK  335



>ref|XP_008785422.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Phoenix dactylifera]
Length=343

 Score =   175 bits (443),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPC VESASLEP+FG RFIAGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGGEDL  250


 Score = 87.4 bits (215),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 53/86 (62%), Gaps = 6/86 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            V +FDFH GEQ  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQT P     NEAT 
Sbjct  252  VHVFDFHSGEQITCNKGHHGPVHCVRFSPMGKSYASGSEDGTIRIWQTSPATADENEATG  311

Query  84   ASAGPPKPXV-XKDVNXEXXKLHIAK  10
            A+    K  V   +   +    HI+K
Sbjct  312  ANGAAGKVKVGANEAARKIEGFHISK  337



>ref|XP_007154947.1| hypothetical protein PHAVU_003G160500g [Phaseolus vulgaris]
 gb|ESW26941.1| hypothetical protein PHAVU_003G160500g [Phaseolus vulgaris]
Length=353

 Score =   173 bits (439),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPC VES SLEP+FG +F+AGG DM
Sbjct  207  GSTVKFWDANYYGLVKSYDMPCTVESVSLEPKFGNKFVAGGEDM  250


 Score = 89.0 bits (219),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    D+ A
Sbjct  252  VHVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDDSEA  309



>ref|XP_006451011.1| hypothetical protein CICLE_v10008796mg [Citrus clementina]
 ref|XP_006475776.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Citrus sinensis]
 gb|ESR64251.1| hypothetical protein CICLE_v10008796mg [Citrus clementina]
 gb|KDO80363.1| hypothetical protein CISIN_1g018860mg [Citrus sinensis]
Length=349

 Score =   172 bits (437),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILS+C+D  GVRLWD+RS E+V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSTCTDMGGVRLWDVRSGEIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC +ESASLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTIESASLEPKYGNKFVAGGEDM  250


 Score = 89.7 bits (221),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            VR FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP      E   
Sbjct  252  VRFFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPVTNDDTETLT  311

Query  84   ASAGPPKPXVXKD-VNXEXXKLHIAKGAK  1
            A+    K  V  D V+ +    HIA   K
Sbjct  312  ANGTIGKVKVTADEVSRKIEGFHIADEGK  340



>ref|XP_006298067.1| hypothetical protein CARUB_v10014111mg [Capsella rubella]
 gb|EOA30965.1| hypothetical protein CARUB_v10014111mg [Capsella rubella]
Length=341

 Score =   172 bits (435),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVTWLHGDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  250


 Score = 90.5 bits (223),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VRLFDFH GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP
Sbjct  252  VRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGP  301



>ref|XP_004287375.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Fragaria vesca subsp. vesca]
Length=357

 Score =   172 bits (435),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKSSVTS+EVS+DG YITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSSVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VES SLEP+FG +FIAGG DM
Sbjct  207  GSTVKFWDANYFGLVKSYNMPCTVESVSLEPKFGNKFIAGGEDM  250


 Score = 90.1 bits (222),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            V +FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP  NE ++A A
Sbjct  252  VHVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTNEESEAQA  311

Query  75   G  73
             
Sbjct  312  A  312



>gb|KHG21144.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=350

 Score =   174 bits (442),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQ ILSSC++T+GVRLWDLRS ++V+TL+TKS VTS+EVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQMILSSCTETNGVRLWDLRSGKIVQTLETKSPVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGGEDM  250


 Score = 87.4 bits (215),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQT P
Sbjct  252  VHVFDFHTGEELGCNKGHHGPVHCVRFSPGGGSFASGSEDGTIRIWQTSP  301



>gb|KDO52915.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=350

 Score =   172 bits (436),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDM  250


 Score = 89.0 bits (219),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GEQ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQT P
Sbjct  252  VHVFDFHTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTNP  301



>ref|XP_007202311.1| hypothetical protein PRUPE_ppa008052mg [Prunus persica]
 gb|EMJ03510.1| hypothetical protein PRUPE_ppa008052mg [Prunus persica]
Length=347

 Score =   172 bits (435),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  207  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  250


 Score = 89.7 bits (221),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 3/86 (3%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            V +FDFH G++  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQTGP   + T+A A
Sbjct  252  VHVFDFHTGDEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTQDETEALA  311

Query  75   GPPKPXV-XKDVNXEXXKLHIAKGAK  1
               K  V  ++V+ +    HIA   K
Sbjct  312  ANGKVKVPAEEVSRKIEGFHIADEGK  337



>ref|XP_006465394.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Citrus sinensis]
Length=350

 Score =   172 bits (436),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHGDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDM  250


 Score = 89.0 bits (219),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GEQ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQT P
Sbjct  252  VHVFDFHTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTNP  301



>gb|ACU23446.1| unknown [Glycine max]
Length=352

 Score =   171 bits (432),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ ILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQAILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPC VES SLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGGEDM  250


 Score = 90.5 bits (223),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            VR+FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    D+    
Sbjct  252  VRVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDDSETVS  311

Query  69   PKPXVXK  49
                V K
Sbjct  312  ANGSVDK  318



>ref|XP_002284993.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Vitis vinifera]
 emb|CBI28146.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   168 bits (426),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+T SSVTSAEVS+DG YI TAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETNSSVTSAEVSQDGRYIITAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY MPC VESASLEP+ G +FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYKMPCTVESASLEPKNGDKFIAGGEDM  250


 Score = 92.8 bits (229),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 57/89 (64%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            +RLFDFH GE+  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP     NE   
Sbjct  252  IRLFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDNNEMFR  311

Query  84   ASAGPPKPXV-XKDVNXEXXKLHIAKGAK  1
            A+    K  V  ++V+ +    HIA   K
Sbjct  312  ANGLTGKVKVAAEEVSCKIEGFHIADEGK  340



>ref|XP_010249966.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nelumbo nucifera]
Length=350

 Score =   172 bits (437),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWDLRS ++++TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDMGGVRLWDLRSGQIIQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+V+FWDAN F LVKSY+MPC VESASLEP+ G +FIAGG DM
Sbjct  207  GSTVRFWDANHFALVKSYNMPCTVESASLEPKLGNKFIAGGEDM  250


 Score = 88.2 bits (217),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP---NEATDAS  79
            + +FDFH G++ GCNKGHHGPVH VRF+PGG    SGSEDGTIRIWQTGP   +E     
Sbjct  252  IHVFDFHTGKEIGCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQTGPACHDEIDTVG  311

Query  78   AGPPKPXVXKDVNXEXXKL---HIAKGAK  1
            A  P   V    +    K+   HIAK  K
Sbjct  312  ANGPTGKVKVTADEVAQKIEGFHIAKDGK  340



>gb|KEH37967.1| Serine/Threonine kinase receptor-associated-like protein [Medicago 
truncatula]
Length=351

 Score =   174 bits (440),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TSAEVS+DG YITTAD
Sbjct  147  SVRSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPCNVESASLEP+FG +F+AGG D+
Sbjct  207  GSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFVAGGEDL  250


 Score = 87.0 bits (214),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP
Sbjct  252  VHVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>gb|KJB64820.1| hypothetical protein B456_010G066700 [Gossypium raimondii]
Length=346

 Score =   168 bits (425),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV+W+H+DQT+LSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTVSWMHSDQTLLSSCTDMGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++VKFWDA+ F LVKSY+MPC VESASLEP++G +FIAGG DM
Sbjct  207  GATVKFWDADHFGLVKSYNMPCTVESASLEPKYGNKFIAGGEDM  250


 Score = 92.8 bits (229),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 59/91 (65%), Gaps = 9/91 (10%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--------NE  94
            VR+FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP        + 
Sbjct  252  VRVFDFHTGDETACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTDHEETKSH  311

Query  93   ATDASAGPPKPXVXKDVNXEXXKLHIAKGAK  1
            A + S G  K  V ++V+ +    HIA+  K
Sbjct  312  AANGSVGKVKVSV-EEVSRKIGGFHIAEEGK  341



>ref|XP_010254304.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nelumbo nucifera]
Length=353

 Score =   172 bits (437),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TLDTKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLDTKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS VKFWDAN F LVKSY+MPC VESASLEP+ G +FIAGG DM
Sbjct  207  GSMVKFWDANHFTLVKSYNMPCTVESASLEPKHGNKFIAGGEDM  250


 Score = 87.8 bits (216),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 53/88 (60%), Gaps = 5/88 (6%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            + +FDFH G + GCNKGHHGPVH VRF+PGG    SGSEDGTIRIWQTGP+     + G 
Sbjct  252  IHVFDFHSGAEIGCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQTGPSHDEIETFGA  311

Query  69   PKPX-----VXKDVNXEXXKLHIAKGAK  1
              P         +V  +    HIAK  K
Sbjct  312  NGPAGKVKVTADEVANKIEGFHIAKDGK  339



>ref|XP_011072259.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Sesamum indicum]
Length=349

 Score =   169 bits (428),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+V FWDAN F LVKSYDMPC VESASLEP++G +FIA G DM
Sbjct  207  GSTVTFWDANHFGLVKSYDMPCIVESASLEPKYGNKFIASGEDM  250


 Score = 91.7 bits (226),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP----NEATDA  82
            + +FDFH G + GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP    N+ T  
Sbjct  252  IHVFDFHTGAEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPQNNTNQETSG  311

Query  81   SAGPPK--PXVXKDVNXEXXKLHIAKGAK  1
            S GP +       +V  +    HIA+  K
Sbjct  312  SNGPIQNVKDAADEVARQIENAHIAEEDK  340



>emb|CDX89958.1| BnaA10g01240D [Brassica napus]
Length=341

 Score =   170 bits (431),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTLTWLHSDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 90.1 bits (222),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNE  94
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT PN+
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTAPNQ  303



>ref|XP_008385948.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=352

 Score =   172 bits (435),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  208  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  251


 Score = 88.2 bits (217),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDFH GE+  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQTGP    +A A
Sbjct  253  VHVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTPDEAEA  310



>ref|XP_008343948.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=352

 Score =   172 bits (435),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  208  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  251


 Score = 88.2 bits (217),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDFH GE+  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQTGP    +A A
Sbjct  253  VHVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTPDEAEA  310



>ref|XP_007023961.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY26583.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=351

 Score =   175 bits (443),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+DTSGVRLWDLRS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDTSGVRLWDLRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY MPCNVESASLEP+ G + IAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYYMPCNVESASLEPKHGNKLIAGGEDM  250


 Score = 85.1 bits (209),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            V +FDFH GE+ GCNKGHHGPVH VRFSPGG    SGSEDGTIRIWQ G
Sbjct  252  VHVFDFHTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQIG  300



>ref|XP_009347464.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
 ref|XP_009348196.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
Length=349

 Score =   171 bits (434),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  208  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  251


 Score = 88.2 bits (217),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDFH GE+  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQTGP    +A A
Sbjct  253  VHVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTPDEAEA  310



>gb|KFK38907.1| hypothetical protein AALP_AA3G176400 [Arabis alpina]
Length=349

 Score =   169 bits (427),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++ +TL+TKS VTSAEVS+DG YITTAD
Sbjct  148  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIEQTLETKSPVTSAEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  208  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  251


 Score = 90.5 bits (223),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG---PNEATDAS  79
            VRLFDFH G++ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTG   P E  + +
Sbjct  253  VRLFDFHTGDEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEIIEPN  312

Query  78   AGPPKPXVXKDVNXE  34
            AG  K    ++V  E
Sbjct  313  AGKSKQNNVEEVARE  327



>ref|XP_003549786.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Glycine max]
 gb|KHN15128.1| Serine-threonine kinase receptor-associated protein [Glycine 
soja]
Length=352

 Score =   172 bits (436),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPC +ES SLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANYYGLVKSYDMPCTIESVSLEPKYGNKFVAGGEDM  250


 Score = 87.4 bits (215),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 47/73 (64%), Gaps = 5/73 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            V +FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP     +E   
Sbjct  252  VHVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDGSETVS  311

Query  84   ASAGPPKPXVXKD  46
            A+    K  V  D
Sbjct  312  ANGSVDKVKVTAD  324



>ref|XP_006392876.1| hypothetical protein EUTSA_v10011626mg [Eutrema salsugineum]
 gb|ESQ30162.1| hypothetical protein EUTSA_v10011626mg [Eutrema salsugineum]
Length=343

 Score =   171 bits (434),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 88.2 bits (217),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-NEATDASAG  73
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT P N   + SA 
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPANTEENESAS  311

Query  72   PPKPXVXKDVNXEXXKLHIAKGAK  1
                    +V+ +    HI K  K
Sbjct  312  RRVKHNVDEVSKKIEGFHINKEGK  335



>gb|AFK46987.1| unknown [Lotus japonicus]
Length=350

 Score =   169 bits (429),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKSSVTSAEVS+DG YI TAD
Sbjct  147  SVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGIIVQTLETKSSVTSAEVSQDGRYIITAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + +VKSYDMPC VESASLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANYYGMVKSYDMPCTVESASLEPKYGNKFVAGGEDM  250


 Score = 89.7 bits (221),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 3/61 (5%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP---NEATDAS  79
            VR+FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIW+TGP   +E+ D S
Sbjct  252  VRVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWRTGPLTHDESEDLS  311

Query  78   A  76
            A
Sbjct  312  A  312



>emb|CDY40132.1| BnaC06g05570D [Brassica napus]
Length=341

 Score =   169 bits (428),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++++TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIMQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 90.1 bits (222),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNE  94
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT PN+
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTAPNQ  303



>ref|XP_008242709.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Prunus mume]
Length=347

 Score =   169 bits (429),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY++PC VESASLEP+FG +FIAGG DM
Sbjct  207  GSTVKFWDANYFGLVKSYNIPCTVESASLEPKFGNKFIAGGEDM  250


 Score = 89.4 bits (220),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            V +FDFH G++  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQTGP   + T+A A
Sbjct  252  VHVFDFHTGDEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTQDETEALA  311

Query  75   GPPKPXV-XKDVNXEXXKLHIA  13
               K  V  ++V+ +    HIA
Sbjct  312  ANGKVKVPAEEVSRKIEGFHIA  333



>ref|XP_010925262.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Elaeis guineensis]
Length=343

 Score =   174 bits (440),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPC VESASLEP+ G RFIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYNMPCTVESASLEPKLGNRFIAGGEDM  250


 Score = 85.1 bits (209),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 52/86 (60%), Gaps = 6/86 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            + +FDFH GEQ  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQ  P     NE T 
Sbjct  252  IHVFDFHTGEQITCNKGHHGPVHCVRFSPVGESYASGSEDGTIRIWQMSPATADENEVTG  311

Query  84   ASAGPPKPXV-XKDVNXEXXKLHIAK  10
            A+    K  V   +V  +    HI+K
Sbjct  312  ANGSAGKVKVGANEVARKIEGFHISK  337



>ref|XP_010503217.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=341

 Score =   168 bits (425),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH DQTILS C+D  GVRLWD+RS ++V+TL+TKS  TSAEVS+DG YITTAD
Sbjct  147  SIRTVTWLHGDQTILSFCTDIGGVRLWDVRSGKIVQTLETKSPATSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDM  250


 Score = 90.5 bits (223),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VRLFDFH GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP
Sbjct  252  VRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGP  301



>ref|XP_010542265.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
 ref|XP_010542266.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
Length=343

 Score =   165 bits (418),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVTWLHSDQTILSSCTDIGGVRLWDVRSGRIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLE + G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLETKSGNKFVAGGEDM  250


 Score = 93.2 bits (230),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN--EATDASA  76
            VR+FDFH GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQTGP+  E  +AS 
Sbjct  252  VRVFDFHTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTGPSNPEDIEAST  311

Query  75   GPPKPXVXKDVNXEXXKLHIAK  10
            G  K     +V  +    HI K
Sbjct  312  GRAK-QTADEVARKIEGFHIDK  332



>ref|XP_009147669.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Brassica rapa]
 emb|CDY62196.1| BnaA06g01530D [Brassica napus]
Length=337

 Score =   170 bits (430),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTLTWLHSDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 88.2 bits (217),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNE  94
            VR+FDF  GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT PN+
Sbjct  252  VRVFDFFTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNQ  303



>gb|KDP32349.1| hypothetical protein JCGZ_13274 [Jatropha curcas]
Length=350

 Score =   173 bits (439),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSCSD  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITT D
Sbjct  147  SIRTVAWLHSDQTILSSCSDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTCD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGNKFIAGGEDM  250


 Score = 84.7 bits (208),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + ++DFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP
Sbjct  252  IHVYDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_008464982.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis melo]
 ref|XP_008464983.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis melo]
Length=353

 Score =   173 bits (438),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDM  250


 Score = 85.1 bits (209),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 6/74 (8%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP------NEAT  88
            + +FDFH G++  CNKGHHGPVH +RF+PGG    SGSEDGTIRIWQTGP      +EAT
Sbjct  252  IHVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGPLTHDDSDEAT  311

Query  87   DASAGPPKPXVXKD  46
              +    K  V  D
Sbjct  312  LVNGSIGKVKVSAD  325



>ref|XP_008792113.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Phoenix dactylifera]
Length=343

 Score =   176 bits (445),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG RFIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGGEDM  250


 Score = 82.0 bits (201),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEA  91
            + +FDFH GEQ  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQ  P  A
Sbjct  252  IHVFDFHTGEQITCNKGHHGPVHCVRFSPIGESYASGSEDGTIRIWQMSPATA  304



>gb|KHG01497.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=349

 Score =   171 bits (432),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVTWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANHYGLVKSYNMPCTVESASLEPKYGNKFVAGGEDM  250


 Score = 87.0 bits (214),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VR+FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIW TGP
Sbjct  252  VRVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWLTGP  301



>ref|XP_004146293.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis sativus]
Length=353

 Score =   173 bits (438),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDM  250


 Score = 84.7 bits (208),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH G++  CNKGHHGPVH +RF+PGG    SGSEDGTIRIWQTGP
Sbjct  252  IHVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGP  301



>gb|KJB54108.1| hypothetical protein B456_009G020900 [Gossypium raimondii]
Length=349

 Score =   171 bits (432),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVTWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANHYGLVKSYNMPCTVESASLEPKYGNKFVAGGEDM  250


 Score = 87.0 bits (214),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VR+FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIW TGP
Sbjct  252  VRVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWLTGP  301



>ref|XP_004167839.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis sativus]
Length=353

 Score =   173 bits (438),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDM  250


 Score = 84.7 bits (208),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH G++  CNKGHHGPVH +RF+PGG    SGSEDGTIRIWQTGP
Sbjct  252  IHVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGP  301



>gb|KGN65408.1| hypothetical protein Csa_1G418250 [Cucumis sativus]
Length=366

 Score =   173 bits (438),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  160  SVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTSAEVSQDGRYITTAD  219

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGG DM
Sbjct  220  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDM  263


 Score = 84.7 bits (208),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH G++  CNKGHHGPVH +RF+PGG    SGSEDGTIRIWQTGP
Sbjct  265  IHVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGP  314



>ref|NP_849800.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 ref|NP_175682.2| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AAD55591.1|AC008016_1 Similar to gb|AJ010025 unr-interacting protein from Homo sapiens 
and contains 3 PF|00400 WD40 domains. EST gb|T45021 comes 
from this gene [Arabidopsis thaliana]
 gb|AAP37674.1| At1g52730 [Arabidopsis thaliana]
 dbj|BAE99937.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20036.1| AT1G52730 [Arabidopsis thaliana]
 gb|AEE32845.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AEE32846.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=343

 Score =   171 bits (434),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 86.3 bits (212),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN--EATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQT P   E  + S+
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPANPEENETSS  311

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
               K  V  +V+ +    HI K  K
Sbjct  312  RRVKHSV-DEVSKKIEGFHINKEGK  335



>ref|XP_002891712.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67971.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   171 bits (434),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 86.3 bits (212),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN--EATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQT P   E  + S+
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTPANPEENETSS  311

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
               K  V  +V+ +    HI K  K
Sbjct  312  RRVKHSV-DEVSKKIEGFHINKEGK  335



>ref|XP_010500889.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
 ref|XP_010462123.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
 ref|XP_010479792.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=343

 Score =   171 bits (434),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 85.9 bits (211),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN--EATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQT P   E  + S+
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGVSYASGSEDGTIRIWQTTPANPEENETSS  311

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
               K  V  +V+ +    HI K  K
Sbjct  312  RRVKHSV-DEVSKKIEGFHINKEGK  335



>ref|XP_006406945.1| hypothetical protein EUTSA_v10021071mg [Eutrema salsugineum]
 gb|ESQ48398.1| hypothetical protein EUTSA_v10021071mg [Eutrema salsugineum]
Length=342

 Score =   167 bits (424),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASL+P+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCNIESASLDPKSGNKFVAGGEDM  250


 Score = 89.7 bits (221),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEA  91
            VRLFDFH GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIW+TGP  A
Sbjct  252  VRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWETGPVNA  304



>ref|XP_006305259.1| hypothetical protein CARUB_v10009632mg [Capsella rubella]
 gb|EOA38157.1| hypothetical protein CARUB_v10009632mg [Capsella rubella]
Length=343

 Score =   170 bits (431),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F L+KSYDMPCN+ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLLKSYDMPCNIESASLEPKSGEKFVAGGEDM  250


 Score = 87.0 bits (214),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            VR+FDF+ GE+ GCNKGHHGPVH VRF+P G    SGSEDGTIRIWQT P  +E  + S+
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFTPTGVSYASGSEDGTIRIWQTTPANSEENETSS  311

Query  75   GPPKPXVXKDVNXEXXKLHIAKGAK  1
               K  V  +V+ +    HI K  K
Sbjct  312  RRVKHSV-DEVSKKIEGFHINKEGK  335



>gb|AFK34417.1| unknown [Medicago truncatula]
Length=351

 Score =   169 bits (429),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SV +VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS EVS+DG YITTAD
Sbjct  147  SVTSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTSVEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN + LVKSYDMPCNVESASLEP+FG +F+AGG D+
Sbjct  207  GSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFVAGGEDL  250


 Score = 87.0 bits (214),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP
Sbjct  252  VHVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_009602512.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   169 bits (428),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQT+LSS  D  G+RLWD+RS +VV+TL+TK  VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTLLSSSGDAGGLRLWDVRSGKVVQTLETKFPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYD+PC VESASLEP+FG RFIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDLPCKVESASLEPKFGNRFIAGGEDM  250


 Score = 87.4 bits (215),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  252  VHVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_008337419.1| PREDICTED: serine-threonine kinase receptor-associated protein-like, 
partial [Malus domestica]
Length=230

 Score =   173 bits (438),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  27   SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  86

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  87   GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  130


 Score = 83.2 bits (204),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V +FDFH GE+  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQT
Sbjct  132  VHVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQT  179



>gb|AGT15994.1| hypothetical protein SHCRBa_159_J23_F_580 [Saccharum hybrid cultivar 
R570]
Length=340

 Score =   170 bits (431),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTSAEVS+DG +ITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  250


 Score = 85.9 bits (211),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD---AS  79
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D   A+
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPANADDNEAAN  311

Query  78   AGPPKPXVXKDVNXEXXKLHIAK  10
            A      V  +V  +    HI K
Sbjct  312  ANGKTNAVVNEVTTKIEGFHIPK  334



>ref|XP_004965966.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Setaria italica]
Length=339

 Score =   170 bits (431),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTSAEVS+DG +ITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTSAEVSQDGRFITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  208  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  251


 Score = 86.3 bits (212),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V LFDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D  A  
Sbjct  253  VHLFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEAAN  312

Query  69   PKPXV-XKDVNXEXXKLHIAK  10
             KP     +V  +    HI K
Sbjct  313  GKPADGVNEVTTKIEGFHIPK  333



>ref|XP_010914940.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Elaeis guineensis]
Length=344

 Score =   173 bits (439),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+ G RFIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCTVESASLEPKIGNRFIAGGEDM  250


 Score = 82.8 bits (203),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEA  91
            + +FDFH GEQ  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQ  P  A
Sbjct  252  IHVFDFHTGEQIACNKGHHGPVHCVRFSPIGESYASGSEDGTIRIWQMSPATA  304



>ref|XP_009402893.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Musa acuminata subsp. malaccensis]
Length=347

 Score =   171 bits (432),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPC VESASLEP+ G +F+AGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYNMPCTVESASLEPKDGNKFVAGGEDM  250


 Score = 85.1 bits (209),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD  85
            V +FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQ GP    D
Sbjct  252  VHVFDFHTGVEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQMGPTATDD  306



>ref|XP_009770768.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Nicotiana sylvestris]
Length=299

 Score =   166 bits (421),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  102  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  161

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  162  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  205


 Score = 89.0 bits (219),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            +R+FDFH GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP
Sbjct  207  IRVFDFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGP  256



>ref|XP_008337340.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
 ref|XP_008352271.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=351

 Score =   172 bits (435),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  208  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  251


 Score = 83.2 bits (204),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V +FDFH GE+  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQT
Sbjct  253  VHVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQT  300



>ref|XP_009374067.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
Length=351

 Score =   172 bits (435),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  208  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  251


 Score = 83.2 bits (204),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT--GPNEATDASA  76
            V +FDFH GE+  CNKGHHGPVH +RFSPGG    SGSEDGTIRIWQT   P E     A
Sbjct  253  VHVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTPLTPEETETLVA  312

Query  75   GPPKPXV---XKDVNXEXXKLHIAKGAK  1
              P   V    ++V+ +    HI    K
Sbjct  313  NGPVGNVKVPAEEVSRKIEGFHITDEGK  340



>gb|EYU24671.1| hypothetical protein MIMGU_mgv1a010043mg [Erythranthe guttata]
Length=324

 Score =   172 bits (436),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+ WLH DQTIL SC+D SGVRLWD+R+ ++VRTL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTLTWLHTDQTILGSCTDMSGVRLWDVRTGKIVRTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYEMPCIVESASLEPKFGNKFIAGGEDM  250


 Score = 82.8 bits (203),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +R+FDF  G + GCNKGHHGPVH VRFSPGG    SGSEDGTIRIW+TG
Sbjct  252  IRVFDFDTGAEVGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWRTG  300



>ref|XP_009770767.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Nicotiana sylvestris]
Length=301

 Score =   166 bits (420),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  104  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  163

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  164  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  207


 Score = 88.6 bits (218),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            +R+FDFH GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP
Sbjct  209  IRVFDFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGP  258



>ref|XP_002438635.1| hypothetical protein SORBIDRAFT_10g023300 [Sorghum bicolor]
 gb|EER90002.1| hypothetical protein SORBIDRAFT_10g023300 [Sorghum bicolor]
Length=340

 Score =   170 bits (431),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTSAEVS+DG +ITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  250


 Score = 84.0 bits (206),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  + D  A  
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPANSDDNEAAN  311

Query  69   PKPXVXKDVNXEXXKL---HIAK  10
                    VN    K+   HI K
Sbjct  312  ANGKTTAGVNEVTTKIEGFHIPK  334



>ref|XP_006341669.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Solanum tuberosum]
Length=356

 Score =   167 bits (422),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSS  D  G+RLWD+RS +VV+ L+TK  VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSSGDAGGLRLWDVRSGKVVQILETKFPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKS+D+PC VESASLEP+FG RFIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSHDLPCKVESASLEPKFGNRFIAGGEDM  250


 Score = 87.0 bits (214),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  252  VHVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>emb|CDP03398.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   165 bits (417),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILSSC+D  GVRLWD+R+ +VV TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SVRTVTWLHSDQTILSSCTDMGGVRLWDVRTGKVVETLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+A G DM
Sbjct  207  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGFKFVAAGEDM  250


 Score = 88.6 bits (218),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            +R+FDFH G++  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQTGP     +E   
Sbjct  252  IRVFDFHTGDEIACNKGHHGPVHCVRFAPGGETYASGSEDGTIRIWQTGPLINDESEPIA  311

Query  84   ASAGPPKPXVXKD-VNXEXXKLHIAKGAK  1
            A+ G  +  V  D V+ +    HI    K
Sbjct  312  ANGGTGRVKVSADEVSRKIEGFHITDEGK  340



>gb|EPS74468.1| hypothetical protein M569_00279, partial [Genlisea aurea]
Length=306

 Score =   170 bits (430),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR + WLH+DQTIL SC+DT GVRLWD+R+  +VRTL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRALTWLHSDQTILGSCTDTGGVRLWDVRTGSIVRTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSYDMPC VESASLEP++G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYDMPCIVESASLEPKYGNKFVAGGEDM  250


 Score = 83.6 bits (205),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -3

Query  249  VRLFDFHXGEQ-XGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNE  94
            + +FDFH GEQ  GCNKGHHGPVH VRFSP G    SGSEDGTIRIW+TGP E
Sbjct  252  IHVFDFHTGEQIVGCNKGHHGPVHCVRFSPEGESYASGSEDGTIRIWETGPGE  304



>ref|XP_009596073.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X4 [Nicotiana tomentosiformis]
Length=341

 Score =   166 bits (421),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  148  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  208  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  251


 Score = 86.7 bits (213),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDAS  79
            +R+F+FH GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP  N+  D +
Sbjct  253  IRVFNFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMT  311



>ref|XP_009760123.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nicotiana sylvestris]
Length=355

 Score =   165 bits (418),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQT+LSS  D  G+RLWD+RS +VV+TL+TK  VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTLLSSSGDAGGLRLWDVRSGKVVQTLETKFPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYD+ C VESASLEP+FG RFIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDLSCKVESASLEPKFGNRFIAGGEDM  250


 Score = 87.4 bits (215),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  252  VHVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|NP_001046249.1| Os02g0205400 [Oryza sativa Japonica Group]
 dbj|BAD16018.1| putative serine-threonine kinase receptor-associated protein 
[Oryza sativa Japonica Group]
 dbj|BAD38438.1| putative serine-threonine kinase receptor-associated protein 
[Oryza sativa Japonica Group]
 dbj|BAF08163.1| Os02g0205400 [Oryza sativa Japonica Group]
 gb|EEC72710.1| hypothetical protein OsI_06306 [Oryza sativa Indica Group]
 gb|EEE56531.1| hypothetical protein OsJ_05825 [Oryza sativa Japonica Group]
Length=342

 Score =   169 bits (427),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILS C+D  GVRLWD+RS ++ +TL+TK++VTSAEVS+DG YI TAD
Sbjct  147  SVRTVAWLHSDQSILSCCTDMGGVRLWDVRSGKIAQTLETKATVTSAEVSQDGRYIITAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPCNVESASLEP++G +FIAGG DM
Sbjct  207  GSSVKFWDANYFGLVKSYNMPCNVESASLEPKYGNKFIAGGEDM  250


 Score = 84.0 bits (206),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ GP   +D    P
Sbjct  252  VHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLGP-ATSDEQESP  310

Query  69   PKPXVXKDVN  40
            P       VN
Sbjct  311  PNANGKLKVN  320



>ref|XP_009596074.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X5 [Nicotiana tomentosiformis]
Length=340

 Score =   166 bits (420),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  147  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  207  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  250


 Score = 86.3 bits (212),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            +R+F+FH GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP  N+  D + 
Sbjct  252  IRVFNFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMTT  311



>emb|CDO98105.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   172 bits (437),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT+AWLH+DQ+ILSSC+D  GVRLWD+RS ++VRTL+TKS+VTS EVS DG YITT D
Sbjct  147  SVRTLAWLHSDQSILSSCTDIGGVRLWDVRSGKIVRTLETKSAVTSTEVSHDGRYITTVD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LV+SYDMPCN+ESASLEPRFG +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVRSYDMPCNMESASLEPRFGNKFVAGGEDM  250


 Score = 79.7 bits (195),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT-GPNEATDASAG  73
            V +FDFH G +  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQ    NE     A 
Sbjct  252  VHVFDFHTGAEIVCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQILNHNEEETIMAN  311

Query  72   PPKPXVXKDVNXEXXKL  22
             P   V  D   +  ++
Sbjct  312  GPSGKVKDDAAEDVTEM  328



>ref|NP_001288531.1| uncharacterized protein LOC103629787 [Zea mays]
 gb|ACN35648.1| unknown [Zea mays]
 gb|AFW76434.1| hypothetical protein ZEAMMB73_231124 [Zea mays]
Length=341

 Score =   169 bits (429),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+S+TSAEVS+DG +ITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASITSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  250


 Score = 82.4 bits (202),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD  85
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPVNADD  306



>gb|AFW87112.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=484

 Score =   170 bits (431),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTSAEVS+DG +ITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  250


 Score = 81.3 bits (199),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQ  P  A D     
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPCGESYASGSEDGTIRIWQLSPANADDNEVAN  311

Query  69   PKPXVXKDVNXEXXKL---HIAK  10
                    VN    K+   HI K
Sbjct  312  ANGKTTAGVNEVTTKIEGFHIPK  334



>ref|NP_001142332.1| LOC100274502 [Zea mays]
 gb|ACF88209.1| unknown [Zea mays]
 gb|AFW87111.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=340

 Score =   170 bits (431),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTSAEVS+DG +ITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  250


 Score = 81.3 bits (199),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQ  P  A D     
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPCGESYASGSEDGTIRIWQLSPANADDNEVAN  311

Query  69   PKPXVXKDVNXEXXKL---HIAK  10
                    VN    K+   HI K
Sbjct  312  ANGKTTAGVNEVTTKIEGFHIPK  334



>dbj|BAE46565.1| putative WD-40 repeat protein [Nicotiana glutinosa]
Length=336

 Score =   165 bits (417),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  147  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGCYITTCD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  207  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  250


 Score = 86.3 bits (212),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            +R+F+FH GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP
Sbjct  252  IRVFNFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGP  301



>ref|XP_004235719.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Solanum lycopersicum]
Length=356

 Score =   164 bits (415),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQTILSS  D  G+RLWD+R+ +VV+ L+TK  VTSAEVS+DG YITTAD
Sbjct  147  SVRTVAWLHSDQTILSSSGDAGGLRLWDVRTGKVVQILETKFPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKS+++PC VESASLEP+FG RFIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSHELPCKVESASLEPKFGNRFIAGGEDM  250


 Score = 87.0 bits (214),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH GE+ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  252  VHVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_004951509.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Setaria italica]
Length=341

 Score =   166 bits (419),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILS+CSD  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG +ITT D
Sbjct  147  SVRTVTWLHSDQTILSTCSDMGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRFITTTD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN + LVKSY+MPC VESASLEP++G +F+ GG DM
Sbjct  207  GSSVKFWDANHYGLVKSYNMPCAVESASLEPKYGNKFVTGGEDM  250


 Score = 85.5 bits (210),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD---AS  79
            VR+FDF  GE+  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQ GP  + D   A+
Sbjct  252  VRVFDFFTGEELACNKGHHGPVHCVRFSPVGESYASGSEDGTIRIWQLGPANSEDQEVAN  311

Query  78   AGPPKPXVXKDVNXEXXKLHIAK  10
            A         DV  +    HI K
Sbjct  312  ANGKTKVGVNDVARKIEGFHIPK  334



>ref|XP_003563679.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brachypodium distachyon]
Length=340

 Score =   168 bits (425),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILSSC+D  GVRLWD+RS ++V+TL+TK+ VTSAEVS+DG +ITTAD
Sbjct  147  SVRTVAWLHSDQSILSSCTDMGGVRLWDVRSGKIVQTLETKAPVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFITGGEDM  250


 Score = 82.0 bits (201),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA--  76
            V +FDF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIW   P  A D+ A  
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPANADDSEAPN  311

Query  75   --GPPKPXVXKDVNXEXXKLHIAK  10
              G PK  V  +V  +    HI+K
Sbjct  312  ANGKPKDSV-NEVARKVEGFHISK  334



>ref|XP_002451748.1| hypothetical protein SORBIDRAFT_04g007180 [Sorghum bicolor]
 gb|EES04724.1| hypothetical protein SORBIDRAFT_04g007180 [Sorghum bicolor]
Length=341

 Score =   163 bits (412),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAEVS+DG +ITT D
Sbjct  147  SVRTVTWLHSDQTILSSCADLGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRFITTTD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPC VESASLEP  G +F+ GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYNMPCAVESASLEPNCGNKFVTGGEDM  250


 Score = 86.3 bits (212),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP---NEATDAS  79
            VR+FDF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQ GP   +E   AS
Sbjct  252  VRVFDFFTGEELACNKGHHGPVHCVRFTPVGESYASGSEDGTIRIWQLGPANSDEQEAAS  311

Query  78   AGPPKPXVXKDVNXEXXKLHIAK  10
            A         DV  +    HI+K
Sbjct  312  ANGKAKVGVNDVARKIEGFHISK  334



>gb|ACG31749.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=340

 Score =   168 bits (425),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ + V+TL+TK+SVTSAEVS+DG +ITTAD
Sbjct  147  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKNVQTLETKASVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGG D+
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDL  250


 Score = 81.3 bits (199),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQ  P  A D     
Sbjct  252  VHVFDFFTGEEIACNKGHHGPVHCVRFAPCGESYASGSEDGTIRIWQLSPANADDNEVAN  311

Query  69   PKPXVXKDVNXEXXKL---HIAK  10
                    VN    K+   HI K
Sbjct  312  ANGKTTAGVNEVTTKIEGFHIPK  334



>ref|XP_006647058.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oryza brachyantha]
Length=344

 Score =   164 bits (415),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILS C+D  GVRLWD+RS ++V+TL+T + VTSAEVS+DG YI TAD
Sbjct  147  SVRTVAWLHSDQSILSCCTDMGGVRLWDVRSGKIVQTLETNAPVTSAEVSQDGRYIITAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+M CNVESASLEP++G +FIAGG DM
Sbjct  207  GSSVKFWDANYFGLVKSYNMSCNVESASLEPKYGNKFIAGGEDM  250


 Score = 84.7 bits (208),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ GP  + +  + P
Sbjct  252  VHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLGPANSDEQESPP  311

Query  69   P  67
            P
Sbjct  312  P  312



>ref|XP_006656206.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oryza brachyantha]
Length=343

 Score =   166 bits (419),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTSAEVS+D  +ITTAD
Sbjct  147  NVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTSAEVSQDSRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDM  250


 Score = 82.8 bits (203),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD  85
            V LFDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D
Sbjct  252  VHLFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADD  306



>gb|KFK35774.1| hypothetical protein AALP_AA4G034300 [Arabis alpina]
Length=345

 Score =   162 bits (409),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+ +LH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTSAEVS+DG YI TAD
Sbjct  147  SIRTLTYLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTSAEVSQDGRYIITAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKS+DMPC +ESASLEP+ G++F+AGG DM
Sbjct  207  GSTVKFWDANHFGLVKSFDMPCTIESASLEPKSGEKFVAGGEDM  250


 Score = 86.7 bits (213),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VR+FDF+ GE+ GCNKGHHGPVH VRFSP G    SGSEDGTIRIWQT P
Sbjct  252  VRVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTNP  301



>ref|XP_009388533.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   164 bits (414),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD++S ++V+TL+TKS VTSAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDMGGVRLWDVKSGKIVQTLETKSPVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F L+KSY+M C VESASLEP+ G +F+AGG DM
Sbjct  207  GSTVKFWDANHFGLIKSYNMSCTVESASLEPKDGNKFVAGGEDM  250


 Score = 84.7 bits (208),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 4/64 (6%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATD----A  82
            + +FDFH GE+  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQ  P  + D     
Sbjct  252  IHVFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQMNPAVSDDHESHG  311

Query  81   SAGP  70
            S+GP
Sbjct  312  SSGP  315



>gb|EMT09457.1| hypothetical protein F775_27621 [Aegilops tauschii]
Length=340

 Score =   165 bits (418),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLHNDQTILSSC+DT GVRLWD+RS ++V+TL+TK  VTSAEVS+DG +ITTAD
Sbjct  147  SVRTVAWLHNDQTILSSCTDTGGVRLWDVRSEKIVQTLETKGPVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDM   VESASLEP+ G +FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMSFIVESASLEPKSGSKFIAGGEDM  250


 Score = 83.2 bits (204),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P      EA D
Sbjct  252  VHVFDFLTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNVDAEEAVD  311

Query  84   ASAGPPKPXVXKDVNXEXXKLHIAKGAK  1
             + G PK    +++  +    HIAK  K
Sbjct  312  TN-GKPKAGA-EEIACKIEGFHIAKEEK  337



>ref|NP_001057997.1| Os06g0598900 [Oryza sativa Japonica Group]
 dbj|BAF19911.1| Os06g0598900 [Oryza sativa Japonica Group]
Length=342

 Score =   166 bits (419),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTSAEVS+D  +ITTAD
Sbjct  147  NVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTSAEVSQDSRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDM  250


 Score = 82.4 bits (202),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D  A
Sbjct  252  VHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEA  309



>dbj|BAD32940.1| putative WD-40 repeat protein [Oryza sativa Japonica Group]
 gb|EAZ37546.1| hypothetical protein OsJ_21874 [Oryza sativa Japonica Group]
Length=345

 Score =   165 bits (418),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTSAEVS+D  +ITTAD
Sbjct  147  NVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTSAEVSQDSRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDM  250


 Score = 82.4 bits (202),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D  A
Sbjct  252  VHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEA  309



>gb|KEH23437.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=762

 Score =   170 bits (431),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TSAEVS+DG YITTAD
Sbjct  560  SVRSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTSAEVSQDGCYITTAD  619

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFW AN + LVKSYDMPCNVESASLEP+FG +F+AGG D+
Sbjct  620  GSTVKFWYANHYGLVKSYDMPCNVESASLEPKFGNKFVAGGEDL  663


 Score = 76.6 bits (187),  Expect(2) = 9e-57, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAG  73
            V  F     +   CNKG+HGPVH VRFSPGG    SGSEDGTIRIWQTGP  A D S G
Sbjct  680  VHQFQLSPLQSMTCNKGYHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP-LAHDESEG  737



>gb|EEC80916.1| hypothetical protein OsI_23591 [Oryza sativa Indica Group]
Length=302

 Score =   164 bits (414),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS+EVS+D  +ITTAD
Sbjct  104  NVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTSSEVSQDSRFITTAD  163

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GG DM
Sbjct  164  GSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDM  207


 Score = 82.0 bits (201),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ  P  A D  A
Sbjct  209  VHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEA  266



>dbj|BAJ92707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   164 bits (414),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTSAEVS+DG +ITTAD
Sbjct  147  SVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDM C VESASLEP+ G +F  GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFFTGGEDM  250


 Score = 80.9 bits (198),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA--  76
            V ++DF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIW   P    DA A  
Sbjct  252  VHVYDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPASTDDAEAPT  311

Query  75   --GPPK-PXVXKDVNXEXXKLHIAK  10
              G PK   V  +V  +    HI+K
Sbjct  312  ANGKPKAAAVANEVARKIEGFHISK  336



>gb|EMT15935.1| hypothetical protein F775_06783 [Aegilops tauschii]
Length=367

 Score =   165 bits (418),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTSAEVS+DG +ITTAD
Sbjct  170  SVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTSAEVSQDGRFITTAD  229

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDM C VESASLEP+ G +FI GG DM
Sbjct  230  GSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGGEDM  273


 Score = 79.3 bits (194),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 4/66 (6%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA--  76
            V ++DF  GE+  CNKGHHGPVH VRF+P G    SGSEDGTIRIW   P  A DA A  
Sbjct  275  VHVYDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPANADDAEAPT  334

Query  75   --GPPK  64
              G PK
Sbjct  335  ANGKPK  340



>ref|XP_006305313.1| hypothetical protein CARUB_v10009691mg [Capsella rubella]
 gb|EOA38211.1| hypothetical protein CARUB_v10009691mg [Capsella rubella]
Length=332

 Score =   166 bits (421),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D+TILSSC+DT  +RLWD+RS ++V+TL+TK  VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDKTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANSFGLLKSYDMPCNVESASLEPKLGNSFIAGGEDM  245


 Score = 76.6 bits (187),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW  G
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>ref|XP_006416902.1| hypothetical protein EUTSA_v10008159mg [Eutrema salsugineum]
 gb|ESQ35255.1| hypothetical protein EUTSA_v10008159mg [Eutrema salsugineum]
Length=332

 Score =   164 bits (415),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  VRLWD+RS ++V+TL+TK  VTSAEVS DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDVRLWDIRSDKIVQTLETKFPVTSAEVSHDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F L+KSY+MPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANNFGLLKSYEMPCNVESASLEPKHGNTFIAGGEDM  245


 Score = 78.6 bits (192),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW+ G     +++   
Sbjct  247  VHRFDFRTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWEVGSVNHEESNLSG  306

Query  69   PKPXVXKDVNXEXXKLHIAKGA  4
                V ++V  +   L I + A
Sbjct  307  HVKLVAEEVVRKAESLRINEKA  328



>ref|XP_010497185.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   164 bits (416),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTSAEVS+DG YITTADG
Sbjct  143  IRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTSAEVSQDGRYITTADG  202

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            SSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGG DM
Sbjct  203  SSVKFWDANNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDM  245


 Score = 78.2 bits (191),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW  G     ++++  
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVGSVNHEESNSSG  306

Query  69   PKPXVXKDVNXEXXKLHIAK  10
                V ++V  +   L I++
Sbjct  307  HVKLVAEEVVRKAESLRISE  326



>ref|XP_010537963.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Tarenaya hassleriana]
Length=302

 Score =   166 bits (420),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC+VESASLEP+ G+ FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYEMPCSVESASLEPKKGETFIAGGEDM  250


 Score = 76.3 bits (186),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            V +FDF  GE+ GCNKGHHG VH VRF PGG    SGSEDGTIRIWQ
Sbjct  252  VHVFDFQTGEETGCNKGHHGAVHCVRFEPGGESYGSGSEDGTIRIWQ  298



>ref|NP_563978.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AAD39675.1|AC007591_40 Strong similarity to gb|AF096285 serine-threonine kinase receptor-associated 
protein from Mus musculus and contains 5 PF|00400 
WD40, G-beta repeat domains. EST gb|F14050 comes from 
this gene [Arabidopsis thaliana]
 gb|AAM61168.1| Similar to unr-interacting protein and contains WD40 domains 
[Arabidopsis thaliana]
 gb|AAN41335.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29327.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=333

 Score =   165 bits (418),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+RS ++V TL+TKS VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVHTLETKSPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDA  F L+KSYDMPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDAKNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDM  245


 Score = 77.0 bits (188),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-NEATDASAG  73
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW  G  N   +++  
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVGSVNHPEESNLS  306

Query  72   PPKPXVXKDVNXEXXKLHIAKGA  4
                 V ++V  +   L I++ A
Sbjct  307  GHVKLVAEEVVRKAESLRISEKA  329



>ref|XP_010537966.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Tarenaya hassleriana]
Length=259

 Score =   166 bits (419),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTSAEVSRDG YITTAD
Sbjct  104  SIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTSAEVSRDGRYITTAD  163

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC+VESASLEP+ G+ FIAGG DM
Sbjct  164  GSTVKFWDANHFGLVKSYEMPCSVESASLEPKKGETFIAGGEDM  207


 Score = 76.6 bits (187),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            V +FDF  GE+ GCNKGHHG VH VRF PGG    SGSEDGTIRIWQ
Sbjct  209  VHVFDFQTGEETGCNKGHHGAVHCVRFEPGGESYGSGSEDGTIRIWQ  255



>ref|XP_009596072.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X3 [Nicotiana tomentosiformis]
Length=363

 Score =   167 bits (423),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  136  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  195

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  196  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  239


 Score = 75.1 bits (183),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -3

Query  246  RLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            RL+  H   Q  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP  N+  D + 
Sbjct  277  RLYHLHDQRQ-ACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMTT  334



>emb|CDY55992.1| BnaA09g56870D [Brassica napus]
Length=336

 Score =   164 bits (414),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+R+ ++V+TL+TK  VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRNDKIVQTLETKFPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGGEDM  245


 Score = 78.6 bits (192),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  FDFH GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW+ 
Sbjct  247  VHRFDFHTGEEIGCNKGHHGPVHCVRYAPGGDSYTSGSEDGTVRIWEV  294



>ref|XP_010476637.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   164 bits (416),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTSAEVS+DG YITTADG
Sbjct  143  IRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTSAEVSQDGRYITTADG  202

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            SSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGG DM
Sbjct  203  SSVKFWDANNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDM  245


 Score = 77.8 bits (190),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW  G     +++   
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVGSVNHEESNLSG  306

Query  69   PKPXVXKDVNXEXXKLHIAK  10
                V ++V  +   L I++
Sbjct  307  HVKLVAEEVVRKAESLRISE  326



>ref|XP_002890105.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66364.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   165 bits (418),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+RS ++V TL+TKS VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVHTLETKSPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDA  F L+KSYDMPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDAKNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDM  245


 Score = 76.3 bits (186),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW  G
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>ref|XP_009148941.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Brassica rapa]
 emb|CDY36565.1| BnaA06g10180D [Brassica napus]
Length=335

 Score =   164 bits (416),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F L+KSY+MPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANNFGLLKSYEMPCNVESASLEPKHGNTFIAGGEDM  245


 Score = 77.4 bits (189),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  FDF  GE+ GCNKGHHGPVH VR+SPGG    SGSEDGT+RIW+ 
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYSPGGESYTSGSEDGTVRIWEV  294



>emb|CDY39650.1| BnaC05g11790D [Brassica napus]
Length=335

 Score =   164 bits (414),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F L+KSY+MPCN+ESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANNFGLLKSYEMPCNIESASLEPKHGNTFIAGGEDM  245


 Score = 77.0 bits (188),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  FDF  GE+ GCNKGHHGPVH VR+SPGG    SGSEDGT+RIW+ 
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYSPGGESYTSGSEDGTVRIWEV  294



>ref|XP_009596070.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=375

 Score =   166 bits (421),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  148  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  208  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  251


 Score = 74.3 bits (181),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -3

Query  246  RLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            RL+  H   Q  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP  N+  D + 
Sbjct  289  RLYHLHDQRQ-ACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMTT  346



>ref|XP_009117826.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brassica rapa]
Length=336

 Score =   162 bits (410),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+R+ ++V+TL+TK  VTSAEVS+DG YI+TAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRNDKIVQTLETKFPVTSAEVSQDGRYISTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGGEDM  245


 Score = 78.2 bits (191),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  FDFH GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW+ 
Sbjct  247  VHRFDFHTGEEIGCNKGHHGPVHCVRYAPGGDSYTSGSEDGTVRIWEV  294



>ref|XP_009596071.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Nicotiana tomentosiformis]
Length=374

 Score =   166 bits (420),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTSAEVS+DG YITT D
Sbjct  147  SVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTSAEVSQDGRYITTCD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGG DM
Sbjct  207  GFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDM  250


 Score = 74.3 bits (181),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -3

Query  246  RLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP--NEATDASA  76
            RL+  H   Q  CNKGHHGPVH VRF+P G    SGSEDGTIRIWQTGP  N+  D + 
Sbjct  288  RLYHLHDQRQ-ACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMTT  345



>ref|XP_010459083.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   163 bits (412),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTSAEVSRDG YITTADG
Sbjct  143  IRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTSAEVSRDGRYITTADG  202

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            SSVKFWDAN F L+KSYDMPCNVESASLEP+    FIAGG DM
Sbjct  203  SSVKFWDANNFGLLKSYDMPCNVESASLEPKHENTFIAGGEDM  245


 Score = 77.0 bits (188),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW  G     +++   
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVGSVNHEESNPSG  306

Query  69   PKPXVXKDVNXEXXKLHIAK  10
                V ++V  +   L I++
Sbjct  307  HVKLVAEEVVRKAESLRISE  326



>gb|KHG29669.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=303

 Score =   163 bits (412),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV+W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAEVS+DG YITTAD
Sbjct  147  SVRTVSWMHSDQTILSSCTDMGGVRLWDVRSGDIVKTLETKSSVTSAEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+V  WDAN F LV+ Y+MPC VESASLEP +G +FIAGG DM
Sbjct  207  GSTVNIWDANHFGLVRRYNMPCTVESASLEPIYGNKFIAGGEDM  250


 Score = 75.9 bits (185),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            VR+FDF  G++  CNKGHHGPVH VRFSP G    SGSEDGTIRIW 
Sbjct  252  VRVFDFQSGDEIACNKGHHGPVHCVRFSPKGESYASGSEDGTIRIWH  298



>emb|CDX81717.1| BnaC08g38840D [Brassica napus]
Length=336

 Score =   162 bits (411),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+T   VTSAEVS+DG YITTAD
Sbjct  142  SIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETTFPVTSAEVSQDGRYITTAD  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGG DM
Sbjct  202  GSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGGEDM  245


 Score = 75.9 bits (185),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  FDF  GE+ GCNKGHHGPVH VR++PGG    SGSEDGT+RIW+ 
Sbjct  247  VHRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWEV  294



>gb|KJB27111.1| hypothetical protein B456_004G278600 [Gossypium raimondii]
Length=303

 Score =   161 bits (407),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTV+W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+T+SSVTSAEVS+DG YI TAD
Sbjct  147  SVRTVSWMHSDQTILSSCTDMGGVRLWDVRSGKIVKTLETESSVTSAEVSQDGRYIMTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VK WDAN F LV+ Y+MPC VESASLEP +G +FIAGG DM
Sbjct  207  GSTVKIWDANHFGLVRRYNMPCTVESASLEPIYGNKFIAGGEDM  250


 Score = 75.9 bits (185),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIW  112
            VR+FDF  G++  CNKGHHGPVH VRFSP G    SGSEDGTIRIW
Sbjct  252  VRVFDFQSGDEIACNKGHHGPVHCVRFSPKGESYASGSEDGTIRIW  297



>gb|KCW68993.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=304

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS+EVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDMXGSSL*L-SXWRTNXM  209
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGG DM        +      M
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDMWVHIFDFHTGEEIGRM  266

Query  208  QQGTPWSCAXCAFLSRRRXXXFRFXRRDN*NMADWA  101
            QQG+  SC   A  +R         RR   N+ADWA
Sbjct  267  QQGSSRSCPLRAIFTRWGILRIWIRRRHYKNLADWA  302



>gb|AFK43194.1| unknown [Medicago truncatula]
Length=185

 Score =   139 bits (351),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -2

Query  502  SGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMP  323
             GVRLWD+R+ ++V+TLDTKS +TSAEVS+DG YITTADGS+VKFWDAN + LVKSYDMP
Sbjct  2    GGVRLWDVRTGKIVQTLDTKSPMTSAEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMP  61

Query  322  CNVESASLEPRFGKRFIAGGVDM  254
            CNVESASLEP+FG +F+AGG D+
Sbjct  62   CNVESASLEPKFGNKFVAGGEDL  84


 Score = 84.7 bits (208),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V +FDFH G++  CNKGHHGPVH V+FSPGG    SGSEDGTIRIWQTGP
Sbjct  86   VHVFDFHTGDEIACNKGHHGPVHCVQFSPGGESYASGSEDGTIRIWQTGP  135



>ref|XP_006427174.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
 gb|ESR40414.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
Length=268

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKSYNMPCNTESASLEPKLGNIFIAGGEDM  250



>emb|CAN67314.1| hypothetical protein VITISV_014120 [Vitis vinifera]
Length=426

 Score =   128 bits (322),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  499  GVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPC  320
            GV LWD+RS ++V+TL+T SSVTSAEVS+DG YI TADGSSVKFWDAN F LVKSY MPC
Sbjct  247  GVGLWDVRSGKIVQTLETNSSVTSAEVSQDGRYIITADGSSVKFWDANHFGLVKSYKMPC  306

Query  319  NVESASLEPRFGKRFIAGGVDM  254
             VESASLEP+ G +FIAGG DM
Sbjct  307  TVESASLEPKNGDKFIAGGEDM  328


 Score = 94.4 bits (233),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 57/89 (64%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            +RLFDFH GE+  CNKGHHGPVH VRFSPGG    SGSEDGTIRIWQTGP     NE   
Sbjct  330  IRLFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDNNEMFR  389

Query  84   ASAGPPKPXV-XKDVNXEXXKLHIAKGAK  1
            A+    K  V  ++V+ +    HIA   K
Sbjct  390  ANGLTGKVKVAAEEVSCKIEGFHIADEGK  418



>ref|XP_001756882.1| predicted protein [Physcomitrella patens]
 gb|EDQ78113.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   141 bits (355),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R   W H+DQTILSS +D  GVR+WD+R+  VVRTLDTKSS TS EVSRDG YITTADG
Sbjct  149  IRAAVWHHSDQTILSSSNDIGGVRVWDVRTKSVVRTLDTKSSCTSVEVSRDGRYITTADG  208

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            ++VKFWDAN F LVKSY MP  VESASL P  GK FIAGG DM
Sbjct  209  NTVKFWDANHFGLVKSYSMPRPVESASLFPSRGK-FIAGGDDM  250


 Score = 81.3 bits (199),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT--GPNEA  91
            VRLFDF  G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIW+T  G +EA
Sbjct  252  VRLFDFDTGDEIECNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWKTVNGNDEA  306



>gb|KCW68994.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=265

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS+EVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTSSEVSQDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGG DM
Sbjct  207  GSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDM  250



>ref|XP_008785435.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Phoenix dactylifera]
Length=322

 Score =   134 bits (336),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 75/104 (72%), Gaps = 21/104 (20%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GV                     SAEVS+DG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGV---------------------SAEVSQDGRYITTAD  185

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSY+MPC VESASLEP+FG RFIAGG D+
Sbjct  186  GSSVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGGEDL  229


 Score = 87.4 bits (215),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 53/86 (62%), Gaps = 6/86 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP-----NEATD  85
            V +FDFH GEQ  CNKGHHGPVH VRFSP G    SGSEDGTIRIWQT P     NEAT 
Sbjct  231  VHVFDFHSGEQITCNKGHHGPVHCVRFSPMGKSYASGSEDGTIRIWQTSPATADENEATG  290

Query  84   ASAGPPKPXV-XKDVNXEXXKLHIAK  10
            A+    K  V   +   +    HI+K
Sbjct  291  ANGAAGKVKVGANEAARKIEGFHISK  316



>gb|KDO52916.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=268

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDM  250



>ref|XP_006465395.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Citrus sinensis]
Length=268

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHGDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDM  250



>gb|KDO52917.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=264

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTSAEVSRDG YITTAD
Sbjct  147  SIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTSAEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGG DM
Sbjct  207  GSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDM  250



>ref|XP_008385958.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=274

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS+EVS+DG YITTAD
Sbjct  148  SVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTSSEVSQDGRYITTAD  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGG DM
Sbjct  208  GSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDM  251



>ref|XP_001777192.1| predicted protein [Physcomitrella patens]
 gb|EDQ57972.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   135 bits (340),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R   W H+DQTILSS +D  G+R+WD+R+  VVRTLDTKSS TS EVSRDG YITTA G
Sbjct  149  IRAAVWHHSDQTILSSSNDIGGLRVWDVRTKSVVRTLDTKSSCTSVEVSRDGRYITTAHG  208

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            ++V FWDAN F LVKSY MP  VESASL P  GK FIAGG DM
Sbjct  209  NTVNFWDANHFGLVKSYTMPRPVESASLFPSKGK-FIAGGDDM  250


 Score = 83.2 bits (204),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT--GPNEA-----  91
            VRLFDF  G++  CNKGHHGPVH VRFSPGG    SGSEDGTIRIW+T  G  EA     
Sbjct  252  VRLFDFDTGDEIECNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWKTVNGSQEAEVGGL  311

Query  90   TDASAGPPKPXVXKDVNXEXXKLHIAK  10
             +A+AG        +V  +    HIA+
Sbjct  312  AEAAAGNQIKVRVDEVARKVQGFHIAQ  338



>ref|XP_002977277.1| hypothetical protein SELMODRAFT_151778 [Selaginella moellendorffii]
 gb|EFJ21886.1| hypothetical protein SELMODRAFT_151778 [Selaginella moellendorffii]
Length=342

 Score =   134 bits (337),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++R+  W H+DQTILSSC+DT  VRLWD+R+   VR L+TKS  TS EVSRDG YITTAD
Sbjct  147  TIRSAVWHHSDQTILSSCNDTGSVRLWDVRTKTTVRQLETKSPCTSVEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+SVKFWDAN F +VKS+ M   +ESASL P  GK F+AGG DM
Sbjct  207  GNSVKFWDANHFGMVKSFTMARPMESASLYPALGK-FVAGGDDM  249


 Score = 81.3 bits (199),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            VR+FDF+ GE+  C KGHHGPVH VRFSPGG    SGSEDGTIRIWQT
Sbjct  251  VRVFDFYTGEEIECCKGHHGPVHCVRFSPGGESFASGSEDGTIRIWQT  298



>ref|XP_002992164.1| hypothetical protein SELMODRAFT_186588 [Selaginella moellendorffii]
 gb|EFJ06819.1| hypothetical protein SELMODRAFT_186588 [Selaginella moellendorffii]
Length=342

 Score =   134 bits (337),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++R+  W H+DQTILSSC+DT  VRLWD+R+   VR L+TKS  TS EVSRDG YITTAD
Sbjct  147  TIRSAVWHHSDQTILSSCNDTGSVRLWDVRTKTTVRQLETKSPCTSVEVSRDGRYITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+SVKFWDAN F +VKS+ M   +ESASL P  GK F+AGG DM
Sbjct  207  GNSVKFWDANHFGMVKSFTMARPMESASLYPALGK-FVAGGDDM  249


 Score = 81.3 bits (199),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            VR+FDF+ GE+  C KGHHGPVH VRFSPGG    SGSEDGTIRIWQT
Sbjct  251  VRVFDFYTGEEIECCKGHHGPVHCVRFSPGGESFASGSEDGTIRIWQT  298



>gb|EMS49047.1| Serine-threonine kinase receptor-associated protein [Triticum 
urartu]
Length=320

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTSAEVS+DG +ITTAD
Sbjct  125  SVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTSAEVSQDGRFITTAD  184

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDM C VESASLEP+ G +FI GG DM
Sbjct  185  GSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGGEDM  228


 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 63/125 (50%), Gaps = 11/125 (9%)
 Frame = -3

Query  369  FGMQINLDW*RAMTCPAMLNLLH*NQGSEKGSLPEG*TXGVRLFDFHXGEQXGCNKGHHG  190
            FG+  + D    M+C      L    GS+   +  G    V ++DF  GE+  CNKGHHG
Sbjct  196  FGLVKSYD----MSCTVESASLEPKSGSK--FITGGEDMWVHVYDFFTGEEIACNKGHHG  249

Query  189  PVHXVRFSPGGXXXXSGSEDGTIRIWQTGPN-----EATDASAGPPKPXVXKDVNXEXXK  25
            PVH VRF+P G    SGSEDGTIRIW   P      EA +A+  P    V  +V  +   
Sbjct  250  PVHCVRFAPVGESYASGSEDGTIRIWPLNPANTEDPEAPNANGKPKAAAVANEVARKIEG  309

Query  24   LHIAK  10
             HI K
Sbjct  310  FHITK  314



>dbj|BAJ97958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92033.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            SVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTSAEVS+DG +ITTAD
Sbjct  147  SVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTSAEVSQDGRFITTAD  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSVKFWDAN F LVKSYDM C VESASLEP+ G +FI GG DM
Sbjct  207  GSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGGEDM  250


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 64/125 (51%), Gaps = 11/125 (9%)
 Frame = -3

Query  369  FGMQINLDW*RAMTCPAMLNLLH*NQGSEKGSLPEG*TXGVRLFDFHXGEQXGCNKGHHG  190
            FG+  + D    M+C      L    GS+   +  G    V ++DF  GE+  CNKGHHG
Sbjct  218  FGLVKSYD----MSCTVESASLEPKSGSK--FITGGEDMWVHVYDFFTGEEIACNKGHHG  271

Query  189  PVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA----GPPK-PXVXKDVNXEXXK  25
            PVH VRF+P G    SGSEDGTIRIW   P    DA A    G PK   V  +V  +   
Sbjct  272  PVHCVRFAPVGESYASGSEDGTIRIWPLNPASTDDAEAPTANGKPKAAAVANEVARKIEG  331

Query  24   LHIAK  10
             HI+K
Sbjct  332  FHISK  336



>gb|ABR25578.1| serine-threonine kinase receptor-associated protein [Oryza sativa 
Indica Group]
Length=167

 Score =   122 bits (307),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  478  RSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASL  299
            RS ++ +TL+TK++VTSAEVS+DG YI TADGSSVKFWDAN F LVKSY+MPCNVESASL
Sbjct  1    RSGKIAQTLETKATVTSAEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMPCNVESASL  60

Query  298  EPRFGKRFIAGGVDM  254
            EP++G +FIAGG DM
Sbjct  61   EPKYGNKFIAGGEDM  75


 Score = 84.0 bits (206),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGP  70
            V +FDF  GE+  CNKGHHGPVH VRF+PGG    SGSEDGTIRIWQ GP   +D    P
Sbjct  77   VHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLGP-ATSDEQESP  135

Query  69   PKPXVXKDVN  40
            P       VN
Sbjct  136  PNANGKLKVN  145



>ref|XP_005650326.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25782.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   105 bits (263),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R  AW  ND  +L+S +D  G+ +WD+R+  +V+TL T   VTS E+S+DG YIT+ADG
Sbjct  147  IRCAAWHQNDALLLTSYTDQPGIGVWDIRTAGLVKTLATGKEVTSIEISQDGRYITSADG  206

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V+FWD  +   +K +  P +VESAS  P  G RF+AGG DM
Sbjct  207  TEVRFWDGERLEPIKVFSQPYSVESASFCPEKG-RFVAGGGDM  248


 Score = 73.9 bits (180),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -3

Query  243  LFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAGPPK  64
            L D+  G +  CN+GHHGPVH +RF+PGG    SGSEDGTIRIW+T     T+    P  
Sbjct  252  LHDYETGAELECNRGHHGPVHTIRFAPGGDSYASGSEDGTIRIWETDYALKTENGEAPAA  311

Query  63   PXV  55
            P V
Sbjct  312  PAV  314



>ref|XP_007023909.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY26531.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=157

 Score =   128 bits (321),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  490  LWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVE  311
            LWDLRS ++V+TL+TKS VTSAEVS+DG +ITTADGS+VKFWDAN F LVKSY MPC+VE
Sbjct  2    LWDLRSGKIVQTLETKSPVTSAEVSQDGRHITTADGSNVKFWDANHFALVKSYYMPCSVE  61

Query  310  SASLEPRFGKRFIAGGVDM  254
            SASLEP+ G +FIAGG DM
Sbjct  62   SASLEPKHGNKFIAGGEDM  80


 Score = 47.0 bits (110),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 34/63 (54%), Gaps = 2/63 (3%)
 Frame = -3

Query  249  VRLFDFHXGEQ-XGCNKGHHGPV-HXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASA  76
            V +FDFH GE+     +G    V   V  SPGG    SGSEDGTIRIWQTG        +
Sbjct  82   VHVFDFHTGEEIVRLQQGSPCMVLSTVCSSPGGESYASGSEDGTIRIWQTGSGNHEKNDS  141

Query  75   GPP  67
             PP
Sbjct  142  VPP  144



>ref|XP_003081517.1| WD40 repeat protein (ISS) [Ostreococcus tauri]
Length=627

 Score =   105 bits (261),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S++T +++HND+ ILSSC++  G+R+WD+R+  VV TL T+S V S EVS DG ++TTAD
Sbjct  471  SIKTASFIHNDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMSIEVSADGKHMTTAD  530

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G  V FWD   F  ++ + M   VESAS+  +  ++F+AGG DM
Sbjct  531  GKDVTFWDLQNFSKIQKWTMEYEVESASVSLKH-RKFVAGGPDM  573


 Score = 65.9 bits (159),  Expect(2) = 7e-34, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V L D   G +   NKGHHGPVH VRF+P      SGSEDGTIRIWQT
Sbjct  575  VHLHDMETGAEEQTNKGHHGPVHNVRFAPDQNSYCSGSEDGTIRIWQT  622



>emb|CEF99303.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=299

 Score =   105 bits (261),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S++T +++HND+ ILSSC++  G+R+WD+R+  VV TL T+S V S EVS DG ++TTAD
Sbjct  143  SIKTASFIHNDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMSIEVSADGKHMTTAD  202

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G  V FWD   F  ++ + M   VESAS+  +  ++F+AGG DM
Sbjct  203  GKDVTFWDLQNFSKIQKWTMEYEVESASVSLKH-RKFVAGGPDM  245


 Score = 64.3 bits (155),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V L D   G +   NKGHHGPVH VRF+P      SGSEDGTIRIWQT
Sbjct  247  VHLHDMETGAEEQTNKGHHGPVHNVRFAPDQNSYCSGSEDGTIRIWQT  294



>ref|XP_001419915.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98208.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=299

 Score = 99.8 bits (247),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++T +++ ND+ ILSSC++  G+R+WD+R+  VV TL T+S V S EVS DG  +TTADG
Sbjct  144  IKTASFIANDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMSIEVSADGKNMTTADG  203

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
              V FWD   F  V+ + M   VESAS+  +  K+F+AGG DM
Sbjct  204  KDVTFWDLQNFSKVQKWTMEYEVESASVSLKH-KKFVAGGPDM  245


 Score = 64.3 bits (155),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V L D   G +   NKGHHGPVH VRF+P      SGSEDGTIRIWQT
Sbjct  247  VHLHDMETGAEEQTNKGHHGPVHCVRFAPDQNSYCSGSEDGTIRIWQT  294



>ref|XP_007510202.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18547.1| predicted protein [Bathycoccus prasinos]
Length=323

 Score = 99.4 bits (246),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++T  ++ ND+ ILSSCSD   +R+WD R+  +  TL T+++VTS E+S DG YITTADG
Sbjct  167  IKTARYICNDELILSSCSDNPDLRVWDARTGIIATTLKTENAVTSIEISEDGKYITTADG  226

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
             +V  WD   FR ++++ M  N+ESAS+  + GK F+ GG DM
Sbjct  227  KNVTLWDVGSFRPMETWKMKYNMESASVCMKEGK-FVCGGEDM  268


 Score = 60.5 bits (145),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -3

Query  249  VRLFDFHXGEQXGC-NKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V + D   GE+ G   KGHHGPVH VRF+P G    SGSEDGTIRIWQT
Sbjct  270  VHVHDCASGEEIGEPGKGHHGPVHCVRFAPDGKSYSSGSEDGTIRIWQT  318



>ref|XP_003055628.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=302

 Score = 99.8 bits (247),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +RT  +   D  I+SSC+D  G+R+WD+R+  VV TL T + VTS E++ +G YITTADG
Sbjct  143  IRTAQFTAEDTLIVSSCADDPGIRVWDVRTNTVVTTLGTDTPVTSIEITENGRYITTADG  202

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
             +V F+DA  F  VK + MP  VESAS+  +  +RF+AGG DM
Sbjct  203  KNVTFFDAMTFTPVKKWTMPYEVESASVCVKH-ERFVAGGTDM  244


 Score = 59.3 bits (142),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  204  KGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            KGHHGPVH VRF+P G    SGSEDGTIRIW+T P
Sbjct  263  KGHHGPVHSVRFAPDGESYSSGSEDGTIRIWRTFP  297



>ref|XP_006385489.1| hypothetical protein POPTR_0003s05820g [Populus trichocarpa]
 gb|ERP63286.1| hypothetical protein POPTR_0003s05820g [Populus trichocarpa]
Length=298

 Score = 87.4 bits (215),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            + +FDFH GEQ GCNKGHHGPVH +RFSPGG    SGSEDGTIRIWQ GP
Sbjct  200  IHVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  249


 Score = 70.9 bits (172),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 47/104 (45%), Gaps = 52/104 (50%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+RTVAWLH+DQTILSSC+D  GV                                    
Sbjct  147  SIRTVAWLHSDQTILSSCTDIGGV------------------------------------  170

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
                            SYDMPCNVESASLEP+ G +F+AGG DM
Sbjct  171  ----------------SYDMPCNVESASLEPKLGNKFVAGGEDM  198



>ref|XP_002503507.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64765.1| predicted protein [Micromonas sp. RCC299]
Length=300

 Score = 89.0 bits (219),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 1/103 (1%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +RT  +   D  I+SSC+D  G+R+WD+R+  +V TL T S VTS E++ DG YITTADG
Sbjct  146  IRTAQFTAEDTLIMSSCADDKGIRVWDVRTNTIVTTLGTDSPVTSIEITDDGRYITTADG  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
             +V F+DA  F  V    M   VESAS+  +    F+AGG DM
Sbjct  206  KTVTFFDAMTFTPVWKRTMGYEVESASVCIK-NDVFVAGGTDM  247


 Score = 66.2 bits (160),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  225  GEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            GE+  C KGHHGPVH VRF+P G    SGSEDGTIRIW+T P
Sbjct  257  GEEVDCGKGHHGPVHSVRFAPDGKSYASGSEDGTIRIWRTLP  298



>ref|XP_005849411.1| hypothetical protein CHLNCDRAFT_143924 [Chlorella variabilis]
 gb|EFN57309.1| hypothetical protein CHLNCDRAFT_143924 [Chlorella variabilis]
Length=337

 Score = 83.2 bits (204),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 2/105 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++R   W+ ++Q +L S  D   V +WD+R  EV R+L ++ +VTS EV+  G YI TAD
Sbjct  158  NIRVTHWIGDNQLLLVSYLDKPNVDVWDVRMGEVARSLGSQGTVTSIEVTPCGRYIVTAD  217

Query  385  GSSVKFWDANQFRLVKSYDMPC-NVESASLEPRFGKRFIAGGVDM  254
            G  V F DA  F LVKS+      VESAS  P  G RF+ GG DM
Sbjct  218  GKQVDFRDAASFDLVKSHACEGYEVESASFAPERG-RFVTGGSDM  261


 Score = 70.1 bits (170),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            VRL DF  G++    KGHHGPVH VRF+PGG    SGSEDGTIRIW+T
Sbjct  263  VRLHDFETGQELEVCKGHHGPVHNVRFAPGGATYASGSEDGTIRIWRT  310



>ref|XP_001691265.1| hypothetical protein CHLREDRAFT_128295 [Chlamydomonas reinhardtii]
 gb|EDP04998.1| predicted protein [Chlamydomonas reinhardtii]
Length=307

 Score = 85.9 bits (211),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R+V ++ ND TI+ S  D  G+ ++D+RS + V+T+DT + VTS E+S D  +ITTA+G
Sbjct  146  IRSVNFIQNDNTIICSYVDKPGLGVYDVRSLQHVQTIDTSAPVTSIEISFDQQHITTAEG  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKR-FIAGGVDM  254
            S V+ ++      VKS+ MP   ESASL   + KR F+AGG DM
Sbjct  206  SHVRVFEVGSLNQVKSHRMPAPAESASL--CWAKRKFVAGGEDM  247


 Score = 58.2 bits (139),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIW  112
            V L+D    ++   NKGHHGPVH +R++P      SGSEDGTIRIW
Sbjct  249  VHLYDLDTCQELEVNKGHHGPVHAIRWAPTYDAYASGSEDGTIRIW  294



>gb|AFK49343.1| unknown [Lotus japonicus]
Length=131

 Score = 87.0 bits (214),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP---NEATDAS  79
            VR+FDFH G +  CNKGHHGPVH VRF PGG    SGSEDGTIRIW+TGP   +E+ D S
Sbjct  33   VRVFDFHTGNEIACNKGHHGPVHCVRFFPGGESYASGSEDGTIRIWRTGPLTHDESEDLS  92

Query  78   AGPPKPXV---XKDVNXEXXKLHIAKGAK  1
            A      V     +V+ +    HIA   K
Sbjct  93   ANGSIDKVKVTADEVSRKIEGFHIADEGK  121


 Score = 56.6 bits (135),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  346  LVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            +V+SYDMPC VESASLEP++G +F+AGG DM
Sbjct  1    MVRSYDMPCTVESASLEPKYGNKFVAGGEDM  31



>gb|ESA22835.1| hypothetical protein GLOINDRAFT_342473 [Rhizophagus irregularis 
DAOM 181602]
Length=334

 Score = 71.2 bits (173),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++++V W      ILS+  D   +R+WD+R+ + + T  T+  +TS E+S +G YIT+  
Sbjct  154  TIKSVIWDGERNVILSAGDDKE-IRVWDVRNFDQINTFKTEHPITSMELSANGKYITSTA  212

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGG  263
            G  V F DA+ +++ KS     +V S SL P   KRF+AGG
Sbjct  213  GKVVHFLDASTYQVFKSVPTAYDVSSVSLHPDH-KRFVAGG  252


 Score = 68.9 bits (167),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEA  91
            VR++DF  G++    KGHHGP+H V +SP G    +GSEDGTIR+WQT P ++
Sbjct  258  VRIYDFESGKELEVYKGHHGPIHTVSYSPDGEIYATGSEDGTIRLWQTTPGKS  310



>ref|XP_637742.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q54LT8.1|STRAP_DICDI RecName: Full=Serine-threonine kinase receptor-associated protein; 
AltName: Full=WD40 repeat-containing protein strap [Dictyostelium 
discoideum]
 gb|EAL64253.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=293

 Score = 80.1 bits (196),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 63/105 (60%), Gaps = 4/105 (4%)
 Frame = -2

Query  565  SVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTA  389
            +++T  W +HND  +LS   D   +R+WDLRS   V +L  KSS+TS E S+D  ++ T 
Sbjct  142  TIKTATWSVHNDDIVLSGGLDEV-IRIWDLRSGTQV-SLCAKSSITSMEFSKDRRFLVTT  199

Query  388  DGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
             G+ V FWDA  F  +K Y +P +V  ASL P    +FIAGG D 
Sbjct  200  AGNEVTFWDAQSFYPLKVYSLPFDVNCASLHPD-NSKFIAGGSDF  243


 Score = 59.7 bits (143),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            V ++DF  G +   NKGHHGPV+  RFSP G    SGS DGTIR+W+
Sbjct  245  VHVYDFSTGNEIEVNKGHHGPVNCCRFSPDGASFASGSLDGTIRLWK  291



>gb|ACO09706.1| Serine-threonine kinase receptor-associated protein [Osmerus 
mordax]
Length=344

 Score = 75.9 bits (185),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND+ ILS+  D + VRLWD  S E VRTL    SV+S E   DG  +    
Sbjct  159  AIKKALWCNNDKQILSAADDKT-VRLWDRNSTEAVRTLSFDMSVSSMEYIPDGEVLVITY  217

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ D P ++ SASL P   + F+AGG D 
Sbjct  218  GKTIAFYNALSLDLIKTVDAPASIHSASLHPD-KEFFVAGGDDF  260


 Score = 62.4 bits (150),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  265  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  310



>gb|KFH62158.1| hypothetical protein MVEG_11797 [Mortierella verticillata NRRL 
6337]
Length=320

 Score = 68.9 bits (167),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V W      ILSS  D   +R+WD R+   V +      + S E+S DG YIT+  G
Sbjct  153  IRNVVWDGARNMILSSGDDME-IRVWDPRTFNQVHSCKMDGPIASMELSADGQYITSTTG  211

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGG  263
             SV FWDA  + L K      +V + SL P    RF+AGG
Sbjct  212  KSVYFWDAQTYTLRKQIKTEYDVSAVSLHPNH-TRFVAGG  250


 Score = 68.2 bits (165),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            VR++DF  G +    KGHHGPVH V +SP G    +GSEDGTIR+WQT P
Sbjct  256  VRIYDFESGRELEVYKGHHGPVHTVSYSPDGELYATGSEDGTIRLWQTTP  305



>ref|XP_004564827.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X4 [Maylandia zebra]
 ref|XP_005730245.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pundamilia nyererei]
 ref|XP_005940646.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Haplochromis burtoni]
 ref|XP_006808414.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Neolamprologus brichardi]
 ref|XP_006808415.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Neolamprologus brichardi]
Length=329

 Score = 74.3 bits (181),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSMEYVADGQILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGGDDF  246


 Score = 62.0 bits (149),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>gb|EXX68237.1| Tif34p [Rhizophagus irregularis DAOM 197198w]
Length=308

 Score = 71.2 bits (173),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++++V W      ILS+  D   +R+WD+R+ + + T  T+  +TS E+S +G YIT+  
Sbjct  154  TIKSVIWDGERNVILSAGDDKE-IRVWDVRNFDQINTFKTEHPITSMELSANGKYITSTA  212

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGG  263
            G  V F DA+ +++ KS     +V S SL P   KRF+AGG
Sbjct  213  GKVVHFLDASTYQVFKSVPTAYDVSSVSLHPDH-KRFVAGG  252


 Score = 64.7 bits (156),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            VR++DF  G++    KGHHGP+H V +SP G    +GSEDGTIR+WQ
Sbjct  258  VRIYDFESGKELEVYKGHHGPIHTVSYSPDGEIYATGSEDGTIRLWQ  304



>ref|NP_956598.1| serine-threonine kinase receptor-associated protein [Danio rerio]
 gb|AAH49525.1| Serine/threonine kinase receptor associated protein [Danio rerio]
 gb|AAH65428.1| Serine/threonine kinase receptor associated protein [Danio rerio]
Length=329

 Score = 75.5 bits (184),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +NDQ ILS+  D + +RLWD  + E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDQQILSAADDKT-IRLWDKNTNEAVKTLSFDASVSSMEYIPDGETLVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A+   L+K+ D P ++ SASL P     F+AGG D 
Sbjct  204  GRTIAFYNAHSLDLIKTVDAPASIHSASLHPD-KDFFVAGGDDF  246


 Score = 60.8 bits (146),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +D+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  YDYTTKEEMESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_008314236.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cynoglossus semilaevis]
Length=329

 Score = 73.2 bits (178),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W ++D+ ILS+  D + +RLWD  S EVV+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNDDKQILSAAEDKT-IRLWDRNSTEVVKTLTFDASVSSMEYMADGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIKAVEAPAPISSASLHPE-KDFFVAGGEDF  246


 Score = 62.4 bits (150),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_007577214.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Poecilia formosa]
Length=329

 Score = 72.8 bits (177),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND  ILS+  D + VRLWD RS E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKSLWCNNDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSSMEYLADGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIKTVEAPAPINSASLHPE-KDFFVAGGDDF  246


 Score = 62.4 bits (150),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_005454109.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oreochromis niloticus]
Length=350

 Score = 72.4 bits (176),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +NDQ ILS+  D + +RLWD  S + V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDQQILSAADDKT-IRLWDRSSMQEVKTLTFDTSVSSMEYVADGQILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    ++K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLEMIKTVEAPAPINSASLHPE-KDFFVAGGDDF  246


 Score = 62.4 bits (150),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_010740062.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Larimichthys crocea]
Length=329

 Score = 71.6 bits (174),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND+ ILS+  D + +RLWD  S + V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWYNNDKQILSAAEDKT-IRLWDRSSMQEVKTLTFDTSVSSMEYMTDGDILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+KS + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIKSVEAPAPINSASLHPE-KDFFVAGGDDF  246


 Score = 62.0 bits (149),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSNKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>gb|AAK01368.1| serine-threonine kinase receptor-associated protein [Carassius 
gibelio]
Length=329

 Score = 73.6 bits (179),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +NDQ ILS+  D + VRLWD  + E V+T    +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDQQILSAADDKT-VRLWDKNTKEAVKTPSFDASVSSMEYIPDGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F+ A+   L+K+ D P ++ SASL P     F+AGG D 
Sbjct  204  GRTIAFYKAHSLDLIKTVDAPASIHSASLHPE-KDFFVAGGDDF  246


 Score = 60.5 bits (145),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +D+   E+    KGH GP+H VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  YDYTTKEEMESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_008399465.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Poecilia reticulata]
Length=329

 Score = 71.2 bits (173),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND  ILS+  D + VRLWD RS E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKSLWCNNDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSSMEYLADGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L++  + P ++ SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIQMVEAPASINSASLHPE-KDFFVAGGDDF  246


 Score = 62.4 bits (150),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>gb|KFM64458.1| Serine-threonine kinase receptor-associated protein, partial 
[Stegodyphus mimosarum]
Length=333

 Score = 73.2 bits (178),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +V+   +L +++ I+S+  D S VR WDL S E ++ L+ ++   + E+S +G+ +    
Sbjct  146  AVKKALFLQDEKRIVSAADDKS-VRFWDLTSHEEIKKLEFETQPNNLELSLNGNILVIPH  204

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G SV FWD N F  +K+Y +P  V SASL P     F+ GG D 
Sbjct  205  GHSVSFWDVNNFEKLKTYSVPSQVNSASLHPD-QSVFVCGGDDF  247


 Score = 60.5 bits (145),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FDF  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  252  FDFETGMELESFKGHFGPVHCVQFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_003402993.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombus terrestris]
Length=330

 Score = 72.8 bits (177),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V + +ND T L +C D   +R+WD +S + VR LD  +   S EVSRDG+ ITT   
Sbjct  147  IRHVTFFNND-TALITCGDDKTLRVWDRKSGQEVRRLDFPAIPNSMEVSRDGNIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW++ +   ++ Y  P  + SASL P     F+ GG D+
Sbjct  206  NIVTFWNSRELTKLREYTAPTQMNSASLHPDC-SIFVCGGEDL  247


 Score = 60.5 bits (145),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYATGTEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_003487985.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombus impatiens]
Length=330

 Score = 72.8 bits (177),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V + +ND T L +C D   +R+WD +S + VR LD  +   S EVSRDG+ ITT   
Sbjct  147  IRHVTFFNND-TALITCGDDKTLRVWDRKSGQEVRRLDFPAIPNSMEVSRDGNIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW++ +   ++ Y  P  + SASL P     F+ GG D+
Sbjct  206  NIVTFWNSRELTKLREYTAPTQMNSASLHPDC-SIFVCGGEDL  247


 Score = 60.5 bits (145),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYATGTEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_005805514.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Xiphophorus maculatus]
Length=333

 Score = 70.9 bits (172),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W ++D  ILS+  D + VRLWD RS E V+TL   +SV+S E   DG  +    
Sbjct  149  AIKKSLWCNDDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSSMEYLADGEILVITY  207

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  208  GKTIAFYNALSLDLIKTVEAPAPINSASLHPE-KDFFVAGGDDF  250


 Score = 62.0 bits (149),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  255  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  300



>ref|XP_006633224.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Lepisosteus oculatus]
Length=329

 Score = 71.2 bits (173),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W ++D  ILS+  D + VRLWD  S EVV+TL    SV+S E   +G  +    
Sbjct  145  AIKKALWCNDDTQILSAADDKT-VRLWDRNSMEVVKTLSFDISVSSMEYIPEGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ D P ++ SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIKTVDTPASINSASLHPE-KDFFVAGGDDF  246


 Score = 61.6 bits (148),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +D++  E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  YDYNTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_002949849.1| hypothetical protein VOLCADRAFT_80852 [Volvox carteri f. nagariensis]
 gb|EFJ48952.1| hypothetical protein VOLCADRAFT_80852 [Volvox carteri f. nagariensis]
Length=305

 Score = 67.0 bits (162),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
             +R+V ++ ND  ++ S  D  G+ ++DLRS ++ +T++T +SVTS EVS D  ++TTA+
Sbjct  145  GIRSVNFIQNDNLVICSYVDKPGIGVYDLRSQQLSQTVETTTSVTSIEVSFDQQHVTTAE  204

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS V+F++A   + VK + +    ESAS      ++F+AGG DM
Sbjct  205  GSHVRFFEAATLQQVKQHKLSAPAESASY-CAVKRKFVAGGEDM  247


 Score = 65.5 bits (158),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIW  112
            V L+D+  G++  CNKGHHGPVH +R++P      SGSEDGTIRIW
Sbjct  249  VHLYDYDTGQELECNKGHHGPVHTIRWAPTYDAYASGSEDGTIRIW  294



>emb|CDQ67406.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ64442.1| unnamed protein product [Oncorhynchus mykiss]
Length=331

 Score = 71.6 bits (174),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND  ILS+  D + VRLWD  S EVV+ L    SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDTQILSAADDKT-VRLWDRNSTEVVKQLSFDMSVSSMEYIPDGEVLVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    ++K+ D P ++ SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDMIKTVDAPASIHSASLHPD-KDFFVAGGDDF  246


 Score = 60.8 bits (146),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYGTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_004082930.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Oryzias latipes]
Length=329

 Score = 71.2 bits (173),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W ++D+ ILS+  D + +RLWD  S E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNDDKQILSAADDKT-IRLWDRTSMEEVKTLTFNTSVSSMEYMADGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLELIKTAEAPAPINSASLHPE-KDFFVAGGEDF  246


 Score = 61.2 bits (147),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYGTQEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|NP_001279558.1| serine/threonine kinase receptor associated protein [Callorhinchus 
milii]
 gb|AFK10801.1| serine/threonine kinase receptor associated protein [Callorhinchus 
milii]
 gb|AFM85457.1| serine-threonine kinase receptor associated protein [Callorhinchus 
milii]
Length=329

 Score = 68.9 bits (167),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W + D+ ILS+  D + +RLWD  S   V++++  +SV+S E    G  +    
Sbjct  145  AIKKACWCNGDKQILSAADDKT-IRLWDRESMTEVKSINFGTSVSSMEYIPKGEMLILTH  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+KS+D P ++ SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLELIKSFDAPASINSASLHPE-KDCFVAGGDDF  246


 Score = 63.2 bits (152),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ GE     KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  251  FDYNTGEDLESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  295



>gb|EFA79493.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=315

 Score = 72.4 bits (176),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = -2

Query  562  VRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++T  W ++ND  ILS  +D   +R+ DLRS   +  L  K+ ++S E S+D  Y+ T  
Sbjct  143  IKTAMWSVYNDDVILSGGNDEV-IRIMDLRSGTQM-ALCAKAPISSMEFSKDKQYLVTTA  200

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+ V FW+A  F  VK Y +P  V  ASL P    RFIAGG D 
Sbjct  201  GNEVTFWNAQNFHPVKVYSLPFEVICASLHPD-NSRFIAGGSDF  243


 Score = 59.7 bits (143),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIW  112
            V ++DF+ G +   NKGHHGPV+  R+SP G    SGS DGTIRIW
Sbjct  245  VHVYDFNTGNEIEVNKGHHGPVNCCRYSPDGESFASGSVDGTIRIW  290



>ref|XP_008288513.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Stegastes partitus]
Length=329

 Score = 69.7 bits (169),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND+ ILS+ +D   +RLW+  S E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDKQILSA-ADDKTIRLWNRSSMEEVKTLTFDTSVSSMEYVADGEIVVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLELIKTVEAPAPINSASLHPD-KDFFVAGGEDF  246


 Score = 62.0 bits (149),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_008288505.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Stegastes partitus]
Length=357

 Score = 69.7 bits (169),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND+ ILS+  D   +RLW+  S E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDKQILSAADD-KTIRLWNRSSMEEVKTLTFDTSVSSMEYVADGEIVVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLELIKTVEAPAPINSASLHPD-KDFFVAGGEDF  246


 Score = 62.0 bits (149),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_004564826.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X3 [Maylandia zebra]
Length=343

 Score = 74.3 bits (181),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSMEYVADGQILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ + P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGGDDF  246


 Score = 57.0 bits (136),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  204  KGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  277  KGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  310



>ref|XP_010773038.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Notothenia coriiceps]
Length=329

 Score = 69.7 bits (169),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND+ ILS+  D + +RLWD  S E V+ L   ++V+S E   DG  +    
Sbjct  145  AIKKALWCNNDKQILSAADDKT-IRLWDRSSMEEVKQLKFDTAVSSMEYLADGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ D P  + SASL P     F+AGG D 
Sbjct  204  GKTIGFYNALSLDLIKTVDAPAPINSASLHPD-KDFFVAGGEDF  246


 Score = 60.8 bits (146),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYGTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_010882092.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Esox lucius]
Length=329

 Score = 70.1 bits (170),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND+ ILS+  D + VRLWD  S EVV++L  ++SV+S E   +   +    
Sbjct  145  AIKKALWCNNDKHILSAADDRT-VRLWDRSSAEVVKSLSFEASVSSMEYMPEEEILVVTY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ D P ++ SASL P     F+AGG D 
Sbjct  204  GKTISFFNALSLDLIKTVDAPASIHSASLHPD-KDFFVAGGDDF  246


 Score = 60.5 bits (145),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  251  YDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|XP_003972671.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Takifugu rubripes]
Length=329

 Score = 68.6 bits (166),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W + D+ ILS+  D + +RLWD  S E V+ L   +SV+S E   DG  +    
Sbjct  145  AIKKALWCNGDKHILSAAEDKT-IRLWDRCSMEEVKRLSFDTSVSSMEYVADGEVLVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+KS D P  + SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIKSVDAPAPINSASLHPE-KDFFVAGGEDF  246


 Score = 61.6 bits (148),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            FD+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  FDYSNKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>gb|KDR13003.1| Serine-threonine kinase receptor-associated protein [Zootermopsis 
nevadensis]
Length=370

 Score = 69.3 bits (168),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +   D T L +C+D   +R+WD  S + V+ LD  +  +S EV+RDG  +T   G
Sbjct  190  IRHVIFFRGD-THLVTCADDRTLRVWDRTSGQEVQKLDFSAIPSSLEVARDGSTLTVTHG  248

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FWDA   + ++ + +P  V SASL P     F+ GG D+
Sbjct  249  NVVSFWDAQSLKKIREFTVPTQVNSASLHPD-KTIFVCGGEDL  290


 Score = 60.5 bits (145),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  295  FDYTTGTEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  339



>ref|XP_010885258.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Esox lucius]
Length=331

 Score = 69.3 bits (168),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND  ILS+  D + VRLWD  S  VV+ L    SV+S E   DG  +    
Sbjct  145  AIKKALWCNNDTQILSAADDKT-VRLWDRTSTAVVKQLSFDMSVSSMEYIPDGEVLVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++ F++A    L+K+ D P ++ SASL P     F+AGG D 
Sbjct  204  GKTIAFYNALSLDLIKTVDAPASIHSASLHPD-KDFFVAGGDDF  246


 Score = 60.8 bits (146),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D+   E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  251  YDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|NP_001090526.1| serine/threonine kinase receptor associated protein [Xenopus 
laevis]
 gb|AAH97832.1| Strap protein [Xenopus laevis]
Length=273

 Score = 65.5 bits (158),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +DF  GE+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  195  YDFTTGEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  240


 Score = 64.7 bits (156),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND  ILS+  D + VRLWD  S   V+TL   +SV+S E   +G  +    
Sbjct  89   AIKKALWYNNDNQILSAADDKT-VRLWDRVSMTEVKTLQFGASVSSMEYIPEGEALLITY  147

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEP  293
            G ++  +D++   L+KS++ P  + SASL P
Sbjct  148  GRTIALYDSSSLELIKSFEAPAPINSASLHP  178



>ref|XP_011335793.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cerapachys biroi]
 gb|EZA56461.1| Serine-threonine kinase receptor-associated protein [Cerapachys 
biroi]
Length=330

 Score = 68.6 bits (166),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +  N+  +++ C+D   +R+WD  S + ++ LD  +  +S EVS+DG  ITT   
Sbjct  147  IRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEIKRLDFPAIPSSMEVSKDGSIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FWD+ +   +K +  P  V SASL P     F+ GG D 
Sbjct  206  NIVTFWDSKELTKIKEFAAPTQVNSASLHPDC-TMFVCGGEDF  247


 Score = 61.2 bits (147),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_006006111.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Latimeria chalumnae]
Length=329

 Score = 68.2 bits (165),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W + D+ ILS+  D + VRLWD ++   V+TL+  +SV+S E    G  +    
Sbjct  145  AIKKALWCNGDEQILSAADDKT-VRLWDRKTMTEVKTLNFGTSVSSMEYIPGGEILVITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G  + F+ A    L+KS+D P  + S SL P     F+AGG D 
Sbjct  204  GKVIAFYHAQSLDLIKSFDAPAPINSTSLHPE-KDFFVAGGDDF  246


 Score = 61.6 bits (148),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++  E+    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  251  YDYNTSEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|XP_396504.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis mellifera]
 ref|XP_003691084.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis florea]
 ref|XP_006613623.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis dorsata]
Length=330

 Score = 68.9 bits (167),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V + +N+ T L +C D   +R+WD  S + V+ LD  +   S EVSRDG+ ITT   
Sbjct  147  IRHVTFFNNN-TALITCGDDKTLRVWDRNSGQEVKRLDFPAIPNSMEVSRDGNIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW++ +   ++ Y  P  + SASL P     F+ GG D+
Sbjct  206  NIVTFWNSRELTKLREYTAPTQMNSASLHPDC-SIFVCGGEDL  247


 Score = 60.5 bits (145),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYTTGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_001959831.1| GF11838 [Drosophila ananassae]
 gb|EDV36653.1| GF11838 [Drosophila ananassae]
Length=328

 Score = 69.3 bits (168),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S++   +   D+ I+S+  D + VRLWD  +   V+ L   ++  S E+SRD H +T A 
Sbjct  148  SIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFPNNPNSLEISRDNHILTIAH  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSSV FW+ +  + +K   +P NV SASL P     F+ GG D 
Sbjct  207  GSSVSFWEIDTMKKLKEVKVPTNVSSASLHPD-KHVFVCGGEDF  249


 Score = 60.1 bits (144),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FDF  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  254  FDFITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  298



>ref|XP_011052618.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Acromyrmex echinatior]
 gb|EGI66547.1| Serine-threonine kinase receptor-associated protein [Acromyrmex 
echinatior]
Length=330

 Score = 67.8 bits (164),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S EVS+DG+ ITT   
Sbjct  147  IRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSSMEVSKDGNIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW++ +   +K + +P  V SASL P     F+ GG D 
Sbjct  206  NIVTFWNSKELTKIKEFMVPTQVNSASLHPDC-TIFVCGGEDF  247


 Score = 61.2 bits (147),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_005179104.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Musca domestica]
Length=327

 Score = 70.5 bits (171),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   +  ND+ I+S+  D + VRLWD  S   V+ L   ++  S E+S D H +T A 
Sbjct  147  AIKQALFCRNDKCIISAAEDKT-VRLWDRLSGNEVQRLTFPNNPNSLEISADNHILTVAH  205

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+S+ FWD    + +K   +P NV SASL P     F+ GG D 
Sbjct  206  GTSISFWDVESLKKLKEVKVPTNVSSASLHPD-KHVFVCGGEDF  248


 Score = 58.5 bits (140),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  253  FDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  297



>ref|XP_005179105.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Musca domestica]
Length=289

 Score = 70.1 bits (170),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   +  ND+ I+S+  D + VRLWD  S   V+ L   ++  S E+S D H +T A 
Sbjct  109  AIKQALFCRNDKCIISAAEDKT-VRLWDRLSGNEVQRLTFPNNPNSLEISADNHILTVAH  167

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+S+ FWD    + +K   +P NV SASL P     F+ GG D 
Sbjct  168  GTSISFWDVESLKKLKEVKVPTNVSSASLHPD-KHVFVCGGEDF  210


 Score = 58.9 bits (141),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  215  FDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  259



>gb|KIZ04267.1| serine-threonine kinase receptor-associated protein [Monoraphidium 
neglectum]
Length=294

 Score = 94.0 bits (232),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
             +R V W+H D  +L++  DT G+ +WD+RS  +V+TL T++ VTS E++ DG ++TT D
Sbjct  149  GIRNVVWVHGDSLVLTTQQDTPGLDVWDVRSGSIVQTLATEAPVTSVELTFDGRFLTTTD  208

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++++FWD    R  K +     VE+AS  P  G RF  GG DM
Sbjct  209  GATIRFWDVGALREAKQHKAAYPVEAASYCPAKG-RFACGGGDM  251


 Score = 35.0 bits (79),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXS  142
            V L  +  G +    KGHHGPVH +RF P G    S
Sbjct  253  VHLHSYDDGSELEVCKGHHGPVHTIRFGPEGKEYAS  288



>ref|XP_011150584.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Harpegnathos saltator]
 gb|EFN77156.1| Serine-threonine kinase receptor-associated protein [Harpegnathos 
saltator]
Length=330

 Score = 68.2 bits (165),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S EVS+DG  ITT   
Sbjct  147  IRHVTFFDNNSALVT-CADDKTLRVWDRNSGQEVKRLDFPAIPSSMEVSKDGKIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW++ +   +K + +P  V SASL P     F+ GG D+
Sbjct  206  NIVTFWNSKELTKIKEFTVPTQVNSASLHPDC-SIFVCGGEDL  247


 Score = 60.5 bits (145),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYSTGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_001361095.1| GA17804 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002018243.1| GL17603 [Drosophila persimilis]
 gb|EAL25671.1| GA17804 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW36082.1| GL17603 [Drosophila persimilis]
Length=328

 Score = 68.9 bits (167),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   +  +D+ I+S+  D + VRLWD  +   V+ L   S   S E+SRD H +T A 
Sbjct  148  AIKRALFCRDDKCIVSAAEDKT-VRLWDRMTGIEVQRLQFNSHPNSLEISRDNHILTIAH  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSS+ FW+ +  + +K   +P NV SASL P     F+ GG D 
Sbjct  207  GSSISFWEVDTLKKLKEVKVPTNVASASLHPD-KHVFVCGGEDF  249


 Score = 59.7 bits (143),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 12/69 (17%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG------------PN  97
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT             PN
Sbjct  254  FDYITGNEIESFKGHFGPVHAVKFSPDGELYASGSEDGTLRLWQTTVGKTYGLWKCTEPN  313

Query  96   EATDASAGP  70
            E  ++ + P
Sbjct  314  ELNNSMSSP  322



>ref|XP_011396442.1| Serine-threonine kinase receptor-associated protein [Auxenochlorella 
protothecoides]
 gb|KFM23568.1| Serine-threonine kinase receptor-associated protein [Auxenochlorella 
protothecoides]
Length=322

 Score = 72.0 bits (175),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 2/105 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+R  AW+H+++ +L S SD   + + D R+  VV+TL+T   VTS +V+  G +I TAD
Sbjct  149  SIRGAAWIHDNKAMLISYSDKPNLDVLDTRTLSVVKTLETAGPVTSIDVTDCGRFIVTAD  208

Query  385  GSSVKFWDANQFRLVKSY-DMPCNVESASLEPRFGKRFIAGGVDM  254
            GS V   D   F + +++     +VE+A+  P  GK  +AGG DM
Sbjct  209  GSQVLIHDGTDFAVKRTFRPSGYSVEAAAYAPDRGK-LVAGGSDM  252


 Score = 56.2 bits (134),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  204  KGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +GHHGPVH VRF+PG     SGSEDGT+RIWQT
Sbjct  268  RGHHGPVHGVRFAPGHATFASGSEDGTLRIWQT  300



>ref|XP_003705564.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Megachile rotundata]
Length=330

 Score = 68.2 bits (165),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V + +N+ T L +C+D   +R+WD+ S + V+ L+  +   S E+S+DG+ ITT   
Sbjct  147  IRHVTFFNNN-TALITCADDKTLRVWDINSGQEVKRLNFPAIPNSMELSKDGNIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FWD+ +   +  Y  P  + SASL P     F+ GG D+
Sbjct  206  NIVTFWDSKELTKLHEYTAPTQMNSASLHPDC-SIFVCGGEDL  247


 Score = 60.1 bits (144),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYITGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_004360523.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG22672.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
Length=334

 Score = 76.3 bits (186),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (59%), Gaps = 4/104 (4%)
 Frame = -2

Query  562  VRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++   W ++ND  +LS  +D   +R+WDLRS +   T+  K+ ++S E S+D   + T  
Sbjct  143  IKCALWSVYNDDCVLSGGADEV-IRIWDLRS-QNKMTICAKAPISSMEFSKDKKLLLTTA  200

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+ V FWDA  F  VK Y +P +V  ASL P  G RFIAGG D 
Sbjct  201  GNEVTFWDAQSFHPVKVYSLPYDVHCASLHPD-GSRFIAGGSDF  243


 Score = 52.0 bits (123),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            V ++D   G +   NKGHHGPV+  R+S  G    SGS DGTIRIW 
Sbjct  245  VHVYDSATGNEIEVNKGHHGPVNCCRYSSDGESFASGSVDGTIRIWN  291



>gb|EKC40117.1| Serine-threonine kinase receptor-associated protein [Crassostrea 
gigas]
Length=198

 Score = 64.3 bits (155),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++R   + H D+ I+S+ SD   VR+WD  S   ++ L+     +S E+S+DG  +    
Sbjct  18   NIRAAIFAHFDKQIISA-SDDKTVRIWDAVSGSEIKKLEFPGIPSSLELSKDGRVLVITH  76

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+   FW+A+++  +K Y  P  V SASL     K F+ GG D 
Sbjct  77   GNCTSFWNADRYEKIKDYIAPTQVNSASLHEN-KKVFVCGGEDF  119


 Score = 63.5 bits (153),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  GE+    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  124  FDYETGEELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  168



>ref|XP_011434029.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Crassostrea gigas]
Length=208

 Score = 64.3 bits (155),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++R   + H D+ I+S+ SD   VR+WD  S   ++ L+     +S E+S+DG  +    
Sbjct  28   NIRAAIFAHFDKQIISA-SDDKTVRIWDAVSGSEIKKLEFPGIPSSLELSKDGRVLVITH  86

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+   FW+A+++  +K Y  P  V SASL     K F+ GG D 
Sbjct  87   GNCTSFWNADRYEKIKDYIAPTQVNSASLHEN-KKVFVCGGEDF  129


 Score = 63.5 bits (153),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  GE+    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  134  FDYETGEELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  178



>ref|XP_008544371.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Microplitis demolitor]
Length=330

 Score = 67.4 bits (163),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 1/95 (1%)
 Frame = -2

Query  538  NDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDA  359
            ND  ++ SC+D   +R+WD  + + VR +D  +  +S EVS+DG  ITT   ++V FW++
Sbjct  154  NDNKLIVSCADDKTLRVWDRSNGQEVRRIDFPALPSSMEVSKDGKIITTTHSNTVSFWNS  213

Query  358  NQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
                 ++ Y +P  V S SL P     F+ GG D+
Sbjct  214  LDLTKIREYTIPTQVNSVSLHPDC-SIFVCGGEDL  247


 Score = 60.5 bits (145),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYSTGVEMESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_001624518.1| predicted protein [Nematostella vectensis]
 gb|EDO32418.1| predicted protein, partial [Nematostella vectensis]
Length=213

 Score = 68.6 bits (166),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S++T  W + +  ++ S  D   +RLWD R+ E  R +    ++T+ ++SRDG+ +    
Sbjct  51   SIKTALW-NKENNMVYSGGDDKMIRLWDTRTLENTRNIQLPHNLTNMDMSRDGNVLVITH  109

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++V F++     ++KS++MP  V  ASL P     F+AGG D+
Sbjct  110  GTTVVFYETESMDVIKSFEMPTLVYGASLHPD-KSCFVAGGEDL  152


 Score = 58.9 bits (141),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQ  109
            FD+  G++    KGH GPVH VR+SP G    SGSEDGT+R+WQ
Sbjct  157  FDYDTGKELESYKGHFGPVHCVRYSPDGELYASGSEDGTLRLWQ  200



>ref|XP_002732021.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Saccoglossus kowalevskii]
Length=326

 Score = 64.3 bits (155),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+R   W    +TI+S+  D + VR+WD+ S   +  +D  SS  + +++ DG  +    
Sbjct  146  SIRDALWCQKGKTIISAAEDKT-VRMWDVASNREIMKIDLDSSNLNLDINNDGSILVITH  204

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G S+ F+  +    +KSY+ P  V SASL P     F+AGG D 
Sbjct  205  GKSISFYKTDSLEKLKSYEAPTPVYSASLHPE-KLCFVAGGEDF  247


 Score = 63.2 bits (152),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G++    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYETGQELESYKGHFGPVHCVRFSPDGELYSSGSEDGTLRLWQT  296



>ref|NP_001087814.1| serine/threonine kinase receptor associated protein [Xenopus 
laevis]
 gb|AAH81265.1| MGC86380 protein [Xenopus laevis]
Length=329

 Score = 63.9 bits (154),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +DF  GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT 
Sbjct  251  YDFTTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTA  296


 Score = 62.8 bits (151),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +N+  ILS+ SD   VRLWD  S   V+TL    SV+S E   +G  +    
Sbjct  145  AIKKALWYNNNTQILSA-SDDRTVRLWDRVSMTEVKTLQFGVSVSSMEYIPEGEALLITY  203

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++  +D++   L+KS++ P ++ SASL P   +  +AGG D 
Sbjct  204  GRTIALYDSSSLELIKSFEAPASINSASLHPD-KECIVAGGDDF  246



>ref|XP_005761541.1| hypothetical protein EMIHUDRAFT_428205 [Emiliania huxleyi CCMP1516]
 gb|EOD09112.1| hypothetical protein EMIHUDRAFT_428205 [Emiliania huxleyi CCMP1516]
Length=322

 Score = 63.5 bits (153),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            V+   ++ + QT+LS+  D + +RLWDLR+    R ++   SV S E++ DG  +T A G
Sbjct  147  VKVCHFIGDRQTLLSAGEDKT-MRLWDLRTGSTQREIEFSGSVNSVELTADGRIMTVAAG  205

Query  382  SSVKFWDANQFRLVKSYDMPC------NVESASLEPRFGKRFIAGG  263
            + V FWD   ++ +K + +         V SASL P   K F+AGG
Sbjct  206  TEVSFWDLTSWQCLKRFSLGVIAANGYGVNSASLHPNR-KAFVAGG  250


 Score = 63.2 bits (152),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = -3

Query  237  DFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNE  94
            DF  GE+  CNKGHHGPV+ VRF+P G    S  +DGTIR W   P E
Sbjct  259  DFETGEELACNKGHHGPVYGVRFTPDGKAYASAGDDGTIRFWNFAPPE  306



>ref|NP_001120495.1| serine/threonine kinase receptor associated protein [Xenopus 
(Silurana) tropicalis]
 gb|AAI61374.1| LOC100145616 protein [Xenopus (Silurana) tropicalis]
Length=327

 Score = 64.3 bits (155),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTG  103
            +DF  GE+    KGH GPVH VRFSP G    SGSEDGT+R+WQT 
Sbjct  249  YDFTTGEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  294


 Score = 62.4 bits (150),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W +ND  ILS+ SD   VRLWD  S   V+TL    SV+S E   +G  +    
Sbjct  143  AIKKALWYNNDNQILSA-SDDKTVRLWDRVSMTEVKTLQFGVSVSSMEYIPEGEALLITY  201

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G ++  ++A    L+KS++ P  + SASL P   +  +AGG D 
Sbjct  202  GRTIALYNALSLDLIKSFEAPAPINSASLHPD-KECIVAGGDDF  244



>ref|XP_002074661.1| GK23046 [Drosophila willistoni]
 gb|EDW85647.1| GK23046 [Drosophila willistoni]
Length=328

 Score = 67.8 bits (164),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   +   D+ I+S+  D + VRLWD  +   V+ L   ++  S E+SRD H +T A 
Sbjct  148  AIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFPNNPNSLEISRDNHVLTIAH  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSS+ FW+ +  + +K   +P NV SASL P     F+ GG D 
Sbjct  207  GSSISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGGEDF  249


 Score = 58.9 bits (141),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  254  FDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  298



>ref|XP_011263567.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Camponotus floridanus]
 gb|EFN63377.1| Serine-threonine kinase receptor-associated protein [Camponotus 
floridanus]
Length=329

 Score = 64.7 bits (156),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
             +R V +  N+  +++ C+D   +R+WD  S + ++ LD  +  +S EVS+DG  ITT  
Sbjct  146  GIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEIKRLDFPAIPSSMEVSKDGSIITTTH  204

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEP  293
             + V FW++ +   +K + +P  V SASL P
Sbjct  205  SNIVTFWNSKELTKIKEFTVPTQVNSASLHP  235


 Score = 61.2 bits (147),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_008473381.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Diaphorina citri]
Length=360

 Score = 67.4 bits (163),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 2/105 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
             ++ V +  N+ T L SC++   VRLWD+ +   V+ L+  +   S E+SRDG  IT   
Sbjct  171  GIKHVQFFKNN-TRLISCAEDKTVRLWDVSASAEVQKLEFGAVPNSLEISRDGTTITVTH  229

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKR-FIAGGVDM  254
            GS V F DAN   L+K + +P  V SASL     +  F+ GG D+
Sbjct  230  GSCVTFLDANSLELIKEHKVPAQVHSASLLLNSERPIFVCGGEDL  274


 Score = 58.5 bits (140),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GP+H V+FSP G    SGSEDGT+R+WQT
Sbjct  279  FDYSTGAEIESFKGHFGPIHCVKFSPDGELYASGSEDGTLRLWQT  323



>ref|XP_011498271.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Ceratosolen solmsi marchali]
Length=330

 Score = 73.9 bits (180),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V++  ND T+L SC++   +R+WD  + + +R LD +S   S EVS+DG  ITT   
Sbjct  147  LRHVSFYEND-TLLVSCAEDKTMRVWDRHNGKEIRNLDFQSVPRSMEVSKDGSIITTTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FWD+ +   ++ + +P  V SASL P     FI GG D+
Sbjct  206  NIVTFWDSKELTKLREFTVPTQVNSASLHPD-NSVFICGGEDL  247


 Score = 52.0 bits (123),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD   G +    KGH GP+H V FSP G    S SEDGT+R+WQT
Sbjct  252  FDCSTGVEIESLKGHFGPIHCVCFSPDGELYASCSEDGTLRLWQT  296



>ref|XP_007060631.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Chelonia mydas]
Length=274

 Score = 64.3 bits (155),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  174  YDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  218


 Score = 61.2 bits (147),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W  +D+ ILS+  D   VRLWD  +   V+ ++   SV+S E   +G  +    G
Sbjct  70   IKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKAINVAMSVSSMEYVPEGEILVITYG  127

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             ++ F  A     +KS+D P  V SASL P   K F +AGG D 
Sbjct  128  RTIAFHSAETLEQIKSFDAPATVNSASLHPE--KEFLVAGGEDF  169



>ref|XP_969569.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Tribolium castaneum]
 gb|EFA09026.1| hypothetical protein TcasGA2_TC006736 [Tribolium castaneum]
Length=327

 Score = 65.9 bits (159),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +  ND T L SC+D   +R+WD  S + V+ +D  S   S EVSRDG  +T    
Sbjct  147  IRHVIFFRND-THLVSCADDKTLRVWDRSSGKEVQKMDFPSIPNSLEVSRDGTVLTVTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V F D+     ++ + +P  V SASL P     F+AGG D+
Sbjct  206  NHVTFLDSESLNKIREFSVPTTVNSASLHPD-KTIFVAGGDDL  247


 Score = 59.3 bits (142),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  249  VYKFDYTTGNEIESFKGHFGPVHCVKFSPDGELYASGSEDGTLRLWQT  296



>gb|EMP35054.1| Serine-threonine kinase receptor-associated protein, partial 
[Chelonia mydas]
Length=246

 Score = 64.3 bits (155),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  168  YDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  212


 Score = 61.2 bits (147),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W  +D+ ILS+  D   VRLWD  +   V+ ++   SV+S E   +G  +    G
Sbjct  64   IKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKAINVAMSVSSMEYVPEGEILVITYG  121

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             ++ F  A     +KS+D P  V SASL P   K F +AGG D 
Sbjct  122  RTIAFHSAETLEQIKSFDAPATVNSASLHPE--KEFLVAGGEDF  163



>ref|XP_001986592.1| GH20440 [Drosophila grimshawi]
 gb|EDW01459.1| GH20440 [Drosophila grimshawi]
Length=328

 Score = 66.2 bits (160),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   +  +D+ I+S+  D + VRLWD  +   V+ L  +++  S E+SRD H +T   
Sbjct  148  AIKRALFCRDDKCIISAADDKT-VRLWDRMTGIEVQRLQFQNNPNSLEISRDNHVLTITH  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GS++ FW+ +  + +K   +P NV SASL P     F+ GG D 
Sbjct  207  GSTISFWEVDTLKKLKEVKVPTNVASASLHPD-KHVFVCGGEDF  249


 Score = 58.9 bits (141),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  254  FDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  298



>ref|XP_011156221.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Solenopsis invicta]
Length=329

 Score = 63.9 bits (154),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S EVS+DG+ I T   
Sbjct  147  IRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSSMEVSKDGNIIITTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FWD+ +   +K   +P  V S SL P     F+ GG D 
Sbjct  206  NIVTFWDSKELTKIKECTVPTQVNSTSLHPDC-TIFVCGGEDF  247


 Score = 61.2 bits (147),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>gb|EFZ20290.1| hypothetical protein SINV_00798 [Solenopsis invicta]
Length=328

 Score = 63.9 bits (154),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S EVS+DG+ I T   
Sbjct  147  IRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSSMEVSKDGNIIITTHS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FWD+ +   +K   +P  V S SL P     F+ GG D 
Sbjct  206  NIVTFWDSKELTKIKECTVPTQVNSTSLHPDC-TIFVCGGEDF  247


 Score = 61.2 bits (147),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_001976425.1| GG20020 [Drosophila erecta]
 ref|XP_002092635.1| GE11556 [Drosophila yakuba]
 gb|EDV56825.1| GG20020 [Drosophila erecta]
 gb|EDW92347.1| GE11556 [Drosophila yakuba]
Length=328

 Score = 65.9 bits (159),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S++   +   D+ I+S+  D + VRLWD  +   V+ L   S+  S E+S D H +T + 
Sbjct  148  SIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFNSNPNSLEISSDNHILTISH  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSS+ FW+ +  + +K   +P NV SASL P     F+ GG D 
Sbjct  207  GSSISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGGEDF  249


 Score = 58.9 bits (141),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  254  FDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  298



>dbj|GAM26537.1| hypothetical protein SAMD00019534_097120 [Acytostelium subglobosum 
LB1]
Length=291

 Score = 66.2 bits (160),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 4/104 (4%)
 Frame = -2

Query  562  VRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            ++   W  +ND  +LS   D   +R+ DLR+   +  L  K+ ++S E S+D  Y+ T  
Sbjct  143  IKAAMWSAYNDDVVLSGGGDEI-IRIMDLRAGTHM-ALCAKAPISSMEFSKDKKYLITTA  200

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+ + FWDA  F  +K Y +P  V  ASL P    +FIAGG D 
Sbjct  201  GAEITFWDAATFHPLKVYSLPFEVNCASLHPD-NSKFIAGGSDF  243


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIW  112
            V ++DF+ G +   NKGHHGPV+  R+SP G    SGS DGTIRIW
Sbjct  245  VHVYDFNTGHEIEVNKGHHGPVNCCRYSPDGQSFASGSVDGTIRIW  290



>gb|EPQ08116.1| Serine-threonine kinase receptor-associated protein [Myotis brandtii]
Length=309

 Score = 63.5 bits (153),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  209  YDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  253


 Score = 61.2 bits (147),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S E   +G  +    G
Sbjct  105  IKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSSMEYIPEGEILVITYG  162

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             S+ F  A    L+KS++ P  + SASL P   K F +AGG D 
Sbjct  163  RSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDF  204



>ref|XP_004932595.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombyx mori]
Length=277

 Score = 63.2 bits (152),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 61/104 (59%), Gaps = 3/104 (3%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+R   +L+N + +  S SD + +R+WD  S E V+ ++ +S   S E+SRDG  +T A 
Sbjct  100  SIRHAVFLNNSRIV--SVSDDNTMRVWDRNSGEEVQKVEFQSVPNSLELSRDGAILTVAH  157

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++V F+ ++  R ++ + +P    SASL P     F+ GG D+
Sbjct  158  GTNVSFYTSDTMRKLREFPVPTKCYSASLAPSRAT-FVCGGDDL  200


 Score = 61.6 bits (148),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEA  91
            V  +D++ G +   N+GH GPVH VR+SP G    SGSEDGT+R+WQ  P  A
Sbjct  202  VYKYDYNTGTELESNRGHFGPVHCVRWSPDGELYASGSEDGTVRLWQAVPGRA  254



>ref|XP_005866835.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis brandtii]
Length=350

 Score = 63.5 bits (153),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  250  YDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294


 Score = 61.2 bits (147),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S E   +G  +    G
Sbjct  146  IKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSSMEYIPEGEILVITYG  203

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             S+ F  A    L+KS++ P  + SASL P   K F +AGG D 
Sbjct  204  RSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDF  245



>ref|XP_006084353.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis lucifugus]
Length=350

 Score = 63.2 bits (152),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  250  YDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294


 Score = 61.2 bits (147),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S E   +G  +    G
Sbjct  146  IKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSSMEYIPEGEILVITYG  203

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             S+ F  A    L+KS++ P  + SASL P   K F +AGG D 
Sbjct  204  RSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDF  245



>ref|XP_005287566.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Chrysemys picta bellii]
Length=350

 Score = 63.5 bits (153),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  250  YDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294


 Score = 60.8 bits (146),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W  +D+ ILS+  D   VRLWD  +   V+ ++   SV+S E   +G  +    G
Sbjct  146  IKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKAINVAMSVSSMEYVPEGEILVITYG  203

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             ++ F  A     +KS+D P  V SASL P   K F +AGG D 
Sbjct  204  RTIAFHSAETLEQIKSFDAPATVNSASLHPE--KEFLVAGGEDF  245



>ref|XP_002898038.1| WD domain-containing protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY64535.1| WD domain-containing protein, putative [Phytophthora infestans 
T30-4]
Length=341

 Score = 67.8 bits (164),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGPNEATDASAG  73
            VR+FDF  GE    +KGHHGPV  +R+SP G    +GSEDGTIRIWQ     A   S  
Sbjct  276  VRVFDFKTGELLETHKGHHGPVRCLRYSPSGDSFATGSEDGTIRIWQNDSKSAAATSVA  334


 Score = 57.0 bits (136),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 6/94 (6%)
 Frame = -2

Query  523  LSSCSDTSG-VRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDA-NQF  350
            L++  +  G V +WDL +    R L   + V   E SRDG  +T A G  V F+D  N F
Sbjct  181  LAATGEVDGTVTIWDLHAYTQTRQLKVDADVMDMEASRDGQVLTVAAGKQVYFYDVKNDF  240

Query  349  RLVKSYDMPCNVE---SASLEPRFGKRFIAGGVD  257
             L+ S+ MP +      ASL P   K F+AGG D
Sbjct  241  ALLNSFPMPISFAEEGGASLHPTESK-FVAGGSD  273



>gb|EFX76037.1| hypothetical protein DAPPUDRAFT_306319 [Daphnia pulex]
Length=331

 Score = 65.1 bits (157),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R +A+L   + I+S C+D   VR W+  + + +  +D  S     EVS D   +T A G
Sbjct  150  LRHIAFLGKGEKIVS-CADDRTVRFWERSTGKEIHRIDFTSIPNGIEVSNDDSILTVASG  208

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            ++V FW+   F  +K Y +P  V SASL P     F+ GG D 
Sbjct  209  NTVSFWNTTSFEKIKEYQVPSQVHSASLHPS-RSVFVCGGEDF  250


 Score = 59.3 bits (142),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
             D+  G++    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  255  MDYSNGQEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  299



>ref|XP_003294375.1| WD40 repeat-containing protein [Dictyostelium purpureum]
 gb|EGC29100.1| WD40 repeat-containing protein [Dictyostelium purpureum]
Length=283

 Score = 71.2 bits (173),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   W   +  I+ S      +R+WDLRS   + +L  KSS++S E S+D  Y+ T  
Sbjct  134  TIKKATWSAFNSDIVLSGGLDEVIRIWDLRSGTQI-SLCAKSSISSMEFSKDKKYLVTTA  192

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G+ V FWDA+ F  +K Y +P  V  ASL P    +FIAGG D 
Sbjct  193  GNEVTFWDAHSFYPLKVYSLPFEVNCASLSPD-NSKFIAGGSDF  235


 Score = 52.8 bits (125),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIW  112
            V  +DF  G +   +KGHHGPV+   F+P G    SGS DGTIR+W
Sbjct  237  VHSYDFETGNELEVSKGHHGPVNCCSFAPNGSSFASGSVDGTIRVW  282



>ref|XP_001950349.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Acyrthosiphon pisum]
Length=325

 Score = 62.4 bits (150),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++ V +  ND+ ++S C+D   VR+WD  S + +  ++  +  TS EVSRD   +T A G
Sbjct  147  IKHVMFFQNDRRLIS-CADDKTVRIWDPLSGKEIHKMEFSAIPTSLEVSRDESIVTIAHG  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW+A     V    +P  V +ASL  R    F+ GG D+
Sbjct  206  NCVSFWNAESLSKVNEVTVPTLVNTASLH-RDKTMFVCGGEDL  247


 Score = 61.6 bits (148),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD++ G++    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYNTGKEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|NP_611804.1| wing morphogenesis defect, isoform A [Drosophila melanogaster]
 ref|NP_001097436.1| wing morphogenesis defect, isoform B [Drosophila melanogaster]
 ref|XP_002040104.1| GM15531 [Drosophila sechellia]
 gb|AAF47023.1| wing morphogenesis defect, isoform A [Drosophila melanogaster]
 gb|AAL28548.1| HL01517p [Drosophila melanogaster]
 gb|ABV53896.1| wing morphogenesis defect, isoform B [Drosophila melanogaster]
 gb|EDW56969.1| GM15531 [Drosophila sechellia]
 gb|ACL83966.1| wmd-PA, partial [synthetic construct]
 gb|ACL89061.1| wmd-PA [synthetic construct]
Length=328

 Score = 65.1 bits (157),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            +++   +   D+ I+S+  D + VRLWD  +   V+ L   S+  S E+S D H +T + 
Sbjct  148  AIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFNSNPNSLEISSDNHILTISH  206

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            GSS+ FW+ +  + +K   +P NV SASL P     F+ GG D 
Sbjct  207  GSSISFWEIDTLKKLKEVKVPTNVASASLHPD-KHVFVCGGEDF  249


 Score = 58.9 bits (141),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH V+FSP G    SGSEDGT+R+WQT
Sbjct  254  FDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  298



>gb|EHJ68792.1| putative serine-threonine kinase receptor-associated protein 
[Danaus plexippus]
Length=323

 Score = 62.0 bits (149),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 58/104 (56%), Gaps = 3/104 (3%)
 Frame = -2

Query  565  SVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTAD  386
            S+R   +LHN + +  S SD   +R+WD  S + V  ++  +   S E+SRDG  +T A 
Sbjct  147  SIRHAVFLHNSRIV--SVSDDLTMRVWDRTSGQEVHKIEFPTIPNSLELSRDGAVLTVAH  204

Query  385  GSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            G++V F+ ++  R ++ + +P    SASL P     F+ GG D+
Sbjct  205  GTNVSFYSSDTMRKMREFPVPTKCYSASLAPSRAT-FVCGGEDL  247


 Score = 62.0 bits (149),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQTGP  100
            V  FD++ G +   NKGH GPVH VR+SP G    +GSEDGT+R+WQ  P
Sbjct  249  VYKFDYNTGTELESNKGHFGPVHCVRWSPDGELYATGSEDGTVRLWQAVP  298



>ref|XP_010212611.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Tinamus guttatus]
Length=309

 Score = 63.9 bits (154),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  209  YDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  253


 Score = 59.7 bits (143),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 3/103 (3%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W  +D+ ILS+  D   VRLWD  +   V+ L+   SV+S E   +G  +    G
Sbjct  105  IKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKALNVAMSVSSMEYVPEGQILVITYG  162

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
             ++ F  A     +KS++ P  + SASL P+  +  +AGG D 
Sbjct  163  KTIAFHSAETLEQIKSFEAPATINSASLHPQ-KECLVAGGEDF  204



>gb|KGL77017.1| Serine-threonine kinase receptor-associated protein, partial 
[Tinamus guttatus]
Length=314

 Score = 63.9 bits (154),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  213  YDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  257


 Score = 59.7 bits (143),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 3/103 (3%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W  +D+ ILS+  D   VRLWD  +   V+ L+   SV+S E   +G  +    G
Sbjct  109  IKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKALNVAMSVSSMEYVPEGQILVITYG  166

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
             ++ F  A     +KS++ P  + SASL P+  +  +AGG D 
Sbjct  167  KTIAFHSAETLEQIKSFEAPATINSASLHPQ-KECLVAGGEDF  208



>gb|ENN71163.1| hypothetical protein YQE_12093, partial [Dendroctonus ponderosae]
Length=325

 Score = 65.5 bits (158),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            +R + +  ND T L SC+D   +R+WD  + + +  +    S  S EVS+DG  +T A  
Sbjct  147  IRHILFFRND-THLVSCADDKTLRVWDRSNKQEIHKVSFPFSPNSLEVSKDGSVLTVAYS  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V F+DA     ++ Y +P  V SASL P     F+AGG D+
Sbjct  206  NKVAFYDAETLNKIREYTIPSPVNSASLHPD-KSIFVAGGDDL  247


 Score = 58.2 bits (139),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  249  VRLFDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            V  +D+  G +    KGH GP+H ++FSP G    SGSEDGT+R+WQT
Sbjct  249  VYKYDYQNGTEIESFKGHFGPIHCIKFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_006773325.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis davidii]
Length=350

 Score = 63.5 bits (153),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            +D++ GE+    KGH GP+H VRFSP G    SGSEDGT+R+WQT
Sbjct  250  YDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294


 Score = 60.1 bits (144),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 5/104 (5%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++   W   D+ ILS+  D   VRLWD  +   +++L    SV+S E   +G  +    G
Sbjct  146  IKKALWCSEDKQILSA--DDKTVRLWDHATMTELKSLSFNMSVSSMEYIPEGEILVITYG  203

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGVDM  254
             S+ F  A    L+KS++ P  + SASL P   K F +AGG D 
Sbjct  204  RSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDF  245



>ref|XP_011301387.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Fopius arisanus]
Length=330

 Score = 63.5 bits (153),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = -2

Query  562  VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADG  383
            ++ V +  +D++++S C+D   +R+WD  S    R LD  +  +S EVS+DG  ITT   
Sbjct  147  IKHVTFFDHDKSLVS-CADDKTLRVWDRSSGLETRRLDFPAIPSSMEVSKDGSIITTTHA  205

Query  382  SSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGVDM  254
            + V FW+++    ++ + +P  V S SL P     F+ GG D+
Sbjct  206  NIVTFWNSHDLTKIREFTIPTQVNSVSLHPD-RTMFVCGGEDL  247


 Score = 60.1 bits (144),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  240  FDFHXGEQXGCNKGHHGPVHXVRFSPGGXXXXSGSEDGTIRIWQT  106
            FD+  G +    KGH GPVH VRFSP G    SGSEDGT+R+WQT
Sbjct  252  FDYTSGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920