BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026A11

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                261   1e-77   Nicotiana tomentosiformis
gb|ACT34764.1|  subtilisin-like protease preproenzyme                   260   4e-77   Nicotiana tabacum [American tobacco]
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                258   2e-76   Nicotiana sylvestris
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease                258   3e-76   Nicotiana tomentosiformis
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease                256   7e-76   Nicotiana sylvestris
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                254   4e-75   Nicotiana sylvestris
ref|XP_009610212.1|  PREDICTED: subtilisin-like protease                252   4e-74   Nicotiana tomentosiformis
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                250   1e-73   Solanum lycopersicum
ref|XP_009799242.1|  PREDICTED: subtilisin-like protease                243   5e-71   Nicotiana sylvestris
emb|CBI19502.3|  unnamed protein product                                225   8e-70   Vitis vinifera
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                238   4e-69   Solanum lycopersicum
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           237   8e-69   Solanum tuberosum [potatoes]
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                237   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061    234   7e-66   
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like           229   1e-65   Solanum tuberosum [potatoes]
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                227   6e-65   Eucalyptus grandis [rose gum]
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                226   2e-64   
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     226   2e-64   Eucalyptus grandis [rose gum]
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                226   2e-64   Eucalyptus grandis [rose gum]
gb|EYU25437.1|  hypothetical protein MIMGU_mgv1a002005mg                225   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_007017195.1|  Subtilisin-like serine endopeptidase family ...    219   4e-62   
ref|XP_006386505.1|  hypothetical protein POPTR_0002s12610g             218   1e-61   
ref|XP_011017184.1|  PREDICTED: subtilisin-like protease                218   2e-61   Populus euphratica
gb|KDO84130.1|  hypothetical protein CISIN_1g004809mg                   217   2e-61   Citrus sinensis [apfelsine]
ref|XP_006434738.1|  hypothetical protein CICLE_v10000411mg             216   3e-61   
ref|XP_008393790.1|  PREDICTED: subtilisin-like protease                216   4e-61   
emb|CDP17956.1|  unnamed protein product                                216   6e-61   Coffea canephora [robusta coffee]
ref|XP_004514928.1|  PREDICTED: subtilisin-like protease-like           215   9e-61   
gb|KDP41714.1|  hypothetical protein JCGZ_16121                         214   2e-60   Jatropha curcas
gb|KEH18576.1|  subtilisin-like serine protease                         214   3e-60   Medicago truncatula
ref|XP_008351993.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    214   3e-60   
ref|XP_004514927.1|  PREDICTED: subtilisin-like protease-like           214   4e-60   Cicer arietinum [garbanzo]
ref|XP_002510195.1|  Cucumisin precursor, putative                      213   1e-59   Ricinus communis
ref|XP_004291093.1|  PREDICTED: subtilisin-like protease                212   2e-59   Fragaria vesca subsp. vesca
ref|XP_009359804.1|  PREDICTED: subtilisin-like protease                211   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                211   3e-59   Sesamum indicum [beniseed]
ref|XP_007135313.1|  hypothetical protein PHAVU_010G118800g             211   3e-59   Phaseolus vulgaris [French bean]
ref|XP_006374913.1|  subtilase family protein                           211   3e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006374911.1|  subtilase family protein                           211   3e-59   
ref|XP_011029640.1|  PREDICTED: subtilisin-like protease                211   4e-59   Populus euphratica
ref|XP_010059918.1|  PREDICTED: subtilisin-like protease                210   7e-59   Eucalyptus grandis [rose gum]
ref|XP_010112177.1|  Subtilisin-like protease                           210   8e-59   Morus notabilis
gb|ABK95622.1|  unknown                                                 209   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_008220244.1|  PREDICTED: subtilisin-like protease                209   2e-58   Prunus mume [ume]
gb|KJB63881.1|  hypothetical protein B456_010G021600                    208   4e-58   Gossypium raimondii
ref|XP_011029618.1|  PREDICTED: subtilisin-like protease                207   6e-58   Populus euphratica
ref|XP_007221958.1|  hypothetical protein PRUPE_ppa001770mg             207   6e-58   Prunus persica
ref|XP_008221259.1|  PREDICTED: subtilisin-like protease                207   1e-57   Prunus mume [ume]
ref|XP_008220243.1|  PREDICTED: subtilisin-like protease                206   2e-57   Prunus mume [ume]
ref|XP_002523603.1|  Cucumisin precursor, putative                      198   4e-57   
gb|KHN15886.1|  Subtilisin-like protease                                204   6e-57   Glycine soja [wild soybean]
ref|XP_003548151.1|  PREDICTED: subtilisin-like protease-like           204   1e-56   Glycine max [soybeans]
gb|KEH18575.1|  subtilisin-like serine protease                         203   2e-56   Medicago truncatula
ref|XP_008357385.1|  PREDICTED: subtilisin-like protease                203   2e-56   
ref|XP_002523602.1|  Cucumisin precursor, putative                      202   2e-56   
gb|KCW66392.1|  hypothetical protein EUGRSUZ_F00206                     202   4e-56   Eucalyptus grandis [rose gum]
ref|XP_003595551.1|  Subtilisin-like serine protease                    202   5e-56   Medicago truncatula
gb|KDP31945.1|  hypothetical protein JCGZ_12406                         200   6e-56   Jatropha curcas
gb|KJB59847.1|  hypothetical protein B456_009G275900                    202   7e-56   Gossypium raimondii
gb|KEH42928.1|  subtilisin-like serine protease                         202   8e-56   Medicago truncatula
ref|XP_008785918.1|  PREDICTED: subtilisin-like protease                197   9e-56   
gb|KEH18578.1|  subtilisin-like serine protease                         201   2e-55   Medicago truncatula
ref|XP_002510196.1|  Cucumisin precursor, putative                      200   3e-55   Ricinus communis
ref|XP_003626594.1|  Subtilisin-like protease                           200   3e-55   Medicago truncatula
emb|CBI18429.3|  unnamed protein product                                197   3e-55   Vitis vinifera
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease                200   4e-55   Phoenix dactylifera
gb|KHN15890.1|  Subtilisin-like protease                                200   4e-55   Glycine soja [wild soybean]
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     199   4e-55   Eucalyptus grandis [rose gum]
gb|KEH18574.1|  subtilisin-like serine protease                         199   4e-55   Medicago truncatula
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                199   5e-55   Eucalyptus grandis [rose gum]
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                199   7e-55   Nelumbo nucifera [Indian lotus]
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                197   2e-54   Populus euphratica
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease                197   2e-54   Vitis vinifera
ref|XP_009419397.1|  PREDICTED: subtilisin-like protease                196   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002310134.2|  subtilase family protein                           196   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease                196   6e-54   Elaeis guineensis
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                196   9e-54   Phoenix dactylifera
ref|XP_004494864.1|  PREDICTED: subtilisin-like protease-like           196   1e-53   
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease                196   1e-53   Vitis vinifera
gb|KDP41713.1|  hypothetical protein JCGZ_16120                         195   2e-53   Jatropha curcas
emb|CBI21415.3|  unnamed protein product                                195   3e-53   Vitis vinifera
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                194   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                194   5e-53   Sesamum indicum [beniseed]
ref|XP_003624105.1|  Xylem serine proteinase                            193   7e-53   Medicago truncatula
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    193   1e-52   
ref|XP_003529873.2|  PREDICTED: subtilisin-like protease-like           192   3e-52   
emb|CDP01315.1|  unnamed protein product                                191   6e-52   Coffea canephora [robusta coffee]
ref|XP_007204261.1|  hypothetical protein PRUPE_ppa001828mg             191   7e-52   
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease                190   1e-51   Prunus mume [ume]
emb|CDP01317.1|  unnamed protein product                                187   1e-51   Coffea canephora [robusta coffee]
gb|ACA64705.1|  subtilase                                               186   3e-51   Nicotiana tabacum [American tobacco]
ref|XP_011074591.1|  PREDICTED: subtilisin-like protease                189   3e-51   Sesamum indicum [beniseed]
ref|XP_002523606.1|  Cucumisin precursor, putative                      189   3e-51   
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like           188   5e-51   Glycine max [soybeans]
gb|KDP41712.1|  hypothetical protein JCGZ_16119                         188   5e-51   Jatropha curcas
gb|KHN40450.1|  Subtilisin-like protease                                188   5e-51   Glycine soja [wild soybean]
gb|ABD28577.1|  Proteinase inhibitor I9, subtilisin propeptide          188   5e-51   Medicago truncatula
gb|KHN15887.1|  Subtilisin-like protease                                187   6e-51   Glycine soja [wild soybean]
gb|KDP41710.1|  hypothetical protein JCGZ_16117                         186   1e-50   Jatropha curcas
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                186   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_003624104.1|  Subtilisin-like protease                           189   3e-50   
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg             186   3e-50   
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                186   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_003548400.1|  PREDICTED: subtilisin-like protease-like           186   4e-50   Glycine max [soybeans]
emb|CAN60787.1|  hypothetical protein VITISV_034533                     186   4e-50   Vitis vinifera
ref|XP_007139760.1|  hypothetical protein PHAVU_008G056700g             185   5e-50   Phaseolus vulgaris [French bean]
gb|EYU25438.1|  hypothetical protein MIMGU_mgv1a001996mg                185   5e-50   Erythranthe guttata [common monkey flower]
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                185   5e-50   Vitis vinifera
ref|XP_009797476.1|  PREDICTED: subtilisin-like protease                185   6e-50   Nicotiana sylvestris
ref|XP_010267360.1|  PREDICTED: subtilisin-like protease                185   6e-50   Nelumbo nucifera [Indian lotus]
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease                185   7e-50   Sesamum indicum [beniseed]
gb|ACA64703.1|  subtilase                                               185   8e-50   Nicotiana tabacum [American tobacco]
ref|XP_009621569.1|  PREDICTED: subtilisin-like protease                185   8e-50   
ref|XP_006425911.1|  hypothetical protein CICLE_v10024929mg             184   1e-49   Citrus clementina [clementine]
gb|KDO79191.1|  hypothetical protein CISIN_1g004824mg                   184   1e-49   Citrus sinensis [apfelsine]
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...    184   1e-49   
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                   184   1e-49   Citrus sinensis [apfelsine]
ref|XP_007047285.1|  Subtilisin-like serine endopeptidase family ...    184   2e-49   
ref|XP_009787984.1|  PREDICTED: subtilisin-like protease                183   3e-49   Nicotiana sylvestris
gb|ACA64702.1|  subtilase                                               183   4e-49   Nicotiana tabacum [American tobacco]
ref|XP_006466594.1|  PREDICTED: subtilisin-like protease-like           183   4e-49   Citrus sinensis [apfelsine]
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease                182   5e-49   
pdb|3I6S|A  Chain A, Crystal Structure Of The Plant Subtilisin-Li...    182   5e-49   Solanum lycopersicum
emb|CBI19501.3|  unnamed protein product                                185   7e-49   Vitis vinifera
ref|NP_001234774.1|  subtilisin-like protease precursor                 181   1e-48   Solanum lycopersicum
ref|XP_006345401.1|  PREDICTED: subtilisin-like protease-like           181   1e-48   Solanum tuberosum [potatoes]
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease                181   2e-48   Sesamum indicum [beniseed]
ref|XP_004492811.1|  PREDICTED: subtilisin-like protease-like           181   2e-48   Cicer arietinum [garbanzo]
gb|EPS63009.1|  subtilisin-like protease preproenzyme                   180   2e-48   Genlisea aurea
emb|CDP01316.1|  unnamed protein product                                181   2e-48   Coffea canephora [robusta coffee]
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                181   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                179   5e-48   Solanum lycopersicum
ref|XP_009343175.1|  PREDICTED: subtilisin-like protease                179   5e-48   Pyrus x bretschneideri [bai li]
emb|CDP17236.1|  unnamed protein product                                179   5e-48   Coffea canephora [robusta coffee]
ref|XP_009345959.1|  PREDICTED: subtilisin-like protease                179   7e-48   
gb|KHN06360.1|  Subtilisin-like protease                                180   7e-48   Glycine soja [wild soybean]
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease                179   1e-47   Tarenaya hassleriana [spider flower]
gb|AAY63882.1|  subtilisin-like serine protease                         178   1e-47   Solanum tuberosum [potatoes]
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease                179   1e-47   Sesamum indicum [beniseed]
ref|XP_004229665.1|  PREDICTED: subtilisin-like protease                178   2e-47   
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           178   2e-47   
emb|CDP01318.1|  unnamed protein product                                178   2e-47   Coffea canephora [robusta coffee]
emb|CAA07059.1|  SBT4B protein                                          178   2e-47   Solanum lycopersicum
gb|EAY98174.1|  hypothetical protein OsI_20091                          176   2e-47   Oryza sativa Indica Group [Indian rice]
gb|KJB43733.1|  hypothetical protein B456_007G214100                    177   2e-47   Gossypium raimondii
ref|XP_007139763.1|  hypothetical protein PHAVU_008G057000g             177   3e-47   Phaseolus vulgaris [French bean]
ref|XP_006345406.1|  PREDICTED: subtilisin-like protease-like           177   3e-47   Solanum tuberosum [potatoes]
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg                177   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    177   6e-47   
ref|NP_001055646.1|  Os05g0435800                                       176   7e-47   
ref|XP_004143027.1|  PREDICTED: subtilisin-like protease-like           176   7e-47   
ref|XP_004156411.1|  PREDICTED: subtilisin-like protease-like           176   7e-47   
gb|KHN06359.1|  Subtilisin-like protease                                166   1e-46   Glycine soja [wild soybean]
ref|XP_011464036.1|  PREDICTED: subtilisin-like protease                173   1e-46   Fragaria vesca subsp. vesca
gb|ACL52543.1|  unknown                                                 173   1e-46   Zea mays [maize]
gb|AFW81832.1|  putative subtilase family protein                       173   1e-46   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                176   2e-46   Vitis vinifera
ref|XP_010687642.1|  PREDICTED: subtilisin-like protease                175   2e-46   
ref|XP_006345402.1|  PREDICTED: subtilisin-like protease-like           175   2e-46   Solanum tuberosum [potatoes]
ref|XP_004229664.2|  PREDICTED: subtilisin-like protease                175   2e-46   Solanum lycopersicum
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                175   3e-46   Erythranthe guttata [common monkey flower]
gb|AES61117.2|  subtilisin-like serine protease                         174   5e-46   Medicago truncatula
ref|XP_003590866.1|  Subtilisin-like protease                           174   5e-46   
ref|XP_006345405.1|  PREDICTED: subtilisin-like protease-like           174   5e-46   
ref|XP_009595146.1|  PREDICTED: subtilisin-like protease                174   6e-46   Nicotiana tomentosiformis
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      174   7e-46   Ricinus communis
ref|XP_010093626.1|  Subtilisin-like protease                           173   7e-46   
ref|NP_001234780.1|  subtilisin-like protease                           174   7e-46   Solanum lycopersicum
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                173   9e-46   
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                173   9e-46   Nicotiana sylvestris
ref|XP_008444560.1|  PREDICTED: subtilisin-like protease                173   9e-46   Cucumis melo [Oriental melon]
ref|XP_006345400.1|  PREDICTED: subtilisin-like protease-like           173   1e-45   Solanum tuberosum [potatoes]
ref|NP_001145972.1|  uncharacterized protein LOC100279499 precursor     173   1e-45   
gb|AFW81831.1|  putative subtilase family protein                       173   1e-45   
gb|KHN04972.1|  Subtilisin-like protease                                169   2e-45   Glycine soja [wild soybean]
gb|AAO62352.1|  subtilase                                               172   2e-45   Casuarina glauca
gb|ACA64704.1|  subtilase                                               172   2e-45   Nicotiana tabacum [American tobacco]
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                171   4e-45   
emb|CAA07062.1|  SBT4E protein                                          172   4e-45   Solanum lycopersicum
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g             171   4e-45   Phaseolus vulgaris [French bean]
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             171   5e-45   
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease                171   5e-45   
ref|XP_010112176.1|  Subtilisin-like protease                           165   7e-45   
ref|XP_009342993.1|  PREDICTED: subtilisin-like protease                170   1e-44   Pyrus x bretschneideri [bai li]
gb|KHN14785.1|  Subtilisin-like protease                                169   2e-44   Glycine soja [wild soybean]
gb|EYU45084.1|  hypothetical protein MIMGU_mgv1a001942mg                169   2e-44   Erythranthe guttata [common monkey flower]
emb|CAA07060.1|  SBT4C protein                                          170   2e-44   Solanum lycopersicum
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    170   2e-44   
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like           169   3e-44   Glycine max [soybeans]
ref|XP_008370912.1|  PREDICTED: subtilisin-like protease                168   6e-44   
emb|CAA59964.1|  subtilisin-like protease                               168   8e-44   Alnus glutinosa
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                168   8e-44   Eucalyptus grandis [rose gum]
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                168   9e-44   Prunus mume [ume]
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                167   9e-44   Erythranthe guttata [common monkey flower]
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease                167   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_009338017.1|  PREDICTED: subtilisin-like protease                167   1e-43   Pyrus x bretschneideri [bai li]
dbj|BAJ90426.1|  predicted protein                                      167   1e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002441162.1|  hypothetical protein SORBIDRAFT_09g021490          167   1e-43   
dbj|BAJ88973.1|  predicted protein                                      167   1e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003638681.1|  Subtilisin-like protease                           157   2e-43   
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                167   2e-43   
dbj|BAJ88882.1|  predicted protein                                      166   3e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87233.1|  predicted protein                                      166   3e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like           166   5e-43   
gb|KJB58523.1|  hypothetical protein B456_009G213500                    165   6e-43   Gossypium raimondii
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           165   1e-42   Cicer arietinum [garbanzo]
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g             164   1e-42   Phaseolus vulgaris [French bean]
ref|XP_008370910.1|  PREDICTED: subtilisin-like protease                163   2e-42   
gb|KHN43135.1|  Subtilisin-like protease                                162   3e-42   Glycine soja [wild soybean]
ref|XP_009608286.1|  PREDICTED: subtilisin-like protease                162   1e-41   Nicotiana tomentosiformis
ref|XP_008355893.1|  PREDICTED: subtilisin-like protease                162   1e-41   
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           162   1e-41   Setaria italica
ref|XP_003553772.1|  PREDICTED: subtilisin-like protease-like           162   1e-41   Glycine max [soybeans]
gb|EAZ14292.1|  hypothetical protein OsJ_04216                          160   3e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220          160   5e-41   
ref|NP_001044922.1|  Os01g0868900                                       160   6e-41   
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease                159   9e-41   Solanum lycopersicum
ref|XP_009769987.1|  PREDICTED: subtilisin-like protease isoform X1     159   1e-40   Nicotiana sylvestris
ref|XP_011468374.1|  PREDICTED: uncharacterized protein LOC101302380    161   1e-40   Fragaria vesca subsp. vesca
ref|XP_009608285.1|  PREDICTED: subtilisin-like protease                159   1e-40   Nicotiana tomentosiformis
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like           159   1e-40   Solanum tuberosum [potatoes]
ref|XP_009769989.1|  PREDICTED: subtilisin-like protease                159   2e-40   Nicotiana sylvestris
gb|EEC71868.1|  hypothetical protein OsI_04579                          156   5e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                157   6e-40   Solanum lycopersicum
gb|EMT05720.1|  Subtilisin-like protease                                155   7e-40   
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     155   4e-39   Eucalyptus grandis [rose gum]
gb|EAY76626.1|  hypothetical protein OsI_04578                          152   8e-39   Oryza sativa Indica Group [Indian rice]
gb|EEE55729.1|  hypothetical protein OsJ_04215                          152   2e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KEH23384.1|  subtilisin-like serine protease                         151   2e-38   Medicago truncatula
dbj|BAD82002.1|  putative subtilase                                     152   4e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KEH18652.1|  subtilase family protein, putative                      144   1e-37   Medicago truncatula
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like           150   2e-37   Solanum tuberosum [potatoes]
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                150   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like           149   4e-37   
gb|KCW44172.1|  hypothetical protein EUGRSUZ_L024071                    145   6e-37   Eucalyptus grandis [rose gum]
gb|ABN05870.1|  Proteinase inhibitor I9, subtilisin propeptide          146   1e-36   Medicago truncatula
ref|XP_008776814.1|  PREDICTED: cucumisin                               137   3e-36   Phoenix dactylifera
ref|XP_010547521.1|  PREDICTED: subtilisin-like protease SDD1           145   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease                145   1e-35   Eucalyptus grandis [rose gum]
ref|XP_006847081.1|  hypothetical protein AMTR_s00017p00213940          141   7e-35   
dbj|BAJ89456.1|  predicted protein                                      142   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg            142   2e-34   
gb|KJB84344.1|  hypothetical protein B456_N019700                       134   7e-34   Gossypium raimondii
gb|KCW68720.1|  hypothetical protein EUGRSUZ_F02324                     137   9e-34   Eucalyptus grandis [rose gum]
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease                140   9e-34   
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like           140   1e-33   Citrus sinensis [apfelsine]
ref|XP_010647877.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_006847079.1|  hypothetical protein AMTR_s00017p00212440          139   2e-33   
ref|XP_010446287.1|  PREDICTED: subtilisin-like protease SDD1           131   2e-33   
emb|CDM85158.1|  unnamed protein product                                139   3e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             139   3e-33   Citrus clementina [clementine]
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           139   3e-33   Citrus sinensis [apfelsine]
ref|XP_010927458.1|  PREDICTED: subtilisin-like protease                138   4e-33   
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg             138   4e-33   Citrus clementina [clementine]
gb|EMS48839.1|  Subtilisin-like protease                                139   4e-33   Triticum urartu
gb|AFW84453.1|  putative subtilase family protein                       137   8e-33   
ref|XP_007207718.1|  hypothetical protein PRUPE_ppa1027200mg            132   2e-32   
ref|XP_006847104.1|  hypothetical protein AMTR_s00017p00218650          136   2e-32   
emb|CDM85157.1|  unnamed protein product                                135   2e-32   Triticum aestivum [Canadian hard winter wheat]
gb|KDP41709.1|  hypothetical protein JCGZ_16116                         136   2e-32   Jatropha curcas
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        136   2e-32   
ref|XP_006847102.1|  hypothetical protein AMTR_s00017p00218450          131   3e-32   
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease                135   3e-32   Elaeis guineensis
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like           135   4e-32   Citrus sinensis [apfelsine]
emb|CAN60788.1|  hypothetical protein VITISV_034534                     135   4e-32   Vitis vinifera
emb|CAN64996.1|  hypothetical protein VITISV_001780                     135   5e-32   Vitis vinifera
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease                134   7e-32   
emb|CAN64995.1|  hypothetical protein VITISV_001779                     134   7e-32   Vitis vinifera
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease                134   1e-31   
ref|XP_002518750.1|  Xylem serine proteinase 1 precursor, putative      134   1e-31   Ricinus communis
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             134   1e-31   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                134   1e-31   Populus euphratica
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease                133   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_009405278.1|  PREDICTED: subtilisin-like protease                133   2e-31   
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative        134   2e-31   
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                     133   2e-31   Eucalyptus grandis [rose gum]
emb|CBI32393.3|  unnamed protein product                                131   2e-31   Vitis vinifera
gb|KCW63761.1|  hypothetical protein EUGRSUZ_G01423                     132   3e-31   Eucalyptus grandis [rose gum]
gb|KJB47389.1|  hypothetical protein B456_008G024400                    131   3e-31   Gossypium raimondii
ref|XP_007206792.1|  hypothetical protein PRUPE_ppa026679mg             125   5e-31   
ref|XP_006422995.1|  hypothetical protein CICLE_v10030049mg             132   6e-31   
gb|KJB08038.1|  hypothetical protein B456_001G060600                    131   8e-31   
ref|XP_006847088.1|  hypothetical protein AMTR_s00017p00215590          127   1e-30   
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g             131   1e-30   
ref|XP_002282333.2|  PREDICTED: subtilisin-like protease                131   1e-30   
emb|CAN68827.1|  hypothetical protein VITISV_029978                     131   1e-30   
ref|XP_007226597.1|  hypothetical protein PRUPE_ppa023578mg             130   1e-30   
emb|CBI32395.3|  unnamed protein product                                130   1e-30   
ref|XP_006393907.1|  hypothetical protein EUTSA_v10005646mg             130   1e-30   
emb|CBI32394.3|  unnamed protein product                                132   1e-30   
ref|XP_011464023.1|  PREDICTED: subtilisin-like protease                130   1e-30   
ref|XP_006847097.1|  hypothetical protein AMTR_s00017p00216950          130   1e-30   
ref|NP_001064523.2|  Os10g0394200                                       124   2e-30   
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease                130   2e-30   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease                130   2e-30   
gb|KCW63767.1|  hypothetical protein EUGRSUZ_G01432                     129   2e-30   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease                129   3e-30   
ref|XP_010068466.1|  PREDICTED: subtilisin-like protease                129   4e-30   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             129   5e-30   
ref|XP_010464539.1|  PREDICTED: subtilisin-like protease                129   5e-30   
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like           129   5e-30   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           129   5e-30   
ref|XP_008372210.1|  PREDICTED: subtilisin-like protease                129   5e-30   
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                   129   6e-30   
gb|KDO37430.1|  hypothetical protein CISIN_1g039556mg                   127   6e-30   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                129   7e-30   
ref|XP_010906270.1|  PREDICTED: subtilisin-like protease                127   7e-30   
gb|KCW63759.1|  hypothetical protein EUGRSUZ_G01419                     128   9e-30   
ref|XP_002865029.1|  subtilase family protein                           128   9e-30   
ref|XP_010484555.1|  PREDICTED: subtilisin-like protease                128   9e-30   
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                128   1e-29   
gb|KHN07895.1|  Subtilisin-like protease                                126   1e-29   
ref|XP_009129098.1|  PREDICTED: subtilisin-like protease                127   2e-29   
gb|KCW63764.1|  hypothetical protein EUGRSUZ_G01428                     127   2e-29   
gb|KJB58524.1|  hypothetical protein B456_009G213600                    127   2e-29   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    127   3e-29   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             127   3e-29   
gb|AHA84190.1|  subtilisin-like protease                                127   3e-29   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           127   3e-29   
gb|KHN04600.1|  Subtilisin-like protease                                126   4e-29   
ref|XP_010068463.1|  PREDICTED: subtilisin-like protease                126   4e-29   
ref|XP_006280074.1|  hypothetical protein CARUB_v10025957mg             126   4e-29   
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                126   5e-29   
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    126   5e-29   
emb|CDY09336.1|  BnaA02g26740D                                          126   6e-29   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    126   6e-29   
gb|KHN17728.1|  Subtilisin-like protease                                120   7e-29   
ref|XP_010066012.1|  PREDICTED: subtilisin-like protease                126   7e-29   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           126   7e-29   
gb|EMS51375.1|  Subtilisin-like protease                                125   9e-29   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease                123   1e-28   
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           123   1e-28   
gb|KJB34438.1|  hypothetical protein B456_006G065800                    124   1e-28   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                125   1e-28   
gb|KCW63766.1|  hypothetical protein EUGRSUZ_G01430                     125   1e-28   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     125   2e-28   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                125   2e-28   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     125   2e-28   
ref|XP_010068464.1|  PREDICTED: subtilisin-like protease                124   2e-28   
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           124   2e-28   
gb|EMT16255.1|  Subtilisin-like protease                                124   2e-28   
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                124   2e-28   
emb|CDO96926.1|  unnamed protein product                                124   3e-28   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                124   3e-28   
gb|KJB34439.1|  hypothetical protein B456_006G065800                    123   3e-28   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           124   3e-28   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    124   3e-28   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             124   3e-28   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                124   4e-28   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                124   4e-28   
gb|KJB34440.1|  hypothetical protein B456_006G065800                    124   4e-28   
gb|EEE50901.1|  hypothetical protein OsJ_31407                          124   4e-28   
gb|EAY78354.1|  hypothetical protein OsI_33442                          123   5e-28   
emb|CBI37888.3|  unnamed protein product                                123   5e-28   
gb|ACL52505.1|  unknown                                                 120   5e-28   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           123   5e-28   
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      123   6e-28   
ref|XP_007135314.1|  hypothetical protein PHAVU_010G118900g             115   6e-28   
ref|NP_569044.1|  Subtilisin-like serine endopeptidase family pro...    123   6e-28   
gb|KHN04108.1|  Subtilisin-like protease                                123   6e-28   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             123   6e-28   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                123   6e-28   
gb|KHN12283.1|  Subtilisin-like protease                                120   6e-28   
gb|KEH30495.1|  subtilisin-like serine protease                         123   6e-28   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                123   6e-28   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                123   8e-28   
gb|KDP32268.1|  hypothetical protein JCGZ_14789                         115   9e-28   
gb|EMS60034.1|  Subtilisin-like protease                                120   1e-27   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                122   1e-27   
ref|XP_004975630.1|  PREDICTED: subtilisin-like protease-like           122   1e-27   
emb|CAN81091.1|  hypothetical protein VITISV_040911                     120   1e-27   
dbj|BAK06243.1|  predicted protein                                      122   1e-27   
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     122   1e-27   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           122   1e-27   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             122   1e-27   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                122   2e-27   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           122   2e-27   
gb|ABK96588.1|  unknown                                                 116   2e-27   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    122   2e-27   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                122   2e-27   
gb|KHN13888.1|  Subtilisin-like protease                                121   2e-27   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           121   3e-27   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           121   3e-27   
gb|KHN15704.1|  Subtilisin-like protease                                121   3e-27   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                121   3e-27   
gb|AES62637.2|  subtilisin-like serine protease                         121   3e-27   
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                   121   3e-27   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                121   3e-27   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                121   3e-27   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                121   3e-27   
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg             121   4e-27   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          121   4e-27   
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like           121   4e-27   
ref|XP_003592386.1|  Subtilisin-like protease                           121   4e-27   
gb|ACN28035.1|  unknown                                                 118   4e-27   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             120   4e-27   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            120   5e-27   
ref|XP_002446493.1|  hypothetical protein SORBIDRAFT_06g016860          120   5e-27   
tpg|DAA50071.1|  TPA: putative subtilase family protein                 120   5e-27   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                120   5e-27   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                120   5e-27   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     120   6e-27   
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease                120   6e-27   
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     120   6e-27   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             120   7e-27   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             120   7e-27   
ref|XP_003609994.1|  Subtilisin-like protease                           120   8e-27   
gb|AES92191.2|  subtilisin-like serine protease                         120   8e-27   
ref|XP_010090327.1|  Subtilisin-like protease                           120   8e-27   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           120   8e-27   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                120   9e-27   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                119   1e-26   
ref|XP_002321861.2|  subtilase family protein                           119   1e-26   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                119   1e-26   
ref|XP_002320086.2|  subtilase family protein                           119   1e-26   
gb|ADE77855.1|  unknown                                                 116   1e-26   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           119   1e-26   
dbj|BAJ99639.1|  predicted protein                                      119   1e-26   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                119   2e-26   
gb|KHN13887.1|  Subtilisin-like protease                                119   2e-26   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                119   2e-26   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         119   2e-26   
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           118   2e-26   
gb|ADE76648.1|  unknown                                                 116   2e-26   
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           119   2e-26   
dbj|BAD94244.1|  serine protease like protein                           115   2e-26   
gb|ACN27710.1|  unknown                                                 118   2e-26   
gb|EMT30759.1|  Subtilisin-like protease                                119   2e-26   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                119   2e-26   
tpg|DAA50265.1|  TPA: putative subtilase family protein                 118   3e-26   
gb|EMT32146.1|  Subtilisin-like protease                                113   3e-26   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                118   3e-26   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                118   3e-26   
ref|NP_001151549.1|  subtilisin-like protease precursor                 118   3e-26   
dbj|BAD36156.1|  putative serine protease                               118   3e-26   
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease                117   4e-26   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                118   4e-26   
gb|KDO36171.1|  hypothetical protein CISIN_1g030998mg                   111   4e-26   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    118   4e-26   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           118   4e-26   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           117   5e-26   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                117   6e-26   
ref|NP_001234288.1|  SBT2 protein precursor                             117   6e-26   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    117   6e-26   
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                117   6e-26   
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       116   6e-26   
ref|XP_006841510.1|  hypothetical protein AMTR_s00003p00138760          117   6e-26   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             117   6e-26   
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    117   6e-26   
ref|XP_001755716.1|  predicted protein                                  117   7e-26   
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                117   7e-26   
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                117   7e-26   
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          117   7e-26   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                117   7e-26   
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                117   7e-26   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          117   8e-26   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                117   8e-26   
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                117   8e-26   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          117   8e-26   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                117   9e-26   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                117   9e-26   
emb|CDY15145.1|  BnaC05g00240D                                          117   9e-26   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           117   9e-26   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                117   9e-26   
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                117   9e-26   
gb|ACJ26761.1|  subtilisin-like protein                                 110   1e-25   
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          117   1e-25   
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           117   1e-25   
ref|XP_007016287.1|  Subtilase family protein, putative                 110   1e-25   
ref|XP_003595292.1|  Subtilisin-like protease                           117   1e-25   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    116   1e-25   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           116   1e-25   
gb|EMT02947.1|  Subtilisin-like protease                                114   1e-25   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                116   1e-25   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    116   2e-25   
ref|XP_010525170.1|  PREDICTED: cucumisin                               109   2e-25   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease                116   2e-25   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                116   2e-25   
gb|EMS59706.1|  Subtilisin-like protease                                114   2e-25   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                116   2e-25   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  116   2e-25   
gb|ABR17987.1|  unknown                                                 116   2e-25   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           116   2e-25   
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           115   2e-25   
ref|XP_006381615.1|  subtilase family protein                           115   2e-25   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g             116   2e-25   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                115   2e-25   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                115   2e-25   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          115   2e-25   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      115   2e-25   
ref|NP_565330.1|  Subtilase-like protein                                115   2e-25   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    115   2e-25   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                115   3e-25   
ref|XP_006422998.1|  hypothetical protein CICLE_v10029893mg             113   3e-25   
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    115   3e-25   
ref|XP_002533857.1|  Cucumisin precursor, putative                      115   3e-25   
gb|KHN10472.1|  Subtilisin-like protease                                115   3e-25   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                115   3e-25   
ref|XP_002510884.1|  Cucumisin precursor, putative                      115   3e-25   
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      115   3e-25   



>ref|XP_009604890.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=755

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG  NAAA+PLAMGAGHI+PN+ALDPGLIYD + QDY+NL+CAL FT    +TI R
Sbjct  567  PIRDIGSKNAAATPLAMGAGHIDPNKALDPGLIYDATPQDYVNLLCALNFTSKQIKTITR  626

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSY CSNPSLDLNYPSFI FF  N++ SDP R+QEF RT+TN+GDG+S Y+AKLT +G 
Sbjct  627  SSSYTCSNPSLDLNYPSFIGFFNGNSSESDPRRIQEFQRTVTNIGDGMSVYTAKLTTMGK  686

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V +VP+KLVF +K +K SYKLRIE P  M D +V+GSL+WVE  GK+VVRSPIVA
Sbjct  687  FKVNLVPEKLVFKEKYEKLSYKLRIEGPLVMDDIVVYGSLSWVETEGKYVVRSPIVA  743



>gb|ACT34764.1| subtilisin-like protease preproenzyme [Nicotiana tabacum]
Length=763

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +N AASPLAMGAGHINPN+ALDPGLIYD++SQDYINL+CAL FT    + I R
Sbjct  579  PIRDIGRNNNAASPLAMGAGHINPNKALDPGLIYDITSQDYINLLCALDFTSQQIKAITR  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S+Y+CSNPSLDLNYPSFI +F  N++ SDP R+QEF RT+TN+GDG+S Y+AKLT +  
Sbjct  639  SSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKRIQEFQRTVTNVGDGMSVYTAKLTSMDE  698

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PDKLVF +K +KQSYKLRIE P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  699  YKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVYGSLSWVETSGKYVVKSPIVA  755



>ref|XP_009771086.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=772

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG  NAAA+PLAMGAGHI+PN+ALDPGLIYD + QDY+NL+CAL FT    +TI R
Sbjct  584  PIRDIGSRNAAATPLAMGAGHIDPNKALDPGLIYDATPQDYVNLLCALNFTSKQIKTITR  643

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSY CSNPSLDLNYPSFI FF  N+  SDP R+QEF RT+TNL DG S Y+A LTP+G 
Sbjct  644  SSSYTCSNPSLDLNYPSFIGFFNGNSRESDPKRIQEFKRTVTNLQDGTSVYTANLTPMGK  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+VVP+KLVF +K +K SYKLRIE P  M D +V+GSL+WVE  GK+VVRSPIVA
Sbjct  704  FKVSVVPEKLVFKEKYEKLSYKLRIEGPIVMDDNVVYGSLSWVETGGKYVVRSPIVA  760



>ref|XP_009595649.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=763

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +N AA PLAMGAGHINPN+ALDPGLIYD++SQDYINL+CAL FT    + I R
Sbjct  579  PIRDIGRNNNAAIPLAMGAGHINPNKALDPGLIYDITSQDYINLLCALNFTSQQIKAITR  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S+Y+CSNPSLDLNYPSFI +F  N++ SDP R+QEF RT+TN+GDG+S Y+AKLT +  
Sbjct  639  SSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKRIQEFQRTVTNVGDGMSVYTAKLTSMDE  698

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PDKLVF +K +KQSYKLRIE P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  699  YKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVYGSLSWVETSGKYVVKSPIVA  755



>ref|XP_009800439.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +N AASPLAMGAGHINPN+ALDPGLIYD++SQDY NL+CAL FT    ++I R
Sbjct  580  PIRDIGRNNNAASPLAMGAGHINPNKALDPGLIYDITSQDYNNLLCALNFTSQQIKSITR  639

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S+Y+CSNPSLDLNYPSFI +F  N++ SDP R+QEF RT+TN+G+G+S Y+AKLT +  
Sbjct  640  SSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKRIQEFQRTVTNVGEGMSVYTAKLTSMDE  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PDKLVF +K +KQSYKLRIE P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  700  YKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVYGSLSWVETSGKYVVKSPIVA  756



>ref|XP_009790288.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +N AASPLAMGAGHINPN+AL+PGLIYD++SQDY NL+CAL FT    ++I R
Sbjct  580  PIRDIGRNNNAASPLAMGAGHINPNKALEPGLIYDITSQDYNNLLCALDFTSQQIKSITR  639

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S+Y+CSNPSLDLNYPSFI +F  N++ SDP R+QEF RT+TN+G+G+S Y+AKLT +  
Sbjct  640  SSAYSCSNPSLDLNYPSFIGYFNYNSSKSDPKRIQEFQRTVTNVGEGMSVYTAKLTSMDE  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PDKLVF +K +KQSYKLRIE P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  700  YKVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVYGSLSWVETSGKYVVKSPIVA  756



>ref|XP_009610212.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PIQDIG +NAAA+PLAMGAGHINPN+A+DPGLIYD + QDYINL+CAL  T    +TI R
Sbjct  576  PIQDIGQENAAATPLAMGAGHINPNKAIDPGLIYDTTRQDYINLLCALNLTSEQIKTITR  635

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSY C NPSLDLNYPSFIA+F  N++  DP R+QEF RT+TN+G+G+S Y+AKLT +  
Sbjct  636  -SSYTCPNPSLDLNYPSFIAYFNVNSSELDPTRIQEFKRTVTNVGEGVSEYTAKLTAMPG  694

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V+VVP+KLVF  K +KQSYKLR+E    M DFLV GSL+WVE  GK VVRSPIVA
Sbjct  695  LKVSVVPEKLVFKDKYEKQSYKLRVECSKLMNDFLVHGSLSWVEKGGKRVVRSPIVA  751



>ref|XP_010320328.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=751

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PIQD+G  N  A+PLAMGAGHI+PN+ALDPGLIYD + QDY+N +C L FT    QTI R
Sbjct  563  PIQDVGLKNGVATPLAMGAGHIDPNKALDPGLIYDATPQDYVNHLCGLNFTSKQIQTITR  622

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S+Y CSNPSLDLNYPSFI +F  N++ SDP R+QEF RT+TNL DG S Y+AKLTP+G 
Sbjct  623  SSTYTCSNPSLDLNYPSFIGYFNRNSSDSDPKRIQEFKRTVTNLQDGTSVYTAKLTPMGK  682

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+VVP+KL F +K +KQSYKLRIE P  M D +V GSL+W+E  GK++V+SPIVA
Sbjct  683  FKVSVVPNKLTFKEKYEKQSYKLRIEGPIIMDDIVVDGSLSWMETRGKYIVKSPIVA  739



>ref|XP_009799242.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=757

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = -2

Query  756  PIQDIGF-DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PIQDIG  +NAAA+PLAMGAGHINPN+A+DPGLIYD + QDYINL+CAL  T    +TI 
Sbjct  576  PIQDIGRPENAAATPLAMGAGHINPNKAIDPGLIYDTTPQDYINLLCALNLTSKQIKTIT  635

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            R SSY C NPSLDLNYPSFIA+F  N++  DP R+QEF RT+TN+G+ +S Y+A+LT + 
Sbjct  636  R-SSYTCPNPSLDLNYPSFIAYFNVNSSELDPTRIQEFKRTVTNVGERVSEYTAELTAMP  694

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             + V++VP+KLVF  K +KQSYKLRIE P  M DFLV GSL W+E  GK+VVRSPIVA
Sbjct  695  GLKVSIVPEKLVFKDKYEKQSYKLRIECPKLMNDFLVHGSLRWMEKGGKYVVRSPIVA  752



>emb|CBI19502.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -2

Query  723  ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSL  544
            ASPLAMG+GHINPN+ALDPG IYDV+ +D+INL+CAL ++    Q I R+SSY CS+PSL
Sbjct  15   ASPLAMGSGHINPNKALDPGFIYDVNLEDHINLLCALNYSTKQIQIITRSSSYTCSDPSL  74

Query  543  DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLV  364
            DLNYPSFIA F AN + SD   VQEF RT+TN+G+ +STY+AKLT +    V+VVPDKLV
Sbjct  75   DLNYPSFIASFDANDSRSDSKTVQEFRRTVTNVGEAMSTYNAKLTGMDGFQVSVVPDKLV  134

Query  363  FTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            F  K  K SYKLRIE PS M + + FGSL+WV+   KHVVRSPIVA
Sbjct  135  FKDKYQKLSYKLRIEGPSLMKETVAFGSLSWVDVEAKHVVRSPIVA  180



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG DN AA+PLAMGAGHINPN+ALDPGLIYD + +DY+NL+C L FT    ++I R
Sbjct  591  PIRDIGRDNNAATPLAMGAGHINPNKALDPGLIYDATPEDYVNLLCGLDFTSKQIKSITR  650

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSY+CS PSLDLNYPSFI +F  N++ SDP R+Q F+RT+TNLGDG STY+AKLTP+G 
Sbjct  651  SSSYSCSKPSLDLNYPSFIGYFNFNSSKSDPKRIQVFNRTVTNLGDGQSTYTAKLTPMGE  710

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PDKLVF +K +KQSYKLRIE P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  711  YTVSVTPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVYGSLSWVETSGKYVVKSPIVA  767



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG DN AA+PLAMGAGHINPN+ALDPGLIYD + +DY+NL+C L FT    ++I R
Sbjct  565  PIRDIGRDNNAATPLAMGAGHINPNKALDPGLIYDATPEDYVNLLCGLDFTSKQIKSITR  624

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSY+CS PSLDLNYPSFI +F  N++ SDP R+QEF+RT+TNLGDG  TY+AKLTP+G 
Sbjct  625  SSSYSCSKPSLDLNYPSFIGYFNFNSSKSDPKRIQEFNRTVTNLGDGQLTYTAKLTPMGK  684

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PDKLVF +K +KQSYKLRIE P  + ++LV+GSL+WV+ +GK+VV+SPIVA
Sbjct  685  YTVSVAPDKLVFKEKYEKQSYKLRIEGPLLVDNYLVYGSLSWVDTSGKYVVKSPIVA  741



>ref|XP_010263512.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=767

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PIQ  G+ N AASPLAMGAGHINPN+ALDPGLIYD S+ DY++L+CAL +T N  + I R
Sbjct  583  PIQVAGYKNKAASPLAMGAGHINPNKALDPGLIYDASTDDYVSLLCALNYTMNEIKMITR  642

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S +NCSNPSLDLNYPSFIAFF A  + SD   VQEF RT+TN+G+G+STY+A LTP+  
Sbjct  643  SSDFNCSNPSLDLNYPSFIAFFNAQDSGSDAKVVQEFQRTVTNVGEGMSTYTAYLTPMDG  702

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V VVPD LVF +K +K SYKL IE P+ M + +V GS++W ++ GKHVVRSPIV
Sbjct  703  FQVAVVPDTLVFREKYEKLSYKLSIEGPTRMKEKVVHGSISWTDSGGKHVVRSPIV  758



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score =   234 bits (596),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  756   PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
             PI+ IG DN  ASPLAMG+GHINPN+ALDPG IYDV+ +D+INL+CAL ++    Q I R
Sbjct  1345  PIKGIGDDNQPASPLAMGSGHINPNKALDPGFIYDVNLEDHINLLCALNYSTKQIQIITR  1404

Query  576   TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             +SSY CS+PSLDLNYPSFIA F AN + SD   VQEF RT+TN+G+ +STY+AKLT +  
Sbjct  1405  SSSYTCSDPSLDLNYPSFIASFDANDSRSDSKTVQEFRRTVTNVGEAMSTYNAKLTGMDG  1464

Query  396   VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
               V+VVPDKLVF  K  K SYKLRIE PS M + + FGSL+WV+   KHVVRSPIVA
Sbjct  1465  FQVSVVPDKLVFKDKYQKLSYKLRIEGPSLMKETVAFGSLSWVDVEAKHVVRSPIVA  1521


 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 115/175 (66%), Gaps = 1/175 (1%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G +   ASPLAMGAG I+PN ALDPGL+YD + QDY+NL+C++ FT     TI R+
Sbjct  588  IRDNGLNFTIASPLAMGAGQIDPNGALDPGLVYDATPQDYVNLLCSMNFTKKQILTITRS  647

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            ++Y C   S DLNYPSFIA +  N   S    VQ+F RT+TN+GDG +TY A +      
Sbjct  648  NTYTCPKTSPDLNYPSFIALYSQNDNKST-TVVQKFQRTVTNVGDGTATYHATVIAPRGS  706

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             VTV P  LVF KK +KQSY + I+  S     + FG LTW+E+ G+H VRSPIV
Sbjct  707  KVTVSPTTLVFEKKYEKQSYTMSIKYKSDKDGKISFGWLTWIEDDGEHTVRSPIV  761



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG +N AA+PLAMGAGHINPN+ALDPGLIYDV+ +DYINL+C L FT    + I R+
Sbjct  572  IRDIGKNNNAANPLAMGAGHINPNKALDPGLIYDVTPEDYINLLCGLDFTSQQIKAITRS  631

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSY+CSNPSLDLNYPSFI +F  N++ SD  R QEF RT+TNLGDG+STY+AKLTP+   
Sbjct  632  SSYSCSNPSLDLNYPSFIGYFNRNSSKSDTKRTQEFQRTVTNLGDGMSTYTAKLTPMDEY  691

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             V+V P KLVF +K +KQ+YKLRIE P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  692  KVSVAPHKLVFKEKYEKQNYKLRIEGPLLLDNYLVYGSLSWVETSGKYVVKSPIVA  747



>ref|XP_010059917.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66393.1| hypothetical protein EUGRSUZ_F00207 [Eucalyptus grandis]
Length=768

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASP+ MGAGH++PN+ALDPGLIYDV+ QDY+NL+CA+ +T    Q + R
Sbjct  582  PIKDIGNDYKPASPVGMGAGHVDPNKALDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCSNPSLDLNYPSFIAFF +N+  SD   VQ+F+RT+TN+G G STY+A++ P+  
Sbjct  642  SSSYNCSNPSLDLNYPSFIAFFSSNS--SDSLTVQDFYRTVTNVGAGASTYTAEVNPMEE  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+VVPDKL F +K +K SYKL IE P  M   +V GSL+W+++ GK+VV+SPIVA
Sbjct  700  FKVSVVPDKLTFKEKYEKLSYKLTIEGPKQMKQTVVSGSLSWMDDGGKYVVKSPIVA  756



>ref|XP_010025755.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=759

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASP+ MGAGH++PN+ALDPGLIYDV  QDY+NL+CA+ +T    Q + R
Sbjct  573  PIKDIGNDYKPASPIGMGAGHVDPNKALDPGLIYDVMPQDYVNLMCAMNYTSKQIQMVTR  632

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCSNPSLDLNYPSFIAFF +N+  SD   VQEF+RT+TN+G G STY+A++ P+  
Sbjct  633  SSSYNCSNPSLDLNYPSFIAFFSSNS--SDSPTVQEFYRTVTNVGAGGSTYTAEVNPMEG  690

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+VVPDKL F  K +K SYKL IE P  M   +V GSL+W+++ GK+VV+SPIVA
Sbjct  691  FKVSVVPDKLTFKVKYEKLSYKLTIEGPKQMKQTVVSGSLSWMDDGGKYVVKSPIVA  747



>gb|KCW62487.1| hypothetical protein EUGRSUZ_H05125 [Eucalyptus grandis]
Length=768

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASP+ MGAGH++PN+ALDPGLIYDV  QDY+NL+CA+ +T    Q + R
Sbjct  582  PIKDIGNDYKPASPIGMGAGHVDPNKALDPGLIYDVMPQDYVNLMCAMNYTSKQIQMVTR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCSNPSLDLNYPSFIAFF +N+  SD   VQEF+RT+TN+G G STY+A++ P+  
Sbjct  642  SSSYNCSNPSLDLNYPSFIAFFSSNS--SDSPTVQEFYRTVTNVGAGGSTYTAEVNPMEG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+VVPDKL F  K +K SYKL IE P  M   +V GSL+W+++ GK+VV+SPIVA
Sbjct  700  FKVSVVPDKLTFKVKYEKLSYKLTIEGPKQMKQTVVSGSLSWMDDGGKYVVKSPIVA  756



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASP+ MGAGH++PN+ALDPGLIYDV+ QDY+NL+CA+ +T    Q + R
Sbjct  582  PIKDIGNDYKPASPVGMGAGHVDPNKALDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCSNPSLDLNYPSFIAFF +N+  SD   VQEF+RT+TN+G G STY A++ P+  
Sbjct  642  SSSYNCSNPSLDLNYPSFIAFFGSNS--SDSPMVQEFYRTVTNVGAGASTYRAEVNPMEG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V++VPDKL F +K +K SYKL IE P  M   +V GSL+W+++ GK+ V+SPIVA
Sbjct  700  FKVSIVPDKLTFKEKYEKLSYKLTIEGPKQMKQTVVSGSLSWMDDGGKYAVKSPIVA  756



>gb|EYU25437.1| hypothetical protein MIMGU_mgv1a002005mg [Erythranthe guttata]
Length=728

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA-ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI++IG +    A P  +G+GHI+PN+ALDPGL+YD +S+DYINLICAL FT N  +TI 
Sbjct  546  PIKEIGSNGGQFADPFGIGSGHIDPNKALDPGLVYDATSEDYINLICALNFTENQIKTIT  605

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            R+++YNCSNPSLDLNYPSFIAFF  N T S+   V+EF RT+TN+G G S YS++LT   
Sbjct  606  RSTAYNCSNPSLDLNYPSFIAFFNPNGTSSEKLAVREFRRTVTNVGVGKSVYSSELTTFD  665

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             + V+V PD+L F+ K +K+SYKLRIE+ + M D LV+GSLTW+E++GK+ VRSPIVA
Sbjct  666  GLKVSVSPDRLEFSDKYEKKSYKLRIESQTLMKDSLVYGSLTWIESSGKYQVRSPIVA  723



>ref|XP_007017195.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14420.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=760

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +   ASPLAMGAGHINPN+ALDPGLIYD + +DY+NL+C L FT    +TI +
Sbjct  578  PIKDTGDNLRPASPLAMGAGHINPNKALDPGLIYDATVEDYVNLLCGLNFTAEQIKTITK  637

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SS NCSNP+LDLNYPSFIAFF       +   V+EF RT+TN+G+G STY A +TPI  
Sbjct  638  -SSNNCSNPALDLNYPSFIAFFNDRDAKRNSKTVKEFQRTVTNVGEGSSTYKATVTPING  696

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            V VTV PD+LVF +K+DK+++KL +EAPS + + + FG LTW +  GKHVVRSPIVA
Sbjct  697  VKVTVEPDQLVFKEKNDKKNFKLSVEAPSQLDEAVSFGYLTWEDIGGKHVVRSPIVA  753



>ref|XP_006386505.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
 gb|ERP64302.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
Length=739

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI DIGF N    ASPLAMGAG +NPN+ALDPGLIYDV+S DY+ L+CALKFT    Q I
Sbjct  553  PINDIGFGNKTQLASPLAMGAGQVNPNKALDPGLIYDVNSNDYVRLLCALKFTEKQIQAI  612

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS NCSNPS DLNYPSFIA+F A  + S+   V+EF RT+TN+G  +STY+  +TP+
Sbjct  613  TRSSSTNCSNPSTDLNYPSFIAYFNAKDSPSNLTTVREFQRTVTNVGAEMSTYTVNVTPM  672

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V+V+PDKL F  K +K SYKL IE P+ + + + FG L+WV+  GKH+VRSPIV+
Sbjct  673  IGLKVSVIPDKLEFRAKYEKLSYKLIIEGPALLDETVTFGYLSWVDVGGKHIVRSPIVS  731



>ref|XP_011017184.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=772

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 132/179 (74%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI DIGF N    ASPLAMGAG +NPN+ALDPGLIYDV+S DY+ L+CALKFT    Q I
Sbjct  586  PINDIGFGNKTHPASPLAMGAGQVNPNKALDPGLIYDVNSNDYVRLLCALKFTEKQIQAI  645

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS NCSNPS DLNYPSFIA+F A  + S+   V+EFHRT+TN+G  +STY+  +TP+
Sbjct  646  TRSSSTNCSNPSTDLNYPSFIAYFNAKDSPSNLTTVREFHRTVTNVGAEMSTYTVNMTPM  705

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V+V+PDKL F  K +K SYKL IE P+ + + + FG L WV+  GKH+V SPIV+
Sbjct  706  IGLKVSVIPDKLEFKAKYEKLSYKLIIEGPALLDETVTFGYLRWVDVGGKHIVSSPIVS  764



>gb|KDO84130.1| hypothetical protein CISIN_1g004809mg [Citrus sinensis]
Length=729

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 6/177 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG DN  A+P+AMGAGHINP++ALDPGLIYD +++DY++L+CAL  T    QTI R+
Sbjct  547  IKDIGDDNKPATPIAMGAGHINPDKALDPGLIYDATTEDYVSLLCALNLTMKRIQTITRS  606

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
             S NCS  SLDLNYPSFIAFF AN + S    VQEF RT+TN+G+G+STY+A +TP+   
Sbjct  607  YSVNCSTSSLDLNYPSFIAFFNANESKS----VQEFQRTVTNVGEGVSTYTASVTPLKGF  662

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGD--FLVFGSLTWVENAGKHVVRSPIV  229
            N +V PDKL F  K  KQSYKLRIE P+ M +   + F  L+W+E  GKHVV+SPIV
Sbjct  663  NFSVDPDKLTFKGKYAKQSYKLRIEGPNQMDEETVVAFCYLSWIETGGKHVVKSPIV  719



>ref|XP_006434738.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
 gb|ESR47978.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
Length=729

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 132/177 (75%), Gaps = 6/177 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG DN  A+P+AMGAGHINP++ALDPGLIYD +++DY++L+CAL  T    QTI R+
Sbjct  547  IKDIGDDNKPATPIAMGAGHINPDKALDPGLIYDATTEDYVSLLCALNLTMKRIQTITRS  606

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
             S NCS  +LDLNYPSFIAFF AN + S     QEF RT+TN+G+G+STY+A +TP+   
Sbjct  607  YSVNCSTSALDLNYPSFIAFFNANESKS----AQEFQRTVTNVGEGVSTYTASVTPLKGF  662

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGD--FLVFGSLTWVENAGKHVVRSPIV  229
            NV+V PDKL F  K  KQSYKLRIE P+ M +   + F  L+W+E  GKHVV+SPIV
Sbjct  663  NVSVDPDKLTFKGKYAKQSYKLRIEGPNQMDEETVVAFCYLSWIETGGKHVVKSPIV  719



>ref|XP_008393790.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=766

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG     ASPLA+GAGH+NPN+ALDPGLIYD   +DY+NL+CAL +T    QTI +
Sbjct  585  PIKDIGDAYQPASPLAIGAGHVNPNKALDPGLIYDAKIEDYVNLLCALNYTNKQIQTITK  644

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             +S NCS PSLDLNYPSFIAFF +N   SD     EF RT+TNLG G STY A LTP+  
Sbjct  645  YASNNCSTPSLDLNYPSFIAFFNSNKKHSDVQTTHEFRRTVTNLGKGPSTYVASLTPLKG  704

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+KL FT+  +K S+ + I+ P  M + +VFGSL+WVE+ G+HVVRSP+VA
Sbjct  705  FVVGVVPEKLEFTEVGEKLSFVMSIKGPRVMKETVVFGSLSWVESGGEHVVRSPVVA  761



>emb|CDP17956.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 128/177 (72%), Gaps = 3/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI DIG DN AA+PLAMG GH+NPN+ALDPGLIYD   +DY+NL+CAL +  +  QT+ R
Sbjct  539  PITDIGSDNEAANPLAMGTGHLNPNKALDPGLIYDAGIEDYVNLLCALNYNSSQIQTVTR  598

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SS+NCS PSLDLNYPSFIA+F A+   S     QEF RT+TN+G  +S Y AKL P+  
Sbjct  599  SSSHNCSKPSLDLNYPSFIAYFAASGNRS---TTQEFSRTVTNIGSEMSVYVAKLVPLDG  655

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V+V PD L F +K +K+SYKL IE  S + + LVFG L+W +  G HVVRSPIVA
Sbjct  656  FKVSVTPDTLSFRQKYEKKSYKLTIEGFSVLKNSLVFGYLSWEDTGGNHVVRSPIVA  712



>ref|XP_004514928.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=712

 Score =   215 bits (547),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 131/177 (74%), Gaps = 7/177 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG  N AA+PLAMGAGH+NPNRALDPGL+YD   QDY+NL+CAL FT     TI R
Sbjct  536  PIKDIGDGNNAATPLAMGAGHVNPNRALDPGLVYDAGVQDYVNLLCALNFTQQQITTITR  595

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SS +CS PSLD+NYPSFIAFF +  + S    +QEFHRT+TNLG+G + Y A +TPI  
Sbjct  596  SSSNDCSKPSLDINYPSFIAFFNSEKSSS----IQEFHRTVTNLGEGKTVYVASVTPIKG  651

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDF-LVFGSLTWVENAGKHVVRSPIV  229
             NVTV+P+KL F +K++K SYKLRIE   T  +  + FG LTW  N  KHVVRSPIV
Sbjct  652  FNVTVIPNKLTFNQKNEKMSYKLRIENTGTTKEKNVAFGFLTW--NDVKHVVRSPIV  706



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            P++DIGF NA A+PL MGAG +NPN+ALDPGL+YDV++ DY+ L+CAL FT    Q I +
Sbjct  535  PVRDIGFKNAPATPLGMGAGQVNPNKALDPGLVYDVNTSDYVKLLCALNFTQKQIQIITK  594

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            T++ +CS+PSLDLNYPSF+ FF  N +  +P +V EFHRT+ N+GD  +TY+AKLT + +
Sbjct  595  TANNDCSSPSLDLNYPSFLGFF-NNESEPNPRKVVEFHRTVMNVGDAAATYTAKLTQLNH  653

Query  396  -VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
             +NVTVVP+KLVF  ++ K S+KL IE P  + + +VFG L+WVE+ GKH+V+SPI
Sbjct  654  GLNVTVVPNKLVFKSRNQKLSFKLVIEGPRKVDEDIVFGYLSWVESNGKHIVKSPI  709



>gb|KEH18576.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 130/176 (74%), Gaps = 5/176 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG DN AA+P A+GAGHINPN+ALDPGL+YD+  QDY+N +CAL FT  H   I R+
Sbjct  585  IKDIGKDNIAATPFALGAGHINPNKALDPGLVYDIGVQDYVNFLCALNFTQKHITAITRS  644

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CSNPSL LNYPSFIAFF  NA  S P   QEFHRT+TN+G+G + Y A +TPI   
Sbjct  645  SSNDCSNPSLHLNYPSFIAFF--NAGNSSPRTAQEFHRTVTNVGEGQTVYVASITPIEGF  702

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIV  229
            NV V+P++LVF +K++K SY+LRIE    T  + L FG LTW    GKHVVRSPIV
Sbjct  703  NVGVIPNRLVFNEKNEKLSYRLRIEHRRMTQKNELSFGYLTWKN--GKHVVRSPIV  756



>ref|XP_008351993.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=764

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG     ASPLA+GAGH+NPN+ALDPGLIYD   +DY+NL+CAL +T    QTI +
Sbjct  583  PIKDIGDAYQPASPLAIGAGHVNPNKALDPGLIYDAKIEDYVNLLCALNYTNKQIQTITK  642

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             +S NCS PSLDLNYPSFIAFF +N   SD     EF RT+TNLG G STY A +TP+  
Sbjct  643  YASNNCSTPSLDLNYPSFIAFFNSNNKHSDVQTTHEFRRTVTNLGRGPSTYVASVTPLKG  702

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+KL FT+  +K S+ + I+ P  M + +VFGSL+WVE+ G+HVVRSP+VA
Sbjct  703  FVVGVVPEKLEFTEVGEKLSFVMSIKGPRVMKEAVVFGSLSWVESGGEHVVRSPVVA  759



>ref|XP_004514927.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=762

 Score =   214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 134/177 (76%), Gaps = 7/177 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG  N AA+PLAMGAGH+NPNRALDPGL+YDV  QDY+NL+CAL FT     TI R
Sbjct  584  PIKDIGNGNNAATPLAMGAGHVNPNRALDPGLVYDVGVQDYVNLLCALNFTQQQITTITR  643

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SS +CS PSLDLNYPSFIAFF A     + +  QEFHRT+TN+G+G + Y A +TPI  
Sbjct  644  SSSNDCSKPSLDLNYPSFIAFFNAK----NSSSTQEFHRTVTNVGEGQTIYVANITPIKG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIV  229
            ++V+V+P+KLVF +K++K S+KLRIE P  T    + FG LTW++   KHVVRSPIV
Sbjct  700  LSVSVMPNKLVFNEKNEKLSFKLRIEVPRMTKVKKVAFGYLTWMDV--KHVVRSPIV  754



>ref|XP_002510195.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52382.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (79%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +N  ASPL MGAG +NP++ALDPGLIYD+ S DY+ L+CAL FT    Q I R
Sbjct  584  PIKDIGNNNQPASPLDMGAGQVNPSKALDPGLIYDLKSTDYVKLLCALNFTEKQIQIITR  643

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SS +CS+PSLDLNYPSFIAFF  N+ +S  + VQEFHRT+TN+G+G+STY+A LTPI  
Sbjct  644  SSSNDCSSPSLDLNYPSFIAFF--NSNVSKSSTVQEFHRTVTNVGEGMSTYTANLTPING  701

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V+VVPDKL F  K++K SYKL IE P+ + + ++FG L+WV++ GKH V+SPIVA
Sbjct  702  LKVSVVPDKLEFKAKNEKLSYKLVIEGPTMLKESIIFGYLSWVDDEGKHTVKSPIVA  758



>ref|XP_004291093.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=767

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASPLAMGAGH+NPN+AL+PGLIYD +  DY+NL+CAL +T  H Q I  
Sbjct  576  PIKDIGDDLQPASPLAMGAGHVNPNKALNPGLIYDATIDDYVNLLCALNYTQKHIQIITG  635

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++S NCS PSLDLNYPSFIAFF AN ++S     QEF RT+TN+G G STY A +T +  
Sbjct  636  SASNNCSTPSLDLNYPSFIAFFNANDSMSGVQATQEFKRTVTNVGKGQSTYVASVTAMKG  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+KLVF ++ +K S+K+ I     M +   FG LTWV++ G+HVVRSPIVA
Sbjct  696  FEVGVVPNKLVFGREGEKLSFKMSIRGRRLMEETEAFGYLTWVDSEGQHVVRSPIVA  752



>ref|XP_009359804.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=765

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG    +ASPLA+GAGH+NPN+ALDPGLIYD   +DY+NL+CAL +T    QTI +
Sbjct  584  PIKDIGDAYQSASPLAIGAGHVNPNKALDPGLIYDAKIEDYVNLLCALNYTNKQIQTITK  643

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             +S +CS PSLDLNYPSFIAFF +N   SD     EF RT+TNLG G STY A + P+  
Sbjct  644  YASNDCSTPSLDLNYPSFIAFFNSNKRHSDVQTTHEFRRTVTNLGKGPSTYVASVAPLKG  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+KL FT+   K S+ + I+ P  M + +VFGSL+WVE+ G+HVVRSP+VA
Sbjct  704  FVVGVVPEKLEFTEVGQKLSFVMSIKGPRVMKEAVVFGSLSWVESEGEHVVRSPVVA  760



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +N  A+PLAMGAGHI+PN+ALDPGLIYD SS+DYINL+CAL FT    QTI R
Sbjct  573  PIKDSGSNNKPATPLAMGAGHIDPNKALDPGLIYDASSEDYINLLCALNFTAKQIQTITR  632

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++SY+C NPSLDLNYPSFIA+F  N T S    V+EF RT+TN+GD  S Y AKLT +  
Sbjct  633  STSYDCKNPSLDLNYPSFIAYFNTNDTNSTSTTVKEFQRTVTNIGDENSIYIAKLTALDG  692

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V+V P +L F+KK +K+SYKLRIE P  M D L+ GSLTW++++GK+ VRSPIVA
Sbjct  693  LKVSVSPGRLEFSKKYEKKSYKLRIEGPGLMRDGLIHGSLTWIDSSGKYSVRSPIVA  749



>ref|XP_007135313.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
 gb|ESW07307.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
Length=744

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG     ASPLAMGAGHINPN+ALDPGL+YDV +QDY+NL+CA+ FT  + + I R+
Sbjct  570  IRDIGEGEKPASPLAMGAGHINPNKALDPGLVYDVGAQDYVNLLCAMNFTQENIKAITRS  629

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSYNCS PSLDLNYPSFIAFF  N +  +     EF RT+T  G+G ++Y+A +TPI   
Sbjct  630  SSYNCSKPSLDLNYPSFIAFF--NDSSKESTLTWEFVRTVTYFGEGQTSYTASITPIKGF  687

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            NV+++P+KLVF +K++KQSYKLRIE P   G    FG +TW +   KHVVRSPIV
Sbjct  688  NVSIIPNKLVFKEKNEKQSYKLRIEGPKIEG----FGYITWTDV--KHVVRSPIV  736



>ref|XP_006374913.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52710.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+DIGF N    A+PL MGAG +NPN+ALDPGLIYDV+S DY+ L+CA  FT    Q I
Sbjct  586  PIKDIGFGNRINPATPLDMGAGQVNPNKALDPGLIYDVNSTDYVRLLCATNFTEKQIQVI  645

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS +CSNPS DLNYPSFIA+F    + S+   V+EFHRT+TN+G+G   Y+A +TP+
Sbjct  646  TRSSSIDCSNPSSDLNYPSFIAYFNDKKSPSNLTIVREFHRTVTNVGEGTCIYTASVTPM  705

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + + V+PDKL F  K +K SYKL IE P+ + + + FGSL W +  GKHVVRSPI A
Sbjct  706  SGLKINVIPDKLEFKTKYEKLSYKLTIEGPALLDETVTFGSLNWADAGGKHVVRSPIAA  764



>ref|XP_006374911.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52708.1| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+DIG  N    ASPL MGAG +NPN+ALDPGLIYD +S DY+ L+CA  FT    Q I
Sbjct  585  PIKDIGSGNRINPASPLDMGAGQVNPNKALDPGLIYDANSTDYVRLLCATNFTEKEIQVI  644

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS +CSNPS DLNYPSFIA+F    + S+   V+EFHRT+TN+G+GISTY+  +TP+
Sbjct  645  TRSSSTDCSNPSSDLNYPSFIAYFNERFSPSNLTTVREFHRTVTNVGEGISTYTVSVTPM  704

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V V+PDKL F  K +K SYKL IE P+ + + + FG L+W +  GKHVVRSPIVA
Sbjct  705  SGLKVNVMPDKLEFKTKYEKLSYKLTIEGPALLDEAVTFGYLSWADAGGKHVVRSPIVA  763



>ref|XP_011029640.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+DIG  N    ASPLAMGAG +NPN+ALDPGLIYD +S DY+ L+CA  FT    Q I
Sbjct  585  PIKDIGSGNRINPASPLAMGAGQVNPNKALDPGLIYDANSTDYVRLLCATNFTEKQIQVI  644

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS +CSNPS DLNYPSFIA+F    + S+   V+EFHRT+TN+G+GISTY+  +TP+
Sbjct  645  TRSSSTDCSNPSTDLNYPSFIAYFNERFSPSNLTSVREFHRTVTNVGEGISTYTVSVTPM  704

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V V+PDKL F  K +K SYKL I  P+ + + + FG L+W +  GKHVVRSPIVA
Sbjct  705  SGLKVNVMPDKLEFKTKYEKLSYKLTIVGPALLDEAVTFGYLSWADAGGKHVVRSPIVA  763



>ref|XP_010059918.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66394.1| hypothetical protein EUGRSUZ_F00208 [Eucalyptus grandis]
Length=768

 Score =   210 bits (535),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASPLA+GAGH++PN+ALDPGLIYD + QDYINL+CA+ +T    QT+ R
Sbjct  582  PIKDIGDDYKPASPLAIGAGHVDPNKALDPGLIYDATPQDYINLMCAMNYTSKQIQTVTR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCS+ S+DLNYPSFIAFF  N++ S    VQEF RT+TN+GDG STY AK+TP+  
Sbjct  642  SSSYNCSDSSMDLNYPSFIAFFSPNSSGS--LMVQEFFRTVTNVGDGPSTYIAKVTPMEG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V PDKL F +K +K  YKL IE P  M + LVFGSL+W++N GKHVV+SPIVA
Sbjct  700  FKIEVAPDKLTFKEKYEKLRYKLTIEGPKQMNEPLVFGSLSWMDNGGKHVVKSPIVA  756



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIGF+N  A+PLA+G+GHINPN+ALDPGLIYDV  QDY+N++CAL +T  H + I +
Sbjct  581  PIKDIGFNNQPATPLAIGSGHINPNKALDPGLIYDVEIQDYVNVLCALNYTVEHIKVITK  640

Query  576  TSSY-NCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +SS  +CS PSLDLNYPSFIAFF AN + SD   V++F RT+TN+G+G STY A +T + 
Sbjct  641  SSSLVDCSKPSLDLNYPSFIAFFNANDSKSDAKTVKDFQRTVTNVGEGKSTYIASVTSME  700

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             + V VVP KLVF +K++K+ +KL IE P  M   +VFG LTWV+N  KHVVRSPIVA
Sbjct  701  GLKVNVVPKKLVFKEKNEKKKFKLSIEGPRMMKQRVVFGYLTWVDNDNKHVVRSPIVA  758



>gb|ABK95622.1| unknown [Populus trichocarpa]
Length=778

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 128/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+DIG  N    ASPL MGAG +NPN+ALDPGLIYD +S DY+ L+CA  FT    Q I
Sbjct  585  PIKDIGSGNRINPASPLDMGAGQVNPNKALDPGLIYDANSTDYVRLLCATNFTEKEIQVI  644

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS +CSNPS DLNYPSFIA+F    + S+   V EFHRT+TN+G+GISTY+  +TP+
Sbjct  645  TRSSSTDCSNPSSDLNYPSFIAYFNERFSPSNLTTVCEFHRTVTNVGEGISTYTVSVTPM  704

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V V+PDKL F  K +K SYKL IE P+ + + + FG L+W +  GKHVVRSPIVA
Sbjct  705  SGLKVNVMPDKLEFKTKYEKLSYKLTIEGPALLDEAVTFGYLSWADAGGKHVVRSPIVA  763



>ref|XP_008220244.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG     ASPLAMGAGH+NPN+ALDPGLIYD   +DYINL+CAL +T    QTI +
Sbjct  579  PIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDADIEDYINLLCALNYTNKQIQTITK  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++S NCS+PSLDLNYPSFIAFF AN +  D    QEF RT+T +G G STY A +TP+  
Sbjct  639  SASNNCSSPSLDLNYPSFIAFFNANDSKPDVQTTQEFRRTVTYIGKGQSTYVASVTPLKG  698

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+ L F K+ +K S+ L I+ P    + + FG LTW E+ G+HVVRSP+VA
Sbjct  699  FEVAVVPNTLKFKKEGEKLSFVLIIKGPRRTKETVAFGYLTWAESGGEHVVRSPVVA  755



>gb|KJB63881.1| hypothetical protein B456_010G021600 [Gossypium raimondii]
Length=764

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 125/177 (71%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +   A PLAMGAGH+NPN+AL+PGLIYD + QDY++L+C L FT    +TI +
Sbjct  581  PIKDIGGNLRPADPLAMGAGHVNPNKALNPGLIYDATVQDYVDLLCGLNFTQQQIKTITK  640

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            TSS NCSNPSLDLNYPSFIAFF       +   V EF RT+TN+GDG  TY A +TPI  
Sbjct  641  TSSNNCSNPSLDLNYPSFIAFFNDRGAKPNSTTVVEFGRTVTNVGDGSFTYKANVTPING  700

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V PD LVF  K +K+SYKL IE P  +   ++FG LTW ++  +HVV SPIVA
Sbjct  701  LKVIVEPDTLVFKTKYEKKSYKLSIEGPKQLHKAVLFGYLTWEDSGKEHVVTSPIVA  757



>ref|XP_011029618.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=775

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAA--ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+DIGF N    A+PL MGAG +NPN+ALDPGLIYDV+S DY+ L+CA  FT    Q I
Sbjct  586  PIKDIGFGNRINPATPLDMGAGQVNPNKALDPGLIYDVNSTDYVRLLCATNFTEKQIQVI  645

Query  582  IRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
             R+SS +CSNPS DLNYPSFIA+F    + S+   V+EFHRT+TN+G+G  TY+  +TP+
Sbjct  646  TRSSSTDCSNPSSDLNYPSFIAYFNEKNSPSNLTIVREFHRTVTNVGEGTCTYTVSVTPM  705

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V V+PDKL F  K +K SYKL IE P+ + + + FG L W +  GKHVV+SPI A
Sbjct  706  SGLKVNVMPDKLEFKTKYEKLSYKLTIEGPALLDETVTFGYLNWADAGGKHVVKSPIAA  764



>ref|XP_007221958.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
 gb|EMJ23157.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
Length=767

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 125/177 (71%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG     ASPLAMGAGH+NPN+ALDPGLIYD   +DYINL+CAL +T    QTI +
Sbjct  579  PIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDAEIEDYINLLCALNYTNKQIQTITK  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++S NCS PSLDLNYPSFIAFF AN +  +    QEF RT+T +G G STY A +TP+  
Sbjct  639  SASNNCSTPSLDLNYPSFIAFFNANDSKPNVQTTQEFRRTVTYIGKGQSTYVASVTPLKG  698

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+ L F ++ +K S+ L I+ P    + L FG LTW E+ G+HVVRSP+VA
Sbjct  699  FEVAVVPNTLKFKEEGEKLSFVLSIKGPRRTKETLAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_008221259.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 125/177 (71%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG     ASPLAMGAGH+NPN+ALDPGLIYD   +DYINL+CAL +T    QTI +
Sbjct  579  PIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDADIEDYINLLCALNYTNKQIQTITK  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++S NCS+PSLDLNYPSFIAFF AN +  D    QEF RT+T +G G STY A +TP+  
Sbjct  639  SASNNCSSPSLDLNYPSFIAFFNANDSKPDVQTTQEFRRTVTYIGKGQSTYVASVTPLKG  698

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+   F ++ +K S+ L I+ P    + + FG LTW E+ G+HVVRSP+VA
Sbjct  699  FEVAVVPNTFKFKEEGEKLSFVLSIKGPRRTKETVAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_008220243.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 124/177 (70%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG     ASPLAMGAGH+NPN+ALDPGLIYD   +DYINL+CAL +T    QTI +
Sbjct  579  PIKDIGDGYQPASPLAMGAGHVNPNKALDPGLIYDADIEDYINLLCALNYTNKQIQTITK  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++S NCS PSLDLNYPSFIAFF  N +  D    QEF RT+T +G G STY A +TP+  
Sbjct  639  SASNNCSTPSLDLNYPSFIAFFNTNDSKPDVQTTQEFRRTVTYIGKGQSTYVASVTPLKG  698

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              V VVP+ L F ++ +K S+ L I+ P    + + FG LTW E+ G+HVVRSP+VA
Sbjct  699  FEVAVVPNTLKFKEEGEKLSFVLSIKGPRRTKETVAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_002523603.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38798.1| Cucumisin precursor, putative [Ricinus communis]
Length=373

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 132/178 (74%), Gaps = 3/178 (2%)
 Frame = -2

Query  756  PIQDIG-FDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D+   D A  SP+ +G+GHI+PN++LDPGLIYD S +DYI L+CA+ +T    + I 
Sbjct  189  PIKDVSNKDLAPGSPIDVGSGHIDPNKSLDPGLIYDASVEDYIELLCAMNYTEKQIRNIT  248

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            + S+++C N SLDLNYPSFIA+F  N + S    V EF RT+TN+G+ IS+Y+AKLTP+ 
Sbjct  249  K-STHSCLNKSLDLNYPSFIAYFIGNDSDSG-KTVHEFQRTVTNVGEAISSYTAKLTPMK  306

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             + V+VVP KLVF KK +K SYKL +E P +M + +V GSL+WV + GK+VVRSPIVA
Sbjct  307  GIKVSVVPKKLVFRKKYEKLSYKLTLEGPKSMKEDVVHGSLSWVHDEGKYVVRSPIVA  364



>gb|KHN15886.1| Subtilisin-like protease [Glycine soja]
Length=712

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 7/176 (4%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D+G D   A+PLAMGAGH+NPNRALDPGL+YDV  QDY+NL+CAL +T  +   I  T
Sbjct  535  IKDVGDDYKPATPLAMGAGHVNPNRALDPGLVYDVGVQDYVNLLCALGYTQKNITVITGT  594

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFIAFF +N++    +  QEF RT+TN+G+G + Y A +TP+   
Sbjct  595  SSNDCSKPSLDLNYPSFIAFFKSNSS----STTQEFERTVTNVGEGQTIYVASVTPVKGY  650

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDF-LVFGSLTWVENAGKHVVRSPIV  229
            +V+V+P KLVF +K++KQSYKLRIE P    +  + FG LTW +   KHV+RSPIV
Sbjct  651  HVSVIPKKLVFKEKNEKQSYKLRIEGPRKKKEKNVAFGYLTWTDL--KHVIRSPIV  704



>ref|XP_003548151.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=750

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 7/176 (4%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D+G D   A+PLAMGAGH+NPNRALDPGL+YDV  QDY+NL+CAL +T  +   I  T
Sbjct  573  IKDVGDDYKPATPLAMGAGHVNPNRALDPGLVYDVGVQDYVNLLCALGYTQKNITVITGT  632

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFIAFF +N++    +  QEF RT+TN+G+G + Y A +TP+   
Sbjct  633  SSNDCSKPSLDLNYPSFIAFFKSNSS----STTQEFERTVTNVGEGQTIYVASVTPVKGY  688

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDF-LVFGSLTWVENAGKHVVRSPIV  229
            +V+V+P KLVF +K++KQSYKLRIE P    +  + FG LTW +   KHV+RSPIV
Sbjct  689  HVSVIPKKLVFKEKNEKQSYKLRIEGPIKKKEKNVAFGYLTWTDL--KHVIRSPIV  742



>gb|KEH18575.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 130/176 (74%), Gaps = 5/176 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG DN AA+P A+GAGH+NPNRALDPGLIYDV  QDY+NL+CAL ++  +   I R+
Sbjct  586  IKDIGNDNKAATPFALGAGHVNPNRALDPGLIYDVGVQDYVNLLCALSYSQKNITAITRS  645

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFIAFF      S     QEFHRT+TN+G+G + Y + +T +   
Sbjct  646  SSNDCSEPSLDLNYPSFIAFFDNGN--SSSRTTQEFHRTITNVGEGETVYVSSITQVEGF  703

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIE-APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V+V+P+KLVF +K++K SYKLRIE A +T    + FG LTW++   KHVVRSPIV
Sbjct  704  HVSVIPNKLVFNEKNEKLSYKLRIEVARTTKMKKVAFGYLTWMDT--KHVVRSPIV  757



>ref|XP_008357385.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG+ N  ASPLA+GAGH+NPN+ALDPGL+YDV+  DY+NL+CAL +T    QTI +
Sbjct  583  PIKDIGYANQPASPLAIGAGHVNPNKALDPGLLYDVNIDDYVNLLCALNYTNKQIQTITK  642

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + S NCS PSLDLNYPSFIAFF +N + SD     EF RT+ N+G G+STY A +TP+  
Sbjct  643  SXSNNCSTPSLDLNYPSFIAFFNSNDSNSDVQSTHEFRRTVXNIGKGLSTYVASVTPLKG  702

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKH  250
              V VVP KL F ++ +K S+ L I+ P  M + +VFG L+WVE+ G+H
Sbjct  703  FVVGVVPKKLEFKEEGEKLSFVLSIKGPRVMKEAVVFGYLSWVESGGQH  751



>ref|XP_002523602.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38797.1| Cucumisin precursor, putative [Ricinus communis]
Length=665

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -2

Query  756  PIQDIG-FDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D+   D    SP+ +G+GHI+PN++LDPGLIYD +++DY+ L+CA+ +T    Q II
Sbjct  480  PIKDVSNIDLGPGSPIDIGSGHIDPNKSLDPGLIYDAAAEDYVKLLCAMNYTEKQIQ-II  538

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
              S+YNC+N SLDLNYPSFIA+F    + S+   V EF RT+TN+G+ +S+Y+AKLTP+ 
Sbjct  539  TNSTYNCANQSLDLNYPSFIAYFLGGDSDSE-KIVHEFQRTVTNVGEAVSSYTAKLTPMN  597

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             +NVTV P KLVF K+ +K SYKL +E P +M + +V GSL+WV + GK+VVRSPIVA
Sbjct  598  GINVTVEPKKLVFNKQYEKLSYKLTLEGPKSMKEDVVHGSLSWVHDEGKYVVRSPIVA  655



>gb|KCW66392.1| hypothetical protein EUGRSUZ_F00206 [Eucalyptus grandis]
Length=756

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 14/177 (8%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG D   ASP+ MGAGH++PN+ALDPGLIYDV+ QDY+NL+CA+ +T    Q + R
Sbjct  582  PIKDIGNDYKPASPVGMGAGHVDPNKALDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCSNPSLDLNYPSFIAFF +N+  SD   VQEF+RT+TN+G G STY A++ P+  
Sbjct  642  SSSYNCSNPSLDLNYPSFIAFFGSNS--SDSPMVQEFYRTVTNVGAGASTYRAEVNPMEG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
                         KK +K SYKL IE P  M   +V GSL+W+++ GK+ V+SPIVA
Sbjct  700  F------------KKYEKLSYKLTIEGPKQMKQTVVSGSLSWMDDGGKYAVKSPIVA  744



>ref|XP_003595551.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES65802.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG  N AA+P A+GAGHINPNRALDPGL+YD+  QDYINL+CAL FT  +   I R+
Sbjct  584  IKDIGNGNRAATPFALGAGHINPNRALDPGLVYDIGVQDYINLLCALNFTQKNISAITRS  643

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            S  +CS PSLDLNYPSFIAF  A  +    N   EFHRT+TN+G+  +TY A +TPI   
Sbjct  644  SFNDCSKPSLDLNYPSFIAFSNARNSSRTTN---EFHRTVTNVGEKKTTYFASITPIKGF  700

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIV  229
             VTV+P+KLVF KK++K SYKL+IE P  T  + + FG L+W +  GKHVVRSPIV
Sbjct  701  RVTVIPNKLVFKKKNEKISYKLKIEGPRMTQKNKVAFGYLSWRD--GKHVVRSPIV  754



>gb|KDP31945.1| hypothetical protein JCGZ_12406 [Jatropha curcas]
Length=569

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNA-AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D   D   AA+PL +GAGHI+PN+AL+PGLIYD  ++DYI  +CA+  T    Q I 
Sbjct  386  PIKDEADDKIPAATPLDIGAGHIDPNKALEPGLIYDAKTEDYIKFLCAMNLTKKQIQFIT  445

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNR-VQEFHRTLTNLGDGISTYSAKLTPI  403
            R+S +NC N SLDLNYPSFIA+F  + + S+    VQEF RT+TN+G+GIS Y+AKLT +
Sbjct  446  RSSHHNCLNKSLDLNYPSFIAYFTGDESKSNGKMVVQEFPRTVTNVGEGISNYTAKLTKM  505

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V+V P KL F KK++K  YKL IE P  + + +V+GSL+WV + GK+VVRSPIVA
Sbjct  506  NGIKVSVEPQKLAFKKKNEKLRYKLIIEGPKLLEEDVVYGSLSWVHDGGKYVVRSPIVA  564



>gb|KJB59847.1| hypothetical protein B456_009G275900 [Gossypium raimondii]
Length=746

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 125/177 (71%), Gaps = 1/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DIG +   A+PLAMGAGHINPN+ALDPG++YD + QDYI+ +C L FTP   +TI  
Sbjct  564  PIEDIGTNLQPATPLAMGAGHINPNKALDPGIVYDATVQDYIDFLCGLNFTPQQIKTIT-  622

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SS NCSNPSLDLNYPSFIA+F       D N V+EF RT+TN+G+G   Y A LT +  
Sbjct  623  GSSNNCSNPSLDLNYPSFIAYFNDRNVKPDSNTVKEFQRTVTNVGEGSFIYKASLTAMKG  682

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            V V+V PD LVF + ++K+S+KL IE P  +   + FG L W ++  KHVVRSPIVA
Sbjct  683  VKVSVEPDTLVFKEINEKKSFKLSIEGPRQLDKTVSFGYLIWEDSQRKHVVRSPIVA  739



>gb|KEH42928.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 130/176 (74%), Gaps = 6/176 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG D AA +P A+GAGH+NPNRALDPGL+YDV  QDY+NL+CALK++  +  TI R+
Sbjct  582  IKDIGTDKAA-TPFALGAGHVNPNRALDPGLVYDVGVQDYVNLLCALKYSQKNITTITRS  640

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFIAFF    + S P  +QEF RT+TN+GDG + Y A + PI   
Sbjct  641  SSNDCSKPSLDLNYPSFIAFFNDGNSSSRP--IQEFRRTVTNVGDGQAIYVASIAPIKGF  698

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIV  229
             VTV+P+ LVF +K++K SYKLRIE  S T    + FG LTW++   KHVVRSPIV
Sbjct  699  RVTVIPNNLVFNEKNEKLSYKLRIEVASMTKLKKVAFGYLTWMDV--KHVVRSPIV  752



>ref|XP_008785918.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=456

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 132/178 (74%), Gaps = 2/178 (1%)
 Frame = -2

Query  753  IQDIGF-DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            I+D+G+ D  AA+PLA+G+GHI PNRALDPGL+YD S++DY+ L+CA+K+T    + I +
Sbjct  271  IRDMGYADRPAATPLAIGSGHIEPNRALDPGLVYDASTEDYVRLLCAMKYTSKQIKMITK  330

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            T S++CS+ SLDLNYPSFIAFF  N T +    VQEF RT+TN+GD +++Y+AK+  +  
Sbjct  331  TYSFDCSHASLDLNYPSFIAFFNPNKTAASDKVVQEFRRTVTNVGDAMASYNAKVVAMKG  390

Query  396  VNVTVVPDKLVFTKKSDKQSYKL-RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + VVP+KLVF +K +K+S+ L  +       D ++ GSL+WV++ GK+VVRSPIVA
Sbjct  391  FAIRVVPEKLVFHEKYEKKSFALILVGQMGKKADEVLHGSLSWVDDKGKYVVRSPIVA  448



>gb|KEH18578.1| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG  N  A+P A GAGHINPN+AL+PGL+YDV  QDY+NL+CAL FT  +   I R+
Sbjct  549  IKDIGKGNNVATPFAQGAGHINPNKALNPGLVYDVGVQDYVNLLCALNFTQKNITIITRS  608

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            S+ +CS PSLDLNYPSFIAFF  NA  S     QEFHRT+TN+G G S Y A +T I   
Sbjct  609  STNDCSKPSLDLNYPSFIAFF--NAANSSSRTTQEFHRTITNVGQGKSIYVAHITRIEGF  666

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIE-APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V V+P+KLVF KK++K SYKLRIE A     + + FG LTW +  GKHVVRSPIV
Sbjct  667  HVRVIPNKLVFNKKNEKLSYKLRIEDARVAQKNEVSFGYLTWQD--GKHVVRSPIV  720



>ref|XP_002510196.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52383.1| Cucumisin precursor, putative [Ricinus communis]
Length=777

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+DI +    A+PL MG+G INPN+ALDPGLIYD +   YIN +CAL  T    QTI +
Sbjct  591  PIRDIDYGRQPATPLDMGSGQINPNKALDPGLIYDANLTSYINFLCALNLTQKQIQTITK  650

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + + +CS+PS DLNYPSF+A+F A+++ ++   VQE+HRT+TN+GD +STY+A LTPI  
Sbjct  651  SPNNDCSSPSSDLNYPSFLAYFNADSSEANLTAVQEYHRTVTNVGDPVSTYTANLTPING  710

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
            +  +VVP+KLVF  K +K SYKL I+ P+ + + +VFG L+WV++ GK+VV+SPI
Sbjct  711  IKASVVPNKLVFKAKYEKLSYKLSIQGPNPVPEDVVFGYLSWVDSKGKYVVKSPI  765



>ref|XP_003626594.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES82812.1| subtilisin-like serine protease [Medicago truncatula]
Length=765

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I DIG     ASPLA+GAGHINPNRALDPGL+YD   QDY+NL+CAL FT  +   I R+
Sbjct  583  ITDIGNGYRPASPLALGAGHINPNRALDPGLVYDAGKQDYVNLLCALNFTQKNIAAITRS  642

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            S  NCSNPSLDLNYPSFI+FF  NA++      QEF RT+TN+G+  + Y A +TPI   
Sbjct  643  SFNNCSNPSLDLNYPSFISFF-NNASVKSKVITQEFQRTVTNVGEEPTIYVANITPIEGF  701

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V+V+P+KLVF +K++K +YKLRIE P    + +VFG LTW ++  KH VRSPIV
Sbjct  702  HVSVIPNKLVFKEKNEKVAYKLRIEGPKMEENKVVFGYLTWTDS--KHNVRSPIV  754



>emb|CBI18429.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = -2

Query  732  NAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSN  553
            N+ A+PL MGAG INPN+AL+PGLIY+ ++QDYINL+C +K T    Q I R SS+ C N
Sbjct  378  NSPATPLDMGAGLINPNKALEPGLIYNATAQDYINLLCGMKLTKREIQVITRASSHKCLN  437

Query  552  PSLDLNYPSFIAFFPANATLSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVV  379
            PSLDLNYPSFIA+F  N   S PN   VQ F RTLTN+G+G S+Y+AKLTP+  + V V 
Sbjct  438  PSLDLNYPSFIAYF--NDVGSSPNEQIVQVFSRTLTNVGEGGSSYTAKLTPMEGLKVKVE  495

Query  378  PDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            P KLVF+ K +K SYKL +E P  M + +V G L+WV + GK+VVRSPIVA
Sbjct  496  PRKLVFSHKYEKLSYKLILEGPKWMEEDVVHGHLSWVSSDGKYVVRSPIVA  546



>ref|XP_008785921.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 134/181 (74%), Gaps = 6/181 (3%)
 Frame = -2

Query  756  PIQDIGF-DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D+G+ D  AA+PLA+G+GHI PNRALDPGL+YD S+ DY+ L+CA+K+T    +TI 
Sbjct  574  PIRDMGYADRPAATPLAIGSGHIEPNRALDPGLVYDASTDDYVRLLCAMKYTSKQIKTIT  633

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +T S++CS+ SLDLNYPSFIAFF  N T +    VQEF RT+TN+GD + TY+AK+  + 
Sbjct  634  KTYSFDCSHASLDLNYPSFIAFFNPNKTAASDEVVQEFRRTVTNVGDAVVTYNAKVVAMK  693

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMG---DFLVFGSLTWVENAGKHVVRSPIV  229
               + +VP+KLVF +K +K+S+ L +     MG   D ++ GSL+WV++ GK+VVRSPIV
Sbjct  694  GFAIRIVPEKLVFYEKYEKKSFALILVG--QMGKKDDEVLHGSLSWVDDKGKYVVRSPIV  751

Query  228  A  226
            A
Sbjct  752  A  752



>gb|KHN15890.1| Subtilisin-like protease [Glycine soja]
Length=757

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DI  D   ASPLA+G+GH NPN+ALDPGL+YDV  QDY+NL+CA+  T  +   I R+
Sbjct  577  IKDIADDYKPASPLALGSGHANPNKALDPGLVYDVGVQDYVNLLCAMSSTQQNISIITRS  636

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            S+ NCSNPSLDLNYPSFI FF +N + ++     EF RT+TN+G+  + YSA +TPI   
Sbjct  637  STNNCSNPSLDLNYPSFIGFFSSNGSSNESRVAWEFQRTVTNVGEKQTIYSANVTPIKGF  696

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            NV+VVP KLVF +K++K SYKLRIE P   G    FG LTW +   KH VRSPIV
Sbjct  697  NVSVVPSKLVFKEKNEKLSYKLRIEGPMVEG----FGYLTWTDM--KHAVRSPIV  745



>gb|KCW66398.1| hypothetical protein EUGRSUZ_F00212 [Eucalyptus grandis]
Length=728

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G     ASPLAMGAGH+NPN+ALDPGLIYDV+ QDY++L+CA+ +T    Q + R
Sbjct  542  PIKDSGSGFEPASPLAMGAGHVNPNKALDPGLIYDVTPQDYVDLMCAMNYTSKQIQIVTR  601

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCS+ SLDLNYPSFIAFF +N+ +S     QEF RT+TN+GDG STY AK+TP+  
Sbjct  602  SSSYNCSDSSLDLNYPSFIAFFSSNSLVSP--TAQEFFRTVTNVGDGPSTYVAKVTPMEG  659

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V PDKL F +K +K  YKL IE P  M   L+FGS++W++  GK+VV+SPIVA
Sbjct  660  YKINVKPDKLTFKEKYEKLRYKLTIEGPKQMNQKLMFGSVSWMDKGGKYVVKSPIVA  716



>gb|KEH18574.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DI   N  A+PLA+GAG+++PNRALDPGL+YDV  QDY+NL+CAL FT  +  TI R+
Sbjct  584  IKDIEKGNEVATPLALGAGYVDPNRALDPGLVYDVGVQDYVNLLCALNFTQKNITTITRS  643

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            S  +CS PSLDLNYPSFIAFF  NA  S    +QEFHRT+TN+G+G + Y A + P+   
Sbjct  644  SFNDCSKPSLDLNYPSFIAFF--NAGNSSSRAIQEFHRTVTNVGEGQAIYVASIMPVEGY  701

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIV  229
             V+ +P+KL+F KK++  SYKLRIE P  T  + + FG +TW +  GKHVVRSPIV
Sbjct  702  RVSAIPNKLMFNKKNEMLSYKLRIEGPRMTQNNEVAFGYITWQD--GKHVVRSPIV  755



>ref|XP_010059919.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=766

 Score =   199 bits (507),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G     ASPLAMGAGH+NPN+ALDPGLIYDV+ QDY++L+CA+ +T    Q + R
Sbjct  580  PIKDSGSGFEPASPLAMGAGHVNPNKALDPGLIYDVTPQDYVDLMCAMNYTSKQIQIVTR  639

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SSYNCS+ SLDLNYPSFIAFF +N+ +S     QEF RT+TN+GDG STY AK+TP+  
Sbjct  640  SSSYNCSDSSLDLNYPSFIAFFSSNSLVSP--TAQEFFRTVTNVGDGPSTYVAKVTPMEG  697

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V PDKL F +K +K  YKL IE P  M   L+FGS++W++  GK+VV+SPIVA
Sbjct  698  YKINVKPDKLTFKEKYEKLRYKLTIEGPKQMNQKLMFGSVSWMDKGGKYVVKSPIVA  754



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   199 bits (506),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI  +      A+PL+MGAGHINPN+ALDPGLIYD ++QDY  L+CAL +T      I R
Sbjct  585  PITQVVDKERPATPLSMGAGHINPNKALDPGLIYDANAQDYARLLCALNYTREQMNKITR  644

Query  576  TSS-YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +SS +NC NPSLDLNYPSFIA    +    D   ++EF RT+TN+GDG++ Y+A+LTPI 
Sbjct  645  SSSGHNCLNPSLDLNYPSFIALLRDDLP-PDAKVIREFRRTVTNVGDGMAEYTAELTPID  703

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
               + V PD+LVF  K +KQSYKL +E P ++   +V GSL WVE  G+HVVRSPIVA
Sbjct  704  GFRLKVEPDRLVFKDKYEKQSYKLTLEGPGSVESGVVHGSLNWVEVGGRHVVRSPIVA  761



>ref|XP_011043530.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=757

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+  +N  A+P+ +G+GHINPN++LDPGLIYD +++DYI  +CA+ +T    Q I R
Sbjct  576  PIKDVSNNNLPATPIDIGSGHINPNKSLDPGLIYDATAEDYIRFLCAMNYTNKQIQIITR  635

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S ++C N SLDLNYPSFIA+F +  + S    V +F RTLTN+G+ +S+Y+AKL  +  
Sbjct  636  SSHHDCKNRSLDLNYPSFIAYFESYDSGSKEKVVHKFQRTLTNVGERMSSYTAKLLGMDG  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V+V P KLVF K+ +K SY L +E P ++ + +V GSL+WV + GK+VVRSPIVA
Sbjct  696  IKVSVEPQKLVFNKEHEKLSYTLTLEGPKSLKEDIVHGSLSWVHDGGKYVVRSPIVA  752



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = -2

Query  732  NAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSN  553
            N+ A+PL MGAG INPN+AL+PGLIY+ ++QDYINL+C +K T    Q I R SS+ C N
Sbjct  586  NSPATPLDMGAGLINPNKALEPGLIYNATAQDYINLLCGMKLTKREIQVITRASSHKCLN  645

Query  552  PSLDLNYPSFIAFFPANATLSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVV  379
            PSLDLNYPSFIA+F  N   S PN   VQ F RTLTN+G+G S+Y+AKLTP+  + V V 
Sbjct  646  PSLDLNYPSFIAYF--NDVGSSPNEQIVQVFSRTLTNVGEGGSSYTAKLTPMEGLKVKVE  703

Query  378  PDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            P KLVF+ K +K SYKL +E P  M + +V G L+WV + GK+VVRSPIVA
Sbjct  704  PRKLVFSHKYEKLSYKLILEGPKWMEEDVVHGHLSWVSSDGKYVVRSPIVA  754



>ref|XP_009419397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=761

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G  N  ASPLAMGAGHI+PNRAL+PGL+YD  ++DY+NL+CA+ FT    +TI  
Sbjct  575  PIKDMGNGNKQASPLAMGAGHIDPNRALEPGLVYDADTKDYVNLLCAMNFTSKQLRTITG  634

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDG-ISTYSAKLTPIG  400
            T++ +CSNP+LDLNYPSFIA+F  N T +    V++F RT+TN+GD  ++TY AKL  I 
Sbjct  635  TATVDCSNPTLDLNYPSFIAYFDPNETSASAPSVRQFRRTVTNVGDNPVATYIAKLVDIK  694

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRI-EAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
               V+VVP+KL F +K  KQS+ L + E      D +  GSLTWV++  K+VVRSPIVA
Sbjct  695  GFTVSVVPEKLSFKEKYQKQSFTLTLKENTREKKDAVRHGSLTWVDDEEKYVVRSPIVA  753



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D   +N  A+P+ +G+GHINPN++LDPGLIYD +++DYI L+CA+ +T    Q I R
Sbjct  576  PIKDASNNNLPATPIDIGSGHINPNKSLDPGLIYDATAEDYIKLLCAMNYTNKQIQIITR  635

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S ++C N SLDLNYPSFIA+F +  + S    V +F RTLTN+G+ +S+Y+AKL  +  
Sbjct  636  SSHHDCKNRSLDLNYPSFIAYFDSYDSGSKEKVVHKFQRTLTNVGERMSSYTAKLLGMDG  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V+V P KLVF K+ +K SY L +E P ++ + ++ GSL+WV + GK+VVRSPIVA
Sbjct  696  IKVSVEPQKLVFKKEHEKLSYTLTLEGPKSLEEDVIHGSLSWVHDGGKYVVRSPIVA  752



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 131/180 (73%), Gaps = 6/180 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G  N  A+PLAMG+GHI PNRALDPGL+YD SS DY+ L+CA+ +T    +TI R
Sbjct  581  PIKDMGDSNRPATPLAMGSGHIEPNRALDPGLVYDASSDDYVRLLCAMNYTIQQIKTITR  640

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            T S++CS  SLDLNYPSFIAFF  N T +    VQEF RT+TN+GD  +TY +K+  +  
Sbjct  641  TYSFDCSKASLDLNYPSFIAFFNPNKTTTRDKVVQEFRRTVTNVGDA-ATYYSKVVAMKG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMG---DFLVFGSLTWVENAGKHVVRSPIVA  226
             ++TV+PD LVF +K +K+S+ + IE    MG   D ++ G+L+WV++ GK+VVRSPIVA
Sbjct  700  FSITVMPDMLVFHEKYEKKSFTIIIEG--QMGKKKDEVLHGALSWVDDKGKYVVRSPIVA  757



>ref|XP_008785865.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   196 bits (498),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 130/179 (73%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGF-DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D+G+ D   A+P+A+G+G I PNRALDPGLIYD S+ DY+ L+CA+K+T    + I 
Sbjct  574  PIRDMGYADRPVATPMAIGSGQIEPNRALDPGLIYDASTDDYVRLLCAMKYTSKQIKMIT  633

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +T S++CSN SLDLNYPSFIAFF  N T      VQEF RT+TN+GD + TY+AK+  + 
Sbjct  634  KTYSFDCSNASLDLNYPSFIAFFNPNKTAISYKVVQEFQRTVTNVGDAVVTYNAKVVAMK  693

Query  399  NVNVTVVPDKLVFTKKSDKQSYKL-RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             + ++V+P+KLVF +K +K+S+ L  +       D ++ GSL+WV++ GK+VVRSPIVA
Sbjct  694  GIEISVMPEKLVFHEKYEKKSFTLIMVGQMGKKADEVLHGSLSWVDDKGKYVVRSPIVA  752



>ref|XP_004494864.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 130/178 (73%), Gaps = 6/178 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG D   +SPLA+GAG+INPNRALDPGLIYD   QDY+NL+CAL FT  +   I R+
Sbjct  592  IKDIGNDYKPSSPLALGAGYINPNRALDPGLIYDAQKQDYVNLLCALNFTRKNIMAITRS  651

Query  573  SSYNCSNPSLDLNYPSFIAFFPA--NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
               NCSNPSLDLNYPSFI+F  A  N T+    + QEFHRT+TN+G+  +TY AK+TPI 
Sbjct  652  FFNNCSNPSLDLNYPSFISFVNAANNGTVGSKVK-QEFHRTVTNVGEEATTYVAKITPIE  710

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTM-GDFLVFGSLTWVENAGKHVVRSPIV  229
              +V V+P KLVF ++++K +YKLRIE    +  + + FG LTW+++  KH+VRSPIV
Sbjct  711  GFHVNVIPKKLVFKERNEKVTYKLRIEGRRILEKNKVAFGYLTWIDS--KHIVRSPIV  766



>ref|XP_002277899.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=769

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 127/177 (72%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            P++++  D   A  L MGAG +NPN+ALDPGLIY+ +++DY+ L+CA+ FT    Q I R
Sbjct  582  PVKEVSNDTVTA--LDMGAGQVNPNKALDPGLIYNATAEDYVQLLCAMGFTAKEIQKITR  639

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSY C NPSLDLNYPSFIA+F   ++  D   VQ FHRT+TN+G+G S Y+A+LTP+  
Sbjct  640  -SSYECLNPSLDLNYPSFIAYFNDESSAPD-ELVQVFHRTVTNVGEGQSNYTAELTPLKG  697

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V P+KLVF  K +  SY L +E P +M ++LV+G L+WV + GK+VVRSPIVA
Sbjct  698  LKVKVDPEKLVFNCKHETLSYNLTLEGPKSMTEYLVYGHLSWVSDGGKYVVRSPIVA  754



>gb|KDP41713.1| hypothetical protein JCGZ_16120 [Jatropha curcas]
Length=767

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PIQDIG +N  ASPL MGAG +NP++ALDPGLIYD++S DY+ L+C L FT N  +TI R
Sbjct  581  PIQDIGNENQPASPLDMGAGEVNPSKALDPGLIYDLNSTDYVKLLCGLNFTANQIKTITR  640

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +SS +CS+PSLDLNYP+FIAFF +N +      V EFHRT+TN+G+  S Y+AK+TP+  
Sbjct  641  SSSNDCSSPSLDLNYPAFIAFFNSNESKLGLATVTEFHRTVTNVGERTSIYTAKVTPMDG  700

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            + V+VVPDKL F  K +K SYKL +E+ S +   +++G L+WV + GK+VV+SPIV
Sbjct  701  LKVSVVPDKLEFKSKYEKLSYKLVVESQSQLRQNVIYGYLSWVHSEGKYVVKSPIV  756



>emb|CBI21415.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 127/177 (72%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            P++++  D   A  L MGAG +NPN+ALDPGLIY+ +++DY+ L+CA+ FT    Q I R
Sbjct  383  PVKEVSNDTVTA--LDMGAGQVNPNKALDPGLIYNATAEDYVQLLCAMGFTAKEIQKITR  440

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSY C NPSLDLNYPSFIA+F   ++  D   VQ FHRT+TN+G+G S Y+A+LTP+  
Sbjct  441  -SSYECLNPSLDLNYPSFIAYFNDESSAPD-ELVQVFHRTVTNVGEGQSNYTAELTPLKG  498

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V P+KLVF  K +  SY L +E P +M ++LV+G L+WV + GK+VVRSPIVA
Sbjct  499  LKVKVDPEKLVFNCKHETLSYNLTLEGPKSMTEYLVYGHLSWVSDGGKYVVRSPIVA  555



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+ F+ + A+PL +G+GH++PNRALDPGL+YD + QD++NL+C++  T   TQTI R
Sbjct  579  PIKDMAFNYSNATPLGIGSGHVDPNRALDPGLVYDATPQDFVNLVCSMNLTREQTQTITR  638

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+YNCS+PS DLNYPSFIA F  +      NR   FHRT+TN+ DG +TY  KL    N
Sbjct  639  -STYNCSSPSSDLNYPSFIALFNFDERGMTFNRT--FHRTVTNVADGAATYKVKLEKPAN  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V + P  LVF KK +KQSY L I     +  F  FGSLTWVE  GKH VRSPIV
Sbjct  696  TRVRIQPKTLVFQKKYEKQSYSLNIRYRGDIDSFPTFGSLTWVEETGKHKVRSPIV  751



>ref|XP_011069662.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+ FD   A+PL +GAG ++PNRAL+PGLIYD + QDY+NL+C++ FTP  T+TIIR
Sbjct  589  PIKDMAFDYRVATPLGIGAGQVDPNRALNPGLIYDATVQDYVNLVCSMNFTPEQTRTIIR  648

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSYNCS PS DLNYP+FIA +    T +   R  +F RTLTN+GDG +TY  K+     
Sbjct  649  -SSYNCSTPSPDLNYPTFIALYEVQETRTTLTR--KFKRTLTNVGDGAATYKVKVKEPNG  705

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              +TV P  LVF KK +KQSY L I   S     +  GS+TW+E  GKH VRSPIV
Sbjct  706  STITVSPQTLVFRKKYEKQSYSLTIRYRSNSEFVITDGSITWIEENGKHTVRSPIV  761



>ref|XP_003624105.1| Xylem serine proteinase [Medicago truncatula]
 gb|ABD28576.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
 gb|AES80323.1| subtilisin-like serine protease [Medicago truncatula]
Length=769

 Score =   193 bits (491),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 129/177 (73%), Gaps = 6/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G+ +  ASPLA+GAG I+PNRA++PGLIYD + QDY+NL+C LKFT N   TI R
Sbjct  591  PIRDNGYPSQHASPLAIGAGEIDPNRAMNPGLIYDATPQDYVNLLCGLKFTKNQILTITR  650

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            ++SY+C NPSLDLNYPSFIAF+ +N T S    V +F R +TN+GDG +TY AK+T P G
Sbjct  651  SNSYDCENPSLDLNYPSFIAFY-SNKTRS---MVHKFKRIVTNVGDGAATYRAKVTYPKG  706

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V VTV PD L F  K++KQSY + I+      + + FG L W+E+ G H+VRSPIV
Sbjct  707  SV-VTVSPDILTFKYKNEKQSYNIIIKYVMYKKENVSFGDLVWIEDGGAHIVRSPIV  762



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 131/179 (73%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  PIQDIGF-DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D+G+ D  AA+PLA+G+G I PNR LDPGL+YD S++DY+ L+CA+K+T    + I 
Sbjct  578  PIRDMGYADRPAATPLAIGSGLIEPNRVLDPGLVYDASTEDYVRLLCAMKYTSKQIKMIT  637

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +T S++CS+ SLDLNYPSFIAFF  N T +    VQEF RT+TN+GD +++Y+AK+  + 
Sbjct  638  KTYSFDCSHASLDLNYPSFIAFFDPNKTAASDKVVQEFRRTVTNMGDAVASYNAKVVAMK  697

Query  399  NVNVTVVPDKLVFTKKSDKQSYKL-RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
               + VVP+KLVF +K +K+S+ L  +       D ++ GSL+W+++ GK+VVRSPIVA
Sbjct  698  GFAIRVVPEKLVFHEKYEKKSFALILVGQMGKKADEVLHGSLSWMDDKGKYVVRSPIVA  756



>ref|XP_003529873.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 125/176 (71%), Gaps = 7/176 (4%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG     ASPLA+GAGH+NPNR LDPGL+YDV  QDY+NL+CAL +T  +   I  T
Sbjct  576  IKDIGDGYKQASPLALGAGHVNPNRGLDPGLVYDVRVQDYVNLLCALGYTQKNITIITGT  635

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFIAF  +N +    +  QEF RT+TN+G+G + Y A +TP+   
Sbjct  636  SSNDCSKPSLDLNYPSFIAFINSNGS----SAAQEFQRTVTNVGEGKTIYDASVTPVKGY  691

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMG-DFLVFGSLTWVENAGKHVVRSPIV  229
            +++V+P KLVF +K++K SYKL IE P+    + + FG LTW +   KHVVRSPIV
Sbjct  692  HLSVIPKKLVFKEKNEKLSYKLTIEGPTKKKVENVAFGYLTWTDV--KHVVRSPIV  745



>emb|CDP01315.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 1/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G DN  A+PLA+GAGH++PNRALDPGLIYD + QDYIN IC++ FT   T  I R
Sbjct  582  PIKDTGRDNEVATPLAIGAGHVDPNRALDPGLIYDATPQDYINFICSMNFTRMQTLAITR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            ++SYNCSNPS DLNYPSF+A +   +  +    V++F RTLTN+G+G +TY+AK+T    
Sbjct  642  STSYNCSNPSSDLNYPSFVALY-ETSDQAKSKLVKKFRRTLTNVGNGAATYTAKVTAPKG  700

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VT+ P  + F KK +KQSY L I         +  GS+TW+E+ G HVV SPIV
Sbjct  701  SAVTISPKTIKFGKKYEKQSYSLTISYYGNENQIVSSGSVTWIEDDGNHVVTSPIV  756



>ref|XP_007204261.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
 gb|EMJ05460.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
Length=759

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D+   N  A+PL +GAGHINPN+AL+PGL+YD +++DYI L+CA+ +T    Q +I 
Sbjct  576  PIIDVS-TNLPATPLDIGAGHINPNKALEPGLVYDTTAEDYIKLLCAMNYTAKQIQ-VIT  633

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+++C N S+DLNYPSFIA+F +  + S    VQEF+RT+TN+G+  S Y+AKLT +  
Sbjct  634  GSTHSCVNRSIDLNYPSFIAYFNSKGSKSSAKVVQEFNRTVTNVGEQRSGYTAKLTAMAG  693

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V P++LVF  K +K SYKL +E P  +   +V GSL+WV++ GK+VVRSPIVA
Sbjct  694  LKVKVEPERLVFKNKYEKLSYKLTLEGPKLLKKVVVQGSLSWVDDGGKYVVRSPIVA  750



>ref|XP_008241490.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=745

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D+   N  A+PL +GAGHINPNRAL+PGL+YD +++DYI L+CA+ +T    Q +I 
Sbjct  562  PIIDVS-TNHPATPLDIGAGHINPNRALEPGLVYDTTAEDYIKLLCAMNYTAKQIQ-VIT  619

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+++C N S++LNYPSFIA+F +  + S    VQEF RT+TN+G+  S Y+AKLT +  
Sbjct  620  GSTHSCVNRSINLNYPSFIAYFNSKGSKSSAKVVQEFKRTVTNVGEQRSGYTAKLTAMAG  679

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V P++LVF  K +K SYKL +E P  + + +V GSL+WV++ GK+VVRSPIVA
Sbjct  680  LKVKVEPERLVFKNKYEKLSYKLTLEGPKLLKEVVVQGSLSWVDDGGKYVVRSPIVA  736



>emb|CDP01317.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 122/176 (69%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D GF  A A+P++MGAG +NPN ALDPGLIYD + QDY++++C++ FT    QTI R
Sbjct  307  PIRDAGFSYATATPVSMGAGQVNPNSALDPGLIYDATPQDYVSILCSMNFTQKQIQTITR  366

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSYNCS  S DLNYPSFIA +P N T +     ++F R +TN+GDG +TY  ++T    
Sbjct  367  -SSYNCSKTSSDLNYPSFIALYP-NKTKNA--LAKKFERIVTNVGDGAATYKVQVTAPKG  422

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ LVF +K DKQSY L+++  +     + FGS+ WVE  GKH+VRSPIV
Sbjct  423  SGVTVYPEALVFGQKYDKQSYSLKLKYKANQNKTVTFGSVIWVEVNGKHIVRSPIV  478



>gb|ACA64705.1| subtilase, partial [Nicotiana tabacum]
Length=531

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 120/177 (68%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  349  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  407

Query  576  TS-SYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +S ++NCSNPS DLNYPSFIA +P     +     Q+F RT+TN+G G +TY AKL    
Sbjct  408  SSDNHNCSNPSADLNYPSFIALYPLEGPFTFLE--QKFRRTVTNVGQGAATYKAKLKAPK  465

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            N  V+V P  LVF KK++KQSY L I     +G     GS+TWVE  G H VRSPIV
Sbjct  466  NTTVSVSPQTLVFKKKNEKQSYTLTIRYLGDVGQSRNVGSITWVEENGNHSVRSPIV  522



>ref|XP_011074591.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D  F+   A+PLAMGAG ++PN+ALDPGLIYD S QDY+NL+C++ FT N   TI R 
Sbjct  580  IRDSYFNYEIATPLAMGAGQVDPNQALDPGLIYDASPQDYVNLLCSMNFTHNQISTITR-  638

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSYNCS PS DLNYPSFIA +  N T    + VQEFHR +TN+GD +++Y  ++T     
Sbjct  639  SSYNCSTPSSDLNYPSFIALY-TNKTRD--SLVQEFHRVVTNVGDDVTSYKVQVTAPSGS  695

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             VTV P  LVF  K +KQSY L I+  S     + FGS+TW+E+ GKH VRSPIV
Sbjct  696  TVTVYPTTLVFGHKYEKQSYSLTIQYKSNSTGAITFGSITWIEDNGKHTVRSPIV  750



>ref|XP_002523606.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38801.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    +  A+PL +GAGH++PN++LDPGLIYD ++ DY+ L+CA+ +T    Q I R
Sbjct  585  PIKDASNHDLPANPLDIGAGHVDPNKSLDPGLIYDATADDYMKLLCAMNYTKKQIQIITR  644

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+ NC N SLDLNYPSFIA+F  + +  +   V+EF RTLTN+G G+S+YSAK+TP+  
Sbjct  645  -SNPNCVNKSLDLNYPSFIAYFNNDDSDLNEKVVREFRRTLTNVGMGMSSYSAKVTPMYG  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            V  TV P +LVF  K +K SYKL +E P  + + +V GSL+WV + GK+VV SPIVA
Sbjct  704  VRATVEPKELVFRNKYEKLSYKLTLEGPKILEEMVVHGSLSWVHDEGKYVVTSPIVA  760



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 123/177 (69%), Gaps = 6/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G+ +  ASPLA+GAG I+PN+ALDPGL+YD + QDY+NL+CALK+T     TI R
Sbjct  586  PIRDYGYPSQYASPLAIGAGQIDPNKALDPGLVYDATPQDYVNLLCALKYTQKQILTITR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            ++SYNC+ PS DLNYPSFIAF+  N      + V +F RT+TN+GDG +TY AK+T P G
Sbjct  646  STSYNCAKPSFDLNYPSFIAFYRNNTR----SVVHKFRRTVTNVGDGAATYRAKVTQPKG  701

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V VTV P+ L F  K++K SY + I+        + FG L WVE  G H VRSPIV
Sbjct  702  SV-VTVSPETLTFRYKNEKLSYDVVIKYSKYKKKNISFGDLVWVEEGGTHSVRSPIV  757



>gb|KDP41712.1| hypothetical protein JCGZ_16119 [Jatropha curcas]
Length=732

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +   ASPLAMGAG ++PNRAL PGLIYD + QDY+N++C++ +T N   TI R
Sbjct  553  PIRDNGINLELASPLAMGAGQLDPNRALQPGLIYDATPQDYVNILCSMNYTKNQILTITR  612

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKL-TPIG  400
            +  YNCSNPS D+NYPSFIA +  N T S     Q F RT+TN+G+G +TY AKL  P G
Sbjct  613  SIRYNCSNPSSDMNYPSFIALY-NNKTTS--TVTQSFQRTVTNVGEGAATYKAKLIAPRG  669

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
            ++ VTV PD LVF KK DKQSY LRI         + FGS+ W+E  G H VRSPI
Sbjct  670  SI-VTVSPDTLVFGKKYDKQSYNLRIRYRRDEKGVVSFGSIVWIEENGVHTVRSPI  724



>gb|KHN40450.1| Subtilisin-like protease [Glycine soja]
Length=765

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 123/177 (69%), Gaps = 6/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G+ +  ASPLA+GAG I+PN+ALDPGL+YD + QDY+NL+CALK+T     TI R
Sbjct  587  PIRDYGYPSQYASPLAIGAGQIDPNKALDPGLVYDATPQDYVNLLCALKYTQKQILTITR  646

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            ++SYNC+ PS DLNYPSFIAF+  N      + V +F RT+TN+GDG +TY AK+T P G
Sbjct  647  STSYNCAKPSFDLNYPSFIAFYRNNTR----SVVHKFRRTVTNVGDGAATYRAKVTQPKG  702

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V VTV P+ L F  K++K SY + I+        + FG L WVE  G H VRSPIV
Sbjct  703  SV-VTVSPETLTFRYKNEKLSYDVVIKYSKYKKKNISFGDLVWVEEGGTHSVRSPIV  758



>gb|ABD28577.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
 gb|AES80322.2| subtilisin-like serine protease [Medicago truncatula]
Length=771

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G+ +  ASPLA+GAG I+PNRA++PGLIYD + QDY+N +C LKFT N   TI R+
Sbjct  594  IRDNGYPSQYASPLAIGAGEIDPNRAMNPGLIYDATPQDYVNFLCGLKFTKNQILTITRS  653

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSY C NPSLDLNYPSFIAF+         + V  F+RT+TN+GDG +TYSA +T     
Sbjct  654  SSYGCENPSLDLNYPSFIAFYNKKTR----SMVHTFNRTVTNVGDGAATYSANVTHPKGC  709

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             +TV+PD L F  +++KQSY L I+      D + FG L W+E  G H VRSPIV
Sbjct  710  VMTVLPDILTFKYRNEKQSYSLVIKCVMYKKDNVSFGDLVWIEYGGAHTVRSPIV  764



>gb|KHN15887.1| Subtilisin-like protease [Glycine soja]
Length=716

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 123/176 (70%), Gaps = 7/176 (4%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG D   A+PLAMGAGH+NPNRALDPGL+YDV  QDY+NL+CAL +T  +   I   
Sbjct  539  IKDIGDDYKPATPLAMGAGHVNPNRALDPGLVYDVGVQDYVNLLCALGYTQKNITVITGN  598

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFI    A    +  +  QEF RT+TN+G+G + Y A +TP+   
Sbjct  599  SSNDCSKPSLDLNYPSFI----AFFNSNSSSTSQEFQRTVTNVGEGQTIYVASVTPVKGY  654

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMG-DFLVFGSLTWVENAGKHVVRSPIV  229
             V+V+P+KLVF +K++K SYKLRIE P+    + + FG  TW +   KHVVRSPIV
Sbjct  655  YVSVIPNKLVFKEKNEKLSYKLRIEGPTNKKVENVAFGYFTWTDV--KHVVRSPIV  708



>gb|KDP41710.1| hypothetical protein JCGZ_16117 [Jatropha curcas]
Length=651

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 3/175 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G   A ASPLAMGAG I+P+RALDPGLIYD +  DY+N++C++ +T     TI R
Sbjct  471  PIRDNGEKFAYASPLAMGAGQIDPHRALDPGLIYDATPHDYVNILCSMNYTKKQILTITR  530

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +  Y CSNPS DLNYPSFIA +  N T +    VQ F RTLTN+GDG +TY AK+     
Sbjct  531  SKRYTCSNPSPDLNYPSFIALYD-NKTAA--VAVQRFRRTLTNVGDGAATYKAKIVVTKG  587

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
              VTV PD LVF KK DKQ+Y L I+     G  + FGS+ W+E  G H VRSPI
Sbjct  588  SKVTVSPDSLVFGKKYDKQTYTLTIKYSKDKGGRVSFGSIVWIEQNGVHTVRSPI  642



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D  F+ + A+PL +G+G ++PNRALDPGLIYD S QD++NL+C++  T   TQTI R
Sbjct  578  PIKDSAFNYSNATPLGIGSGQVDPNRALDPGLIYDASPQDFVNLVCSMNLTREETQTITR  637

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+YNCS PS DLNYPSFIA F  +      N  Q FHRT+TN+ +G +TY  KL    N
Sbjct  638  -STYNCSTPSSDLNYPSFIAVFNNDERGMMFN--QTFHRTVTNVANGAATYKVKLEKPEN  694

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V + P  LVF KK +KQSY L I     +  F  +GSLTWVE  GKH+VRSPIV
Sbjct  695  TRVRIQPKTLVFQKKYEKQSYTLNIRYRGDIDAFPTYGSLTWVEKTGKHLVRSPIV  750



>ref|XP_003624104.1| Subtilisin-like protease [Medicago truncatula]
Length=1278

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G+ +  ASPLA+GAG I+PNRA++PGLIYD + QDY+N +C LKFT N   TI R+
Sbjct  594  IRDNGYPSQYASPLAIGAGEIDPNRAMNPGLIYDATPQDYVNFLCGLKFTKNQILTITRS  653

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSY C NPSLDLNYPSFIAF+         + V  F+RT+TN+GDG +TYSA +T     
Sbjct  654  SSYGCENPSLDLNYPSFIAFYNKKTR----SMVHTFNRTVTNVGDGAATYSANVTHPKGC  709

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             +TV+PD L F  +++KQSY L I+      D + FG L W+E  G H VRSPIV
Sbjct  710  VMTVLPDILTFKYRNEKQSYSLVIKCVMYKKDNVSFGDLVWIEYGGAHTVRSPIV  764


 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = -2

Query  678   ALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANA  499
             A++PGL+YD + QDY+N +C LKFT     TI R+SS+ C N SLDLNYPSFIAF+    
Sbjct  1126  AMNPGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCENTSLDLNYPSFIAFYNKKT  1185

Query  498   TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  319
                  + V  F+RT+TN+GDG +TYSAK+T      V V+P+ L F+ +++KQSY + I+
Sbjct  1186  R----SMVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRVLPEILTFSYRNEKQSYYIIIK  1241

Query  318   APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
                    ++ FG L W+E+ G H VRSPIV
Sbjct  1242  CDMYKKKYVSFGDLVWIEDGGVHTVRSPIV  1271



>ref|XP_006434737.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
 gb|ESR47977.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
Length=765

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  756  PIQDIGFDN-AAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D G  N  +ASPLAMGAG ++PNRALDPGLIYD + QDY+NL+C++ FT N   +I 
Sbjct  587  PIRDNGLINFTSASPLAMGAGQVDPNRALDPGLIYDATPQDYVNLLCSMNFTQNQILSIT  646

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PI  403
            R++ YNCS P+ DLNYPSFI      +T      VQ FHRT+TN+G   +TY AK+T P+
Sbjct  647  RSNRYNCSTPTSDLNYPSFITLHDNTST----KFVQTFHRTVTNVGGSAATYKAKITAPL  702

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
            G V ++V PD LVF K+ ++QSY L I   +  G+ + FG L WVE  G H VRSPI
Sbjct  703  GTV-ISVSPDTLVFGKQYEQQSYTLTINYKTDGGEIISFGELVWVEENGNHTVRSPI  758



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D   +   A+PL +G+G ++PNRALDPGL+YD S QD++NL+C+  FT   TQTI R
Sbjct  578  PIKDSASNYRNATPLGIGSGQVDPNRALDPGLVYDASPQDFVNLVCSRNFTREQTQTITR  637

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            TS YNCS+PS DLNYPSFIA F  +      NR   FHRT+TN+ DG +TY  KL    N
Sbjct  638  TS-YNCSSPSSDLNYPSFIALFNNDEIGMTFNRT--FHRTVTNVADGAATYKVKLEKPAN  694

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V + P  LVF KK +KQSY L I        F   GSLTWVE  GKHVVRSPIV
Sbjct  695  TRVRIQPKTLVFQKKYEKQSYSLNIRYRGDNNAFPRHGSLTWVEETGKHVVRSPIV  750



>ref|XP_003548400.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 123/176 (70%), Gaps = 7/176 (4%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG D   A+PLAMGAGH+NPNRALDPGL+YDV  QDY+NL+CAL +T  +   I   
Sbjct  576  IKDIGDDYKPATPLAMGAGHVNPNRALDPGLVYDVGVQDYVNLLCALGYTQKNITVITGN  635

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS +CS PSLDLNYPSFI    A    +  +  QEF RT+TN+G+G + Y A +TP+   
Sbjct  636  SSNDCSKPSLDLNYPSFI----AFFNSNSSSASQEFQRTVTNVGEGQTIYVASVTPVKGY  691

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMG-DFLVFGSLTWVENAGKHVVRSPIV  229
             V+V+P+KLVF +K++K SYKLRIE P+    + + FG  TW +   KHVVRSPIV
Sbjct  692  YVSVIPNKLVFKEKNEKLSYKLRIEGPTNKKVENVAFGYFTWTDV--KHVVRSPIV  745



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+C++ FT     TI R+
Sbjct  585  IRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQDYVNLLCSMNFTTKQILTITRS  644

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            ++Y CSNPS DLNYPSFIA +   +T      VQ+F RT+TN+GDG S+Y A +T     
Sbjct  645  NTYTCSNPSPDLNYPSFIALYNNKST----AFVQKFQRTVTNVGDGASSYKAIVTAPKGS  700

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             V V P  L F  K +K SY L IE  S     + FGSLTW+E+ GKH VRSPIV
Sbjct  701  KVMVSPATLAFENKYEKLSYTLTIEYKSEKDGKVSFGSLTWIEDDGKHTVRSPIV  755



>ref|XP_007139760.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
 gb|ESW11754.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
Length=765

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 124/177 (70%), Gaps = 6/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G+ +  ASPLAMGAG I+PN+ALDPGLIYD + QDY+NL+CAL +T     TI R
Sbjct  587  PIRDYGYPSQYASPLAMGAGQIDPNKALDPGLIYDATPQDYVNLLCALHYTQKQILTITR  646

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            +SSYNC+ PS DLNYPSFIAF+ +N T S    VQ+F RT+TN+GDG + Y  K T P G
Sbjct  647  SSSYNCAKPSFDLNYPSFIAFY-SNKTRS---VVQKFKRTVTNVGDGGAIYRVKTTQPNG  702

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V VTV P+ L F  K++K SY + I+      + + +G L W+E+ G H VRSPIV
Sbjct  703  SV-VTVSPETLAFRYKNEKLSYDVMIKYRKYKKENISYGDLVWIEDGGAHSVRSPIV  758



>gb|EYU25438.1| hypothetical protein MIMGU_mgv1a001996mg [Erythranthe guttata]
Length=729

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 123/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G D   A+PL MGAG ++PNRALDPGLIYD + QDY+NL+CAL +T   T+TIIR
Sbjct  549  PIKDMGNDYKGATPLDMGAGQVDPNRALDPGLIYDATPQDYVNLVCALNYTREQTRTIIR  608

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+YNCSNPSLDLNYP+F+A +     +S   + + F RT+TN+GDG +TY   +    +
Sbjct  609  -SNYNCSNPSLDLNYPAFVALYDPLEEVS--TKTRRFRRTVTNVGDGAATYKVSVKRPKD  665

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLV-FGSLTWVENAGKHVVRSPIV  229
              +TV P+KLVF KK+ K S+ L I    T  D+++  GS+ W E  GKH VRSPIV
Sbjct  666  SVITVSPEKLVFQKKNQKLSFSLTISY-KTYRDYVINHGSIIWAEEKGKHTVRSPIV  721



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+C++ FT     TI R+
Sbjct  600  IRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQDYVNLLCSMNFTTKQILTITRS  659

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            ++Y CSNPS DLNYPSFIA +   +T      VQ+F RT+TN+GDG S+Y A +T     
Sbjct  660  NTYTCSNPSPDLNYPSFIALYNNKSTA----FVQKFQRTVTNVGDGASSYKAIVTAPKGS  715

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             V V P  L F  K +K SY L IE  S     + FGSLTW+E+ GKH VRSPIV
Sbjct  716  KVMVSPATLAFENKYEKLSYTLTIEYKSEKDGKVSFGSLTWIEDDGKHTVRSPIV  770



>ref|XP_009797476.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  584  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  642

Query  576  TS-SYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            +S ++NCSNPS DLNYPSFIA +P     +     Q+F RT+TN+G G +TY AKL    
Sbjct  643  SSDNHNCSNPSADLNYPSFIALYPLEGPFTFLE--QKFRRTVTNVGQGAATYKAKLKAPK  700

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            N  V+V P  LVF KK++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  701  NTTVSVSPQTLVFKKKNEKQSYTLTIRYLGDEGQSRNVGSITWVEENGNHSVRSPIV  757



>ref|XP_010267360.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=772

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 126/180 (70%), Gaps = 3/180 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI ++  +   ASPLAMGAG +NPN+ALDPGL+YD +++DY+ L+CAL +T    + I R
Sbjct  586  PITELVDNEGPASPLAMGAGQLNPNKALDPGLVYDANAEDYVRLLCALNYTKKEIKKITR  645

Query  576  TSSY-NCSNPSLDLNYPSFIAFFPANATLSDPNR--VQEFHRTLTNLGDGISTYSAKLTP  406
            +SS  +CSNP LDLNYPSFIA    ++++   N   V+EF RT+TN+G+G++TY AKL P
Sbjct  646  SSSKADCSNPLLDLNYPSFIAILHEDSSILPLNTKVVKEFSRTVTNVGEGMATYVAKLAP  705

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            I    + V PD+LVF +K  K S+KL ++ P  + +  V G L+W E  GKHVVRSPIVA
Sbjct  706  IDGFKLKVKPDRLVFKEKYQKLSFKLTLKGPRVVENGDVHGYLSWEEVGGKHVVRSPIVA  765



>ref|XP_011069660.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=762

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G     A+PL MGAG ++PNRALDPGLIYDV++QDY+NL+CAL +T   TQ+IIR
Sbjct  583  PIKDMGHRYDIATPLDMGAGQVDPNRALDPGLIYDVTAQDYVNLVCALNYTREQTQSIIR  642

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+YNCS+PS DLNYP+F+A +  +         Q+F RT+TN+G+G +TY  K+    +
Sbjct  643  -STYNCSSPSTDLNYPAFVALY--DPLQERTTLTQKFQRTVTNVGNGAATYKVKVKRPKD  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              +TV P+KLVF KK++KQ + L I   S     +  GS+TWVE  GKH VRSPIV
Sbjct  700  SVITVSPEKLVFQKKNEKQRFSLTIRYKSYDEYVINHGSITWVEENGKHNVRSPIV  755



>gb|ACA64703.1| subtilase [Nicotiana tabacum]
Length=766

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  584  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  642

Query  576  TS-SYNCSNPSLDLNYPSFIAFFPANA--TLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S ++NCSNPS DLNYPSFIA +P     TL +    Q+F RT+TN+G G +TY AKL  
Sbjct  643  SSDNHNCSNPSADLNYPSFIALYPLEGPFTLLE----QKFRRTVTNVGQGAATYKAKLKA  698

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  V+V P  LVF KK++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  699  PKNSTVSVSPQTLVFKKKNEKQSYTLTIRYLGDEGQSRNVGSITWVEENGNHSVRSPIV  757



>ref|XP_009621569.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  584  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  642

Query  576  TS-SYNCSNPSLDLNYPSFIAFFPANA--TLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S ++NCSNPS DLNYPSFIA +P     TL +    Q+F RT+TN+G G +TY AKL  
Sbjct  643  SSDNHNCSNPSADLNYPSFIALYPLEGPFTLLE----QKFRRTVTNVGQGAATYKAKLKA  698

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  V+V P  LVF KK++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  699  PKNSTVSVSPQTLVFKKKNEKQSYTLTIRYLGDEGQSRNVGSITWVEENGNHSVRSPIV  757



>ref|XP_006425911.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
 gb|ESR39151.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
Length=786

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D   +N  ASPL MGAGHINPN+ALDPGL+YD +++DYI L+CA+ + P   + I   
Sbjct  604  IKDASNNNFPASPLDMGAGHINPNKALDPGLVYDATAEDYIKLLCAMNYKPEQIR-IFTK  662

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS  C+N SLDLNYPSFI FF    + SD   V+EF RT+TN  +  + Y+AKLT I  +
Sbjct  663  SSQKCNNRSLDLNYPSFITFFNDYDSSSDEKVVKEFWRTVTNAEEVGTAYTAKLTGIDGL  722

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             V V P +LVF +K +KQSYKL +E P  +   +V+GS++WV++ G++ VRSPIVA
Sbjct  723  KVYVEPRRLVFKQKYEKQSYKLTLEGPKLLEKDVVYGSISWVDDDGRYEVRSPIVA  778



>gb|KDO79191.1| hypothetical protein CISIN_1g004824mg [Citrus sinensis]
Length=728

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D   +N  ASPL MGAGHINPN+ALDPGL+YD +++DYI L+CA+ + P   + I   
Sbjct  546  IKDASNNNFPASPLDMGAGHINPNKALDPGLVYDATAEDYIKLLCAMNYKPEQIR-IFTK  604

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS  C+N SLDLNYPSFI FF    + SD   V+EF RT+TN  +  + Y+AKLT I  +
Sbjct  605  SSQKCNNRSLDLNYPSFITFFNDYDSSSDEKVVKEFWRTVTNAEEVGTAYTAKLTGIDGL  664

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             V V P +LVF +K +KQSYKL +E P  +   +V+GS++WV++ G++ VRSPIVA
Sbjct  665  KVYVEPRRLVFKQKYEKQSYKLTLEGPKLLEKDVVYGSISWVDDDGRYEVRSPIVA  720



>ref|XP_007047286.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91443.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=767

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+   N  ASPL +GAGHINP +ALDPGL+YD + +DYI L+CA+ +T    + +  
Sbjct  584  PIKDVSNYNFPASPLDIGAGHINPTKALDPGLVYDAAPEDYIKLLCAMNYTSKQIR-VFA  642

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQ---EFHRTLTNLGDGISTYSAKLTP  406
             SS+NC + SLDLNYPSFIAFF    + S+   V+   EF RT+TN+G G   Y+A +T 
Sbjct  643  NSSHNCLSRSLDLNYPSFIAFFTDEQSTSNQKVVKVVKEFRRTVTNVGKGGMAYTAMVTG  702

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            +  + V V P KL+F +  +KQSYKL +E P ++   ++FGSL+WV++ GK++VRSPIVA
Sbjct  703  MDGIKVMVEPQKLIFKQSYEKQSYKLSLEGPKSLKTEVIFGSLSWVDDDGKYMVRSPIVA  762



>gb|KDO84129.1| hypothetical protein CISIN_1g004265mg [Citrus sinensis]
Length=765

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = -2

Query  756  PIQDIGFDN-AAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D G  N  +ASPLAMGAG ++PNRALDPGLIYD + QDY++L+C++ FT N   +I 
Sbjct  587  PIRDNGLINFTSASPLAMGAGQVDPNRALDPGLIYDATPQDYVSLLCSMNFTQNQILSIT  646

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PI  403
            R++ YNCS P+ DLNYPSFI      +T      VQ FHRT+TN+G   +TY AK+T P+
Sbjct  647  RSNRYNCSTPTSDLNYPSFITLHDNTST----KFVQTFHRTVTNVGGSAATYKAKITAPL  702

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
            G V ++V PD LVF K+ ++QSY L I   +  G+ + FG L WVE  G H VRSPI
Sbjct  703  GTV-ISVSPDTLVFGKQYEQQSYTLTINYKTDGGEIISFGELVWVEENGNHTVRSPI  758



>ref|XP_007047285.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91442.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=779

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 122/177 (69%), Gaps = 1/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    +  A+PL +GAGHINP +  DPGL+YD + QDYI L+CA+ +T    + I  
Sbjct  599  PIKDPSSYDLPATPLDIGAGHINPTKVFDPGLVYDAAPQDYIKLLCAMNYTSKQIR-IFT  657

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SS+NC + SLDLNYPSFIA F    + S+   V+EF RT+TN+G G   Y+AKL  +  
Sbjct  658  NSSHNCMSQSLDLNYPSFIALFTDEHSTSNQKVVKEFQRTVTNVGKGGMAYTAKLAGMDG  717

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V P+KL+F ++ +KQSYKL +E P ++   ++FG L+WV++ GK+VVRSPIVA
Sbjct  718  IKVMVKPEKLIFKQRYEKQSYKLSLEVPKSLKIEVIFGYLSWVDDDGKYVVRSPIVA  774



>ref|XP_009787984.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  591  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  649

Query  576  TS-SYNCSNPSLDLNYPSFIAFFPANA--TLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S ++NCSNPS DLNYPSFIA +P     TL +    Q+F RT+TN+G G +TY AK+  
Sbjct  650  SSDNHNCSNPSADLNYPSFIALYPLEGPFTLLE----QKFRRTVTNVGKGAATYKAKIKA  705

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  V+V P  L+F KK++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  706  PKNTTVSVSPQTLMFKKKNEKQSYTLTIRYLGDEGQSRNVGSITWVEENGSHSVRSPIV  764



>gb|ACA64702.1| subtilase [Nicotiana tabacum]
Length=773

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  591  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYLNLLCSLNFTEEQFKTIAR  649

Query  576  TS-SYNCSNPSLDLNYPSFIAFFPANA--TLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S ++NCSNPS DLNYPSFIA +P     TL +    Q+F RT+TN+G G +TY AK+  
Sbjct  650  SSDNHNCSNPSADLNYPSFIALYPLEGPFTLLE----QKFRRTVTNVGKGAATYKAKIKA  705

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  V+V P  L+F KK++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  706  PKNTTVSVSPQTLMFKKKNEKQSYTLTIRYLGDEGQSRNVGSITWVEENGSHSVRSPIV  764



>ref|XP_006466594.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=786

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D   +N  ASPL MGAGHINPN+ALDPGL+YD +++DYI L+CA+ + P   + I   
Sbjct  604  IKDASNNNFPASPLDMGAGHINPNKALDPGLVYDATAEDYIKLLCAMNYKPEQIR-IFTK  662

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SS  C++ SLDLNYPSFI FF    + S    V+EF RT+TN  +  + Y+AKLT I  +
Sbjct  663  SSQECNDLSLDLNYPSFITFFNDYDSSSAEKVVKEFWRTVTNAEEVGTAYTAKLTGIDGL  722

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             V V P +LVF +K +KQSYKL +E P  +   +V+GS++WV++ G++VVRSPIVA
Sbjct  723  KVYVEPQRLVFKQKYEKQSYKLTLEGPKLLEKEVVYGSISWVDDDGRYVVRSPIVA  778



>ref|XP_003566210.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=754

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 124/179 (69%), Gaps = 7/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G DN AA+PLAMG+GHI+P RALDPGL+YD   +DYI L+CA+ +T    +T+++
Sbjct  573  PIKDMGRDNRAATPLAMGSGHIDPTRALDPGLVYDAGPEDYIKLMCAMNYTAEQIKTVVK  632

Query  576  --TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
              +S  +CS  SLDLNYPSFIA+F  +    +    + F+R +TN+GD  ++YSAK+  +
Sbjct  633  PPSSPVDCSGASLDLNYPSFIAYFDPSGAAGE----KTFNRVVTNVGDAPASYSAKVKGL  688

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              + V+VVP +LVF  K +KQ Y + I       D ++ GSLTWV++A KH VRSPIVA
Sbjct  689  SGLTVSVVPSRLVFGGKHEKQRYTVVIRG-QMKDDVVLHGSLTWVDDARKHTVRSPIVA  746



>pdb|3I6S|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3
 pdb|3I6S|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3
 pdb|3I74|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3 In Complex With A Chloromethylketone Inhibitor
 pdb|3I74|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3 In Complex With A Chloromethylketone Inhibitor
Length=649

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D   +N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  468  PIKD-SDNNKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  526

Query  576  TS-SYNCSNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S S+NCSNPS DLNYPSFIA +    N TL +    Q+F RT+TN+G G +TY AKL  
Sbjct  527  SSASHNCSNPSADLNYPSFIALYSIEGNFTLLE----QKFKRTVTNVGKGAATYKAKLKA  582

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  ++V P  LVF  K++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  583  PKNSTISVSPQILVFKNKNEKQSYTLTIRYIGDEGQSRNVGSITWVEQNGNHSVRSPIV  641



>emb|CBI19501.3| unnamed protein product [Vitis vinifera]
Length=1686

 Score =   185 bits (470),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+C++ FT     TI R+
Sbjct  419  IRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQDYVNLLCSMNFTTKQILTITRS  478

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            ++Y CSNPS DLNYPSFIA +   +T      VQ+F RT+TN+GDG S+Y A +T     
Sbjct  479  NTYTCSNPSPDLNYPSFIALYNNKST----AFVQKFQRTVTNVGDGASSYKAIVTAPKGS  534

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             V V P  L F  K +K SY L IE  S     + FGSLTW+E+ GKH VRSPIV
Sbjct  535  KVMVSPATLAFENKYEKLSYTLTIEYKSEKDGKVSFGSLTWIEDDGKHTVRSPIV  589


 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = -2

Query  753   IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
             I+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+C++ FT     TI R+
Sbjct  992   IRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQDYVNLLCSMNFTTKQILTITRS  1051

Query  573   SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
             ++Y CSN S DLNYPSFIA +   +T      VQ+F RT+TN+GD  ++Y A +T     
Sbjct  1052  NTYTCSNSSPDLNYPSFIALYNNKST----TFVQKFQRTVTNVGDKAASYKAMVTAPKGS  1107

Query  393   NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V + P  L F  K +K  Y L I+  S     + FGSLTWVE+ GKH VRSPIV
Sbjct  1108  KVMISPATLAFENKYEKLDYTLTIKYKSHKDGKVSFGSLTWVEDDGKHTVRSPIV  1162


 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 101/169 (60%), Gaps = 1/169 (1%)
 Frame = -2

Query  735   DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCS  556
             D    S  +M   H +   AL  GL+YD + QDY+NL+C++ FT     TI R+++Y C 
Sbjct  1510  DYTMVSGTSMACPHASGVAALLRGLVYDATPQDYVNLLCSMNFTKKQILTITRSNTYTCP  1569

Query  555   NPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVP  376
               S DLNYPSFIA +  N   S    VQ+F RT+TN+GDG +TY A +       VTV P
Sbjct  1570  KTSPDLNYPSFIALYSQNDNKST-TVVQKFQRTVTNVGDGTATYHATVIAPRGSKVTVSP  1628

Query  375   DKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               LVF KK +KQSY + I+  S     + FG LTW+E+ G+H VRSPIV
Sbjct  1629  TTLVFEKKYEKQSYTMSIKYKSDKDGKISFGWLTWIEDDGEHTVRSPIV  1677



>ref|NP_001234774.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA06997.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA07001.1| subtilisin-like protease [Solanum lycopersicum]
Length=761

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D   +N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  580  PIKDSD-NNKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  638

Query  576  TS-SYNCSNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S S+NCSNPS DLNYPSFIA +    N TL +    Q+F RT+TN+G G +TY AKL  
Sbjct  639  SSASHNCSNPSADLNYPSFIALYSIEGNFTLLE----QKFKRTVTNVGKGAATYKAKLKA  694

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  ++V P  LVF  K++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  695  PKNSTISVSPQILVFKNKNEKQSYTLTIRYIGDEGQSRNVGSITWVEQNGNHSVRSPIV  753



>ref|XP_006345401.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=761

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 120/179 (67%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    N AA+PL MGAGH++PNRALDPGL+YD + QDY+NL+C+L FT    +TI R
Sbjct  580  PIKDSDI-NKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIAR  638

Query  576  TSS-YNCSNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S+ +NCSNPS DLNYPSFIA +    N TL +    Q+F RT+TN+G G +TY AKL  
Sbjct  639  SSANHNCSNPSADLNYPSFIALYSIEGNFTLLE----QKFKRTVTNVGKGAATYKAKLKA  694

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N  ++V P  LVF  K++KQSY L I      G     GS+TWVE  G H VRSPIV
Sbjct  695  PKNSTISVSPQTLVFKNKNEKQSYTLTIRYIGDEGQSRNVGSITWVEQNGNHSVRSPIV  753



>ref|XP_011074393.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=767

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 120/178 (67%), Gaps = 7/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+ FD  AA+PL +G+G ++PNRALDPGLIYDVS QD +NL+C++ FT   TQTIIR
Sbjct  586  PIKDMAFDYTAATPLGIGSGLVDPNRALDPGLIYDVSHQDLVNLVCSMNFTREQTQTIIR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNR--VQEFHRTLTNLGDGISTYSAKLTPI  403
             SS+NCS PS DLNYPSF+A F    + ++  R   + F RT+TN+GDG + Y  KL   
Sbjct  646  -SSHNCSTPSADLNYPSFVALF----SFAERGRTLTRRFQRTVTNVGDGAARYRVKLETP  700

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N  V + P  LVF KK +K+SY L I   + +      GSLTW+E  GK+ VRSPI+
Sbjct  701  ENTTVRIQPQTLVFQKKYEKKSYVLTIRYKADIETQNRDGSLTWIEENGKYRVRSPIM  758



>ref|XP_004492811.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 120/176 (68%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G+   +ASP A+GAG I+PNRA++PGLIYD + QDY+NL+C L +T     +I R
Sbjct  581  PIRDSGYLLQSASPFAIGAGEIDPNRAMNPGLIYDATPQDYVNLLCGLNYTKEQILSITR  640

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +S YNC NPSLDLNYPSFIAFF    +L+     Q+F RT+TN+GDG ++Y  K+T    
Sbjct  641  SSHYNCDNPSLDLNYPSFIAFFSNKTSLTG----QKFKRTVTNVGDGGASYRVKVTQPKG  696

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV PD L F+  ++K+SY + I+      + + FG L W+E+ GKH VRSPIV
Sbjct  697  YVVTVSPDILDFSYGNEKKSYYVFIKCVVYNEENVSFGDLVWIEDGGKHSVRSPIV  752



>gb|EPS63009.1| subtilisin-like protease preproenzyme [Genlisea aurea]
Length=716

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +N  A+P  +G+GHINP RAL+PGLIYD  ++DYINL+C L FT    +TI R
Sbjct  541  PIKDSGINNEFANPFGIGSGHINPTRALNPGLIYDAGTEDYINLLCGLNFTARQIKTIAR  600

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +   +CS PSLDLNYPSFIA+F  N        V+ F RT+TN+GD  S Y A+L+    
Sbjct  601  SKPRSCSKPSLDLNYPSFIAYFDGNG---GGKTVKAFRRTVTNVGDVDSVYVARLSKFNG  657

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            VN+TV P++L F +K  K+ + +RIE      + +++G LTWV+  GK+ V++PIV
Sbjct  658  VNLTVSPERLEFDEKHRKRRFTVRIEGRKRSINSVIYGYLTWVDTNGKYTVKTPIV  713



>emb|CDP01316.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = -2

Query  756  PIQDI-GFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI++I GF+N  ASPL+MGAG +NPN ALDPGLIYD ++QDY+ L+C++ +T    +TI 
Sbjct  578  PIREINGFNNPIASPLSMGAGQVNPNSALDPGLIYDATAQDYMELLCSINYTRKQIRTIT  637

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            R SSYNCS  S DLNYPSF++ + +    S     Q F R +TN+GDG +TY AK+TP  
Sbjct  638  R-SSYNCSKASSDLNYPSFVSLYTSGTNAS----TQNFKRIVTNVGDGAATYKAKVTPPE  692

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               VTV P+ LVF KK +K+SY L I       + + +G++ WVE+ GKH VRSPIV
Sbjct  693  GSVVTVFPETLVFRKKYEKRSYSLTIHTKIDENNQVTYGAVIWVEDNGKHSVRSPIV  749



>gb|EYU36350.1| hypothetical protein MIMGU_mgv1a001799mg [Erythranthe guttata]
Length=757

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 116/175 (66%), Gaps = 3/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D  F+   A+PLAMGAG ++PNRALDPGL+YD + QDY+NL+C++ FT N   TI R 
Sbjct  578  IRDSYFNYETATPLAMGAGQVDPNRALDPGLVYDAAPQDYVNLLCSMNFTSNQIATITR-  636

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSY CSNPS DLNYPSFIA +  N T      V++F RT+TN+G    +Y  ++      
Sbjct  637  SSYKCSNPSSDLNYPSFIALYATNQTTG--GLVRKFERTVTNVGGDSGSYKVQVIAPSGS  694

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             V+V P  LVF KK +KQSY + +E        + FGS+TWVE+ GKH VRSPIV
Sbjct  695  KVSVDPSNLVFGKKYEKQSYSVTVEYNGDKSGGVTFGSITWVEDNGKHTVRSPIV  749



>ref|XP_010320327.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=757

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G + + A+PLAMGAG +NPN AL+PGLIYD + QDYINL+CA+KFT     TI R
Sbjct  577  PIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQDYINLLCAMKFTRKQILTITR  636

Query  576  TSSYNCSNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            +S+Y C N S DLNYPSFIA +     ATLS     Q+F RT+TN+GDG + YS  +T  
Sbjct  637  SSTYTCQNASSDLNYPSFIALYTNETGATLS-----QKFIRTVTNVGDGPANYSINMTVP  691

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N N++V P  L F+ K DK SY L +E        +VFGS+TWV+  G H V SPIV
Sbjct  692  SNTNISVYPSTLSFSSKYDKLSYTLTVEYSGNRTGEIVFGSITWVDVLGLHAVTSPIV  749



>ref|XP_009343175.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=761

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 2/177 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D    N  ASPL +GAGHI+PN+A+DPGLIYD ++QDYINL+CA+ +T    Q +I 
Sbjct  578  PIID-AHGNLPASPLDIGAGHISPNKAIDPGLIYDATAQDYINLLCAMNYTSKGIQ-VIT  635

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S  NC++ S+ LNYPSFIA+F    + S    VQEF RT+TN+G   S+Y+AKL  +  
Sbjct  636  GSKNNCTDRSIHLNYPSFIAYFNIEGSNSSAKVVQEFRRTVTNVGGEKSSYTAKLMAMTG  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            + V V P +LVF KK +K SYK+ +E    + + +V GSL W+++ GK+VVRSPIVA
Sbjct  696  LKVKVEPQRLVFKKKYEKLSYKVTLEGSKLLKEDVVQGSLIWIDDGGKYVVRSPIVA  752



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 123/177 (69%), Gaps = 5/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+GF+   ASPLAMGAGHINPN ALDPGLIYD ++QDYI+L+C +  T +   +I+R
Sbjct  580  PIKDMGFNYDIASPLAMGAGHINPNAALDPGLIYDATAQDYISLLCTMNLTRSQIASIVR  639

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            ++ Y+C N S DLNYPSFIA +  N +    N++  F RT+TN+GDG +TY A +T P G
Sbjct  640  STDYSCLNASSDLNYPSFIALY-NNGSTGVLNKI--FERTVTNVGDGPATYKAIVTAPRG  696

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V V V P  L F KK D+Q+Y L I   S     + FGS+TW +  GKHVVRSPIV
Sbjct  697  SV-VEVNPQTLAFQKKYDRQTYSLTIRYTSDNSAKVSFGSITWSDFGGKHVVRSPIV  752



>ref|XP_009345959.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=767

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  732  NAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSN  553
            N  ASPL +GAGHI+PN+A+DPGLIYD ++QDYINL+CA+ +T    Q +I  S  NC++
Sbjct  591  NLPASPLDIGAGHISPNKAIDPGLIYDATAQDYINLLCAMNYTSKGIQ-VITGSKNNCTD  649

Query  552  PSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPD  373
             S+ LNYPSFIA+F +  + S    VQEF RT+TN+G   S+Y+AKL  +  + V V P 
Sbjct  650  RSIHLNYPSFIAYFNSEGSNSSAKVVQEFRRTVTNVGGEKSSYTAKLMAMTGLKVKVEPQ  709

Query  372  KLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            +LVF KK +K SYK+ +E    + + +V GSL W+++ GK+VVRSPIVA
Sbjct  710  RLVFKKKYEKLSYKVTLEGLKLLKEDVVQGSLIWIDDGGKYVVRSPIVA  758



>gb|KHN06360.1| Subtilisin-like protease [Glycine soja]
Length=902

 Score =   180 bits (457),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 125/176 (71%), Gaps = 8/176 (5%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DI  D   ASPLAMG+GH+NPN+ALDPGL+YDV  QDY+NL+CAL FT  +   I R+
Sbjct  544  IKDIATDYRPASPLAMGSGHVNPNKALDPGLVYDVQVQDYVNLLCALNFTQQNITIITRS  603

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQ--EFHRTLTNLGDGISTYSAKLTPIG  400
            SS NCSNPSLDLNYPSFIAF+  NA+ +  +RV   EF RT+TN+G+G +TY+A +T I 
Sbjct  604  SSNNCSNPSLDLNYPSFIAFYSGNASSNHESRVNNWEFQRTVTNVGEGRTTYTASVTFIK  663

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
              NV+V+P KL F KKS++ SYKLRIE P   G    FG LTW +   KHV   P 
Sbjct  664  GFNVSVIPGKLAFKKKSERLSYKLRIEGPRIEG----FGHLTWTDM--KHVGTRPF  713



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 126/183 (69%), Gaps = 7/183 (4%)
 Frame = -2

Query  756  PIQDIGFDNAA-----ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHT  592
            PI D+G D+       A+PLAMGAGHINPNRAL PGL+YD ++QDYINL+CA+  TP   
Sbjct  575  PIGDLGSDDNGDNFLPATPLAMGAGHINPNRALKPGLVYDATTQDYINLMCAMNLTPKQI  634

Query  591  QTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT--LSDPNRVQEFHRTLTNLGDGISTYSA  418
              +  +SS +CS+PSLDLNYPSFIAFF  N T    D +  + F RT+TN+G+G + Y A
Sbjct  635  NVVTGSSSPDCSSPSLDLNYPSFIAFFDGNNTKKTEDSSVEKVFKRTVTNVGEGAARYEA  694

Query  417  KLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRS  238
            K+T I    V V P+KLVF +K +K+S+++RIE P  M    +FG L W +  GK++VRS
Sbjct  695  KVTAIEGFKVEVKPEKLVFAEKKEKKSFEVRIEGPRFMEVDKLFGFLIWEDEEGKYMVRS  754

Query  237  PIV  229
            PIV
Sbjct  755  PIV  757



>gb|AAY63882.1| subtilisin-like serine protease [Solanum tuberosum]
Length=656

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSY--N  562
            DN  A+PL MGAGHI+PNRALDPGL+YD + QDYINLIC++ FT    +T  R+S+   N
Sbjct  478  DNMIATPLDMGAGHIDPNRALDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYDN  537

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G ++Y  K+    N  V+V
Sbjct  538  CSNPSADLNYPSFIALYPFSLEGNFTWLEQKFRRTLTNVGKGGASYKVKIETPKNSTVSV  597

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF +K+DKQSY L I           FGS+TW+E  G H VRSPIV
Sbjct  598  SPRTLVFKEKNDKQSYNLTIRYIGDSDQSRNFGSITWIEQNGNHTVRSPIV  648



>ref|XP_011069661.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 116/176 (66%), Gaps = 3/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+GF    A+PL +GAG ++PNRALDPGLIYD + QDY++L+C++ FT   TQTI+R
Sbjct  605  PIKDMGFGYQVATPLGIGAGQVDPNRALDPGLIYDATMQDYVDLVCSMNFTTAQTQTILR  664

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSYNCS PS DLNYPSFI  +    T +   R  +F RTLTN+G+G + Y  K+     
Sbjct  665  -SSYNCSTPSSDLNYPSFIVLYETQETTTTSTR--KFRRTLTNVGNGPAAYKVKVEEPNG  721

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              + V P  L+FT+K +KQSY L I    +    L  GS+TW+E  G H VRSPIV
Sbjct  722  STIAVSPQTLMFTRKDEKQSYSLTIRYTISSEFVLAPGSITWIEENGNHTVRSPIV  777



>ref|XP_004229665.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            +N  A+PL MG+GH++PN+ALDPGLIYD + QDYINLIC+L FT    +T  R+S+  +N
Sbjct  596  NNRVATPLEMGSGHVDPNKALDPGLIYDATPQDYINLICSLNFTEEQFKTFARSSANYHN  655

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY  K+    N  ++V
Sbjct  656  CSNPSADLNYPSFIALYPFSIERNYTWLEQKFRRTLTNVGKGEATYKVKIETPKNSTISV  715

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF  K+DKQSY L I           FGS+TWVE  G H VRSPIV
Sbjct  716  SPRTLVFKGKNDKQSYSLTIRYIGDSDQSTNFGSITWVEEKGNHSVRSPIV  766



>ref|XP_006655358.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=761

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 124/180 (69%), Gaps = 6/180 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G  N  A+PLAMG+GHI+PNRA+DPGL+YD   +DY+ L+CA+ +T    +T+ +
Sbjct  577  PIKDMGRGNRGATPLAMGSGHIDPNRAVDPGLVYDAGPEDYVRLMCAMNYTEAQIKTVAQ  636

Query  576  --TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
              +++ +C+  SLDLNYPSFIAFF   AT      V+ F R +TN+GD  ++YSAK+  +
Sbjct  637  SPSAAVDCTGASLDLNYPSFIAFFDPGATAP---AVRTFTRVVTNVGDAPASYSAKVKGL  693

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAP-STMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            G + VTV P++LVF  K + Q Y + I        D ++ GSLTWV+++GK+ VRSPIVA
Sbjct  694  GGLTVTVAPERLVFGGKHETQKYTVVIRGQMKKKTDEVLHGSLTWVDDSGKYTVRSPIVA  753



>emb|CDP01318.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PIQDIG +N  ASPL+MGAG +NPN AL+PGLIY+ +++DYINL+C+  +T    + I R
Sbjct  590  PIQDIGLNNTIASPLSMGAGEVNPNGALNPGLIYNATTEDYINLLCSANYTWKQIKIITR  649

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
             S+Y+CSN S D+NYPSFIA +  N T  +  + Q F RT+TN+G+G +TY A++T P G
Sbjct  650  -SNYSCSNASSDMNYPSFIALY--NNTTKNVLK-QRFQRTVTNVGNGAATYKAQVTAPKG  705

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
            +V VTV P+ LVF KK ++QSY L I+  +     + FGS+ WVE  GKH+VRSPI
Sbjct  706  SV-VTVYPEILVFGKKYEEQSYVLTIQYNANQNKTITFGSIVWVEVNGKHIVRSPI  760



>emb|CAA07059.1| SBT4B protein [Solanum lycopersicum]
Length=777

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            DN  A+PL MGAGH++PNRALDPGL+YD + QDYINLIC++ FT    +T  R+S+   N
Sbjct  595  DNMIATPLDMGAGHVDPNRALDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYNN  654

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY  K+    N  V+V
Sbjct  655  CSNPSADLNYPSFIALYPFSLEGNFTWLEQKFRRTLTNVGKGGATYKVKIETPKNSTVSV  714

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF  K+DKQSY L I           FGS+TWVE  G H VRSPIV
Sbjct  715  SPRTLVFKGKNDKQSYNLTIRYIGDSDQSKNFGSITWVEENGNHTVRSPIV  765



>gb|EAY98174.1| hypothetical protein OsI_20091 [Oryza sativa Indica Group]
Length=562

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 124/180 (69%), Gaps = 6/180 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G  N  A+PLAMG+GHI+PNRA+DPGL+YD  + DY+ L+CA+ +T    +T+ +
Sbjct  378  PIKDMGRANRGATPLAMGSGHIDPNRAVDPGLVYDAGADDYVKLMCAMNYTAAQIKTVAQ  437

Query  576  --TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
              +S+ +C+  +LDLNYPSFIAFF   AT       + F R +TN+GD  ++YSAK+  +
Sbjct  438  SPSSAVDCAGATLDLNYPSFIAFFDPGATAP---AARTFTRAVTNVGDAPASYSAKVKGL  494

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAP-STMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            G + V+V P++LVF +K + Q Y + I        D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  495  GGLTVSVSPERLVFGRKHETQKYTVVIRGQMKNKTDEVLHGSLTWVDDAGKYTVRSPIVA  554



>gb|KJB43733.1| hypothetical protein B456_007G214100 [Gossypium raimondii]
Length=758

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+   N  ASPL +GAGHINP +ALDPGL+YD + +DY+ L+CA+ +T    +   +
Sbjct  576  PIKDVSNFNQPASPLDIGAGHINPIKALDPGLVYDATPEDYMKLLCAMNYTSKKIRMFTK  635

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRV-QEFHRTLTNLGDGISTYSAKLTPIG  400
             S ++C N SLDLNYP+FIAFF  +   +  ++  QEF RT+TN+G     Y+AK+T + 
Sbjct  636  LS-HDCMNRSLDLNYPTFIAFFNDDGLSTSADKFEQEFQRTVTNVGKEGMAYTAKVTGMD  694

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             + V V P KLVF +K +KQSYKLR+E P  +   ++FG+L+W ++AGK++V SPI+A
Sbjct  695  GIKVVVEPPKLVFKQKYEKQSYKLRLEGPKLLKKDVIFGALSWRDDAGKYMVTSPIMA  752



>ref|XP_007139763.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
 gb|ESW11757.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
Length=739

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 122/177 (69%), Gaps = 6/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G+ +  ASPL MGAG I+PN+ALDPGLIYD + QDY+NL+CAL +T      + R
Sbjct  561  PIRDYGYPSQYASPLDMGAGQIDPNKALDPGLIYDATPQDYVNLLCALNYTLKQILALTR  620

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            + SYNC+ PS DLNYPSFIA + +N T+S    V +F RT+TN+G G +TY AK+T P G
Sbjct  621  SGSYNCAKPSFDLNYPSFIAIY-SNKTMS---VVHKFRRTVTNVGVGAATYRAKVTQPKG  676

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V VTV P+ L F  K++K SY + I+      + + +G L W+E+ G H VRSPIV
Sbjct  677  SV-VTVSPETLAFRYKNEKLSYDVMIKYRKYKKEDISYGDLIWIEDGGAHRVRSPIV  732



>ref|XP_006345406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 114/171 (67%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSY--N  562
            +N  A+PL MGAGH++PN+ALDPGLIYD + QDYINLIC+L FT    +T  R+S+   N
Sbjct  596  NNRVATPLEMGAGHVDPNKALDPGLIYDATPQDYINLICSLNFTEEQFKTFARSSANYNN  655

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY+ K+    N  ++V
Sbjct  656  CSNPSADLNYPSFIALYPFSIERNYTWLEQKFRRTLTNVGKGGATYNVKIETPKNSTISV  715

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF  K+DKQSY L I+          FGS+TWVE  G H VRSP+V
Sbjct  716  SPRTLVFKGKNDKQSYSLTIQYIGDSDQSTNFGSITWVEEKGNHSVRSPVV  766



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 124/179 (69%), Gaps = 13/179 (7%)
 Frame = -2

Query  753  IQDIGFDNAA-ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            IQD+G   +  ASPL +GAGHI+PN+AL+PGL+YD SS+DY+N +CA+ FT N  QTI R
Sbjct  529  IQDLGSQRSQPASPLGIGAGHIDPNKALNPGLVYDTSSEDYVNFLCAMNFTKNQIQTITR  588

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI-G  400
            +   +C+NPSLDLNYPSFI F  AN T    N V+EF RT+T +G G S Y+A+++    
Sbjct  589  SVISSCTNPSLDLNYPSFITFSDANGT----NSVREFRRTVTYVGQGSSVYTARISEFYE  644

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFL--VFGSLTWVENAGKHVVRSPIV  229
             ++V V PD + F +K +K+++ L IE     G  +   FGSL+WVE+ GK VVRSPIV
Sbjct  645  GLSVRVSPDTIEFKRKFEKKNFTLTIE-----GKMMNKTFGSLSWVESKGKIVVRSPIV  698



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 115/177 (65%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAA-ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D G DN + ASPLAMGAG I+PN+ALDPGLIYD + QDY+NL+C + FT +   TI 
Sbjct  583  PIRDNGDDNLSFASPLAMGAGQIDPNQALDPGLIYDATPQDYVNLLCTMNFTRSQILTIT  642

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            R+ SYNCSNPS DLNYPSFIA +  N T       + F RT+TN+G+G +TY+ K+    
Sbjct  643  RSKSYNCSNPSSDLNYPSFIALYNPNVT---ETVAKIFRRTVTNMGEGAATYNVKIVQPE  699

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               + V P+ LVF    +KQ + + I   S     + FG L WVE  GKH VRSP+V
Sbjct  700  GSTIVVSPETLVFKNTYEKQIFSVTISYSSHKKGRVSFGELVWVEENGKHTVRSPVV  756



>ref|NP_001055646.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|AAT58881.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF17560.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|EEE63841.1| hypothetical protein OsJ_18665 [Oryza sativa Japonica Group]
Length=761

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 124/180 (69%), Gaps = 6/180 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D+G  N  A+PLAMG+GHI+PNRA+DPGL+YD  + DY+ L+CA+ +T    +T+ +
Sbjct  577  PIKDMGRANRGATPLAMGSGHIDPNRAVDPGLVYDAGADDYVKLMCAMNYTAAQIKTVAQ  636

Query  576  --TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
              +S+ +C+  +LDLNYPSFIAFF   AT       + F R +TN+GD  ++YSAK+  +
Sbjct  637  SPSSAVDCAGATLDLNYPSFIAFFDPGATAP---AARTFTRAVTNVGDAPASYSAKVKGL  693

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAP-STMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            G + V+V P++LVF +K + Q Y + I        D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  694  GGLTVSVSPERLVFGRKHETQKYTVVIRGQMKNKTDEVLHGSLTWVDDAGKYTVRSPIVA  753



>ref|XP_004143027.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN62450.1| hypothetical protein Csa_2G354760 [Cucumis sativus]
Length=757

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 121/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G +N  A+PLAMG+GH+NPN+A+DP LIYDV  QDY+N++CAL +T N  + I R+
Sbjct  576  IKDFGNNNKFATPLAMGSGHVNPNKAIDPDLIYDVGIQDYVNVLCALNYTENQIRIITRS  635

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQ-EFHRTLTNLGDGISTYSAKLTPIGN  397
             S NC NPSLDLNYPSFI    ++ + +   ++  EF RTLT +G+  +TY AKLT +  
Sbjct  636  DSNNCENPSLDLNYPSFIMIVNSSDSKTRKRKISGEFKRTLTKIGEHRATYEAKLTGMKG  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V V P+KL F +K+ K S++L+I A S     +VFG L+W E  G H+++SPIV
Sbjct  696  FKVRVKPNKLNFKRKNQKLSFELKI-AGSARESNIVFGYLSWAEVGGGHIIQSPIV  750



>ref|XP_004156411.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=757

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 121/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G +N  A+PLAMG+GH+NPN+A+DP LIYDV  QDY+N++CAL +T N  + I R+
Sbjct  576  IKDFGNNNKFATPLAMGSGHVNPNKAIDPDLIYDVGIQDYVNVLCALNYTENQIRIITRS  635

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQ-EFHRTLTNLGDGISTYSAKLTPIGN  397
             S NC NPSLDLNYPSFI    ++ + +   ++  EF RTLT +G+  +TY AKLT +  
Sbjct  636  DSNNCENPSLDLNYPSFIMIVNSSDSKTRKRKISGEFKRTLTKIGEHRATYEAKLTGMKG  695

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V V P+KL F +K+ K S++L+I A S     +VFG L+W E  G H+++SPIV
Sbjct  696  FKVRVKPNKLNFKRKNQKLSFELKI-AGSARESNIVFGYLSWAEVGGGHIIQSPIV  750



>gb|KHN06359.1| Subtilisin-like protease [Glycine soja]
Length=201

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 110/175 (63%), Gaps = 28/175 (16%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG  +   SPLA+ AGH+NPNRALDPGL+YDV  QDY+NL+CAL FT  +  TI R+
Sbjct  43   IKDIGDGHKQTSPLALRAGHVNPNRALDPGLVYDVGVQDYVNLLCALNFTQKNITTITRS  102

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            SSYNCS  SLDLNYPSFIA F  N                       S+ ++++T IG+ 
Sbjct  103  SSYNCSRLSLDLNYPSFIALFTGNG----------------------SSINSRVTLIGSF  140

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               V+P KL+F +K +K SY+LRIE P   G    FG L+W +   KHVVRSPIV
Sbjct  141  RERVIPSKLLFKQKKEKLSYELRIEGPKIEG----FGYLSWTDV--KHVVRSPIV  189



>ref|XP_011464036.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=474

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = -2

Query  708  MGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNP-SLDLNY  532
             GAGHI PN+ALDPGL+YD ++ DYI L+CA+ +T    Q II  S Y C+N  ++DLNY
Sbjct  303  FGAGHITPNKALDPGLVYDAAADDYIALLCAMNYTAKQIQ-IITGSIYICTNRFNIDLNY  361

Query  531  PSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKK  352
            PSFIA+F  N + SD   VQEF RTLTN+G+  S+Y   LTP+  + + V P KLVFTKK
Sbjct  362  PSFIAYFNNNGSNSDAKVVQEFRRTLTNVGEKQSSYFVNLTPMVGLKLKVEPQKLVFTKK  421

Query  351  SDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             +K  YKL I  P  + + +V GSL W+++ GK+VVR PIVA
Sbjct  422  YEKLRYKLTIVGPKLLKEDVVQGSLIWIDDGGKYVVRCPIVA  463



>gb|ACL52543.1| unknown [Zea mays]
Length=500

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 19/187 (10%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII--  580
            I+D+G  N  ASPLAMG+GHI+P RA+DPGL+YD + +DY+ L+CA+ +T    +T++  
Sbjct  314  IKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQ  373

Query  579  --RTSSY--NCSNPSLDLNYPSFIAFFPANATLSDPNR---VQEFHRTLTNLGDGISTYS  421
               +SSY  +C+  SLDLNYPSFIAFF       DPN     + F RT+TN+GDG ++YS
Sbjct  374  SPSSSSYAVDCTGASLDLNYPSFIAFF-------DPNGGSVERTFTRTVTNVGDGPASYS  426

Query  420  AKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPST--MGDFLVFGSLTWVENAGKHV  247
             K+  +  + V V PDKL F  K++KQ Y L I    T   GD L  GSLTWV++AGK+ 
Sbjct  427  VKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTNKSGDVL-HGSLTWVDDAGKYT  485

Query  246  VRSPIVA  226
            VRSPIVA
Sbjct  486  VRSPIVA  492



>gb|AFW81832.1| putative subtilase family protein [Zea mays]
Length=500

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 19/187 (10%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII--  580
            I+D+G  N  ASPLAMG+GHI+P RA+DPGL+YD + +DY+ L+CA+ +T    +T++  
Sbjct  314  IKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQ  373

Query  579  --RTSSY--NCSNPSLDLNYPSFIAFFPANATLSDPNR---VQEFHRTLTNLGDGISTYS  421
               +SSY  +C+  SLDLNYPSFIAFF       DPN     + F RT+TN+GDG ++YS
Sbjct  374  SPSSSSYAVDCTGASLDLNYPSFIAFF-------DPNGGSVERTFTRTVTNVGDGPASYS  426

Query  420  AKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPST--MGDFLVFGSLTWVENAGKHV  247
             K+  +  + V V PDKL F  K++KQ Y L I    T   GD L  GSLTWV++AGK+ 
Sbjct  427  VKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTNKSGDVL-HGSLTWVDDAGKYT  485

Query  246  VRSPIVA  226
            VRSPIVA
Sbjct  486  VRSPIVA  492



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 113/175 (65%), Gaps = 4/175 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+C++ FT     TI R+
Sbjct  585  IRDNGLSFEIASPLAMGAGQIDPNRALDPGLIYDATPQDYVNLLCSMNFTTKQILTITRS  644

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            ++Y CSN S DLNYPSFIA +   +T      VQ+F RT+TN+GD  ++Y A +T     
Sbjct  645  NTYTCSNSSPDLNYPSFIALYNNKST----TFVQKFQRTVTNVGDKAASYKAMVTAPKGS  700

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             V + P  L F  K +K  Y L I+  S     + FGSLTWVE+ GKH VRSPIV
Sbjct  701  KVMISPATLAFENKYEKLDYTLTIKYKSHKDGKVSFGSLTWVEDDGKHTVRSPIV  755



>ref|XP_010687642.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 122/176 (69%), Gaps = 4/176 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D G +   A+PLAMG+G I+PNRALDPGL+YD++ QDY+NLIC++ FT N   +IIR+
Sbjct  599  IKDNGSNLGPATPLAMGSGQIDPNRALDPGLVYDLTPQDYMNLICSMNFTRNQMLSIIRS  658

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLG-DGISTYSAKLTPIGN  397
            + +NCS  S DLNYPSFIA++  ++T         F+RT+TN+G DG + Y A +T    
Sbjct  659  NKHNCSASSSDLNYPSFIAYYNYDST---KTAAMTFYRTVTNVGKDGFTAYKAVVTAPKG  715

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V V P  LVF ++++KQSY+LRI+  S     + FGS+ W+EN G+H VRSPIV
Sbjct  716  ARVRVHPRTLVFNRRNEKQSYQLRIKYKSVDKLGISFGSIVWMENNGQHSVRSPIV  771



>ref|XP_006345402.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=760

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 10/171 (6%)
 Frame = -2

Query  732  NAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNCS  556
            N  A+PLAMG+GH+NPNRALDPGL+YD + QDY+NL+C++ FT    +TI R+S+ +NCS
Sbjct  589  NREATPLAMGSGHVNPNRALDPGLVYDATPQDYVNLLCSMNFTEEQFKTIARSSANHNCS  648

Query  555  NPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            +PS DLNYPSFIA +    N T  +    Q+F RT+TN+G G +TY AK+    N  V+V
Sbjct  649  DPSADLNYPSFIALYSNEGNYTWLE----QKFRRTVTNVGQGAATYKAKIKAPKNSKVSV  704

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LV+  K++KQSY L I     +G    +GS+TWVE  G H VRSPIV
Sbjct  705  SPQTLVYKNKNEKQSYTLTIR---YIGPNWNYGSITWVEEHGNHTVRSPIV  752



>ref|XP_004229664.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=781

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 115/178 (65%), Gaps = 4/178 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D   +N  A+PL MGAGH++PNRALDPGL+YD + QDYINLIC++ FT    +T  R
Sbjct  594  PIRDD--NNWVATPLDMGAGHVDPNRALDPGLVYDATPQDYINLICSMNFTEEQFKTFAR  651

Query  576  TSS--YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            +S+   NCSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G + Y  K+   
Sbjct  652  SSANYENCSNPSADLNYPSFIALYPYSLEGNFTWLEQKFRRTLTNVGKGGAIYKVKIETP  711

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N  V+V P  LVF  K+D+QSY L I           FGS+TWVE  G H VRSPIV
Sbjct  712  KNSTVSVSPQTLVFKGKNDRQSYNLTIRYIGDSDQGRNFGSITWVEENGNHTVRSPIV  769



>gb|EYU19442.1| hypothetical protein MIMGU_mgv1a001731mg [Erythranthe guttata]
Length=768

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+++  D   A+PL +G+G ++PNRALDPGLIYD ++QD +NL+C++ FT   TQTI+R
Sbjct  588  PIREV--DGTVATPLGIGSGQVDPNRALDPGLIYDATTQDLVNLVCSMNFTSEQTQTIVR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRV--QEFHRTLTNLGDGISTYSAKLTPI  403
            +++YNCSNPS DLNYPSF+A         D  RV  + F RT+TN+GD  + Y  K+   
Sbjct  646  STNYNCSNPSSDLNYPSFVALI----NFEDIGRVLTRRFERTVTNVGDAAAKYRVKVEAP  701

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N  V V P  LVF KK++KQSY + I     +      GSLTW+E +GK+ VRSPI+
Sbjct  702  VNTTVRVRPQTLVFQKKNEKQSYTVTIRYNGDIETQHRPGSLTWIEQSGKYTVRSPIM  759



>gb|AES61117.2| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 7/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G  +  ASPLAMGAG I+PN+ALDPGLIYD + QDY+NL+C   +T + T TI R
Sbjct  585  PIMDNGNPSQFASPLAMGAGQIDPNKALDPGLIYDATPQDYVNLLCDFGYTHSQTLTITR  644

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +  YNC NPS DLNYPSFIA + AN T S     Q+F RT+TN+GDG ++Y+ K+T    
Sbjct  645  SKKYNCDNPSSDLNYPSFIALY-ANKTRSIE---QKFVRTVTNVGDGAASYNVKVTKPKG  700

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFL--VFGSLTWVEN-AGKHVVRSPIV  229
              VTVVP+KL F+ K++KQSY L ++        L  +FG + WVE   G H VRSPIV
Sbjct  701  CVVTVVPEKLEFSVKNEKQSYSLVVKYKRKNKKELNVLFGDIVWVEQGGGAHNVRSPIV  759



>ref|XP_003590866.1| Subtilisin-like protease [Medicago truncatula]
Length=752

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 120/179 (67%), Gaps = 7/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G  +  ASPLAMGAG I+PN+ALDPGLIYD + QDY+NL+C   +T + T TI R
Sbjct  571  PIMDNGNPSQFASPLAMGAGQIDPNKALDPGLIYDATPQDYVNLLCDFGYTHSQTLTITR  630

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +  YNC NPS DLNYPSFIA + AN T S     Q+F RT+TN+GDG ++Y+ K+T    
Sbjct  631  SKKYNCDNPSSDLNYPSFIALY-ANKTRSIE---QKFVRTVTNVGDGAASYNVKVTKPKG  686

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFL--VFGSLTWVEN-AGKHVVRSPIV  229
              VTVVP+KL F+ K++KQSY L ++        L  +FG + WVE   G H VRSPIV
Sbjct  687  CVVTVVPEKLEFSVKNEKQSYSLVVKYKRKNKKELNVLFGDIVWVEQGGGAHNVRSPIV  745



>ref|XP_006345405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=779

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 114/173 (66%), Gaps = 7/173 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSY--N  562
            DN  ASPL +G+GH++PNRALDPGL+YD + QDYINLIC+L FT    +T  R+S+   N
Sbjct  598  DNMVASPLGIGSGHVDPNRALDPGLVYDATPQDYINLICSLNFTEEQFKTFARSSTNYDN  657

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIAF+  +   + P   Q+F RTLTN+G G +TY  K+    N  ++V
Sbjct  658  CSNPSADLNYPSFIAFYSDSQEGNYPWLEQKFKRTLTNVGKGGATYRVKIENPRNSTISV  717

Query  381  VPDKLVFTKKSDKQSYKL--RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF  K++KQSY L  R   P   G     GS+TWVE  G H VRSPIV
Sbjct  718  SPQTLVFMNKNEKQSYTLTIRYRGPFNSGQ---DGSITWVEKNGNHSVRSPIV  767



>ref|XP_009595146.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=781

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 111/171 (65%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            D   A+PL MGAGH+NPNRALDPGL+YD + QDYINLIC++ FT    +T  R+S+   N
Sbjct  599  DGMVATPLDMGAGHVNPNRALDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYNN  658

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CS+PS DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY  K+    N  V+V
Sbjct  659  CSSPSADLNYPSFIALYPFSLEGNFTWLKQKFRRTLTNVGKGGTTYKVKIETPKNSTVSV  718

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF KK++KQSY L I            GS+TWVE  G H VRSPIV
Sbjct  719  SPKTLVFKKKNEKQSYTLTIRYIGDENQSRNVGSITWVEENGNHSVRSPIV  769



>ref|XP_002510194.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52381.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 120/177 (68%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAA-ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D G D    ASPLAMGAG I+PNRAL+PGLIYD + QDY+NL+C++ +T     TI 
Sbjct  583  PIRDNGDDKLGYASPLAMGAGQIDPNRALNPGLIYDATPQDYVNLLCSMNYTKKQILTIT  642

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAK-LTPI  403
            R++SYNC++ S  LNYPSFIA +  N T +     ++F RT+TN+G+G + Y+AK + P+
Sbjct  643  RSNSYNCTSSSSGLNYPSFIALYD-NKTSAGVTLTRKFRRTVTNVGEGAAIYNAKVIAPL  701

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
            G   VTV P+ LVF KK DKQSY+L I   +     + FGS+ W E  G H VRSPI
Sbjct  702  G-ATVTVWPETLVFGKKHDKQSYRLTIYYGADKKGKVSFGSIVWTEENGVHTVRSPI  757



>ref|XP_010093626.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB54387.1| Subtilisin-like protease [Morus notabilis]
Length=724

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = -2

Query  756  PIQDIG-FDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D+  FD      L  GAGHI PN+A++PGLIYD +++DYI ++C + +T    Q II
Sbjct  540  PIKDVARFDIPG---LETGAGHIVPNKAVEPGLIYDATAEDYIKVLCGMNYTAKQIQ-II  595

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRV-QEFHRTLTNLGDGISTYSAKLTPI  403
              S + C + SLDLNYPSF+A+F      S   +V +EF RT+TN+G+  STY AKL  +
Sbjct  596  TKSDHKCVDRSLDLNYPSFVAYFNGLGGSSPSGKVVREFKRTVTNVGEENSTYKAKLKAM  655

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
              +NV V P+KLVF KK +KQSYKL +E P  +      GSL+WVE+ GK+VVRSPI+A
Sbjct  656  NELNVKVEPEKLVFKKKYEKQSYKLTLEGPKLLKAETSLGSLSWVEDTGKYVVRSPILA  714



>ref|NP_001234780.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06998.1| subtilisin-like protease [Solanum lycopersicum]
Length=779

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 7/173 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            D+  ASPL +G+GH++PNRALDPGL+YD + QDYINLIC+L FT    +T  R+S+  +N
Sbjct  598  DDMVASPLGIGSGHVDPNRALDPGLVYDATPQDYINLICSLNFTEEQFKTFARSSANYHN  657

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIAF+  +   + P   Q+F RTLTN+G G +TY  K+    N  ++V
Sbjct  658  CSNPSADLNYPSFIAFYSYSQEGNYPWLEQKFRRTLTNVGKGGATYKVKIESPKNSTISV  717

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDF--LVFGSLTWVENAGKHVVRSPIV  229
             P  LVF  K++KQSY L I      GDF     GS+TWVE  G   VRSPIV
Sbjct  718  SPQTLVFKNKNEKQSYTLTIR---YRGDFNSGQTGSITWVEKNGNRSVRSPIV  767



>ref|XP_010320531.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=750

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 117/178 (66%), Gaps = 7/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G + + A+PLAMGAG +NPN AL+PGLIYD + QDYINL+C +KFT     TI R
Sbjct  569  PIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQDYINLLCTMKFTHKQILTITR  628

Query  576  TSSYNCSNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            +S+Y C N S DLNYPSFIA +     ATLS     Q+F RT+TN+G+G + YS  +   
Sbjct  629  SSTYTCQNASSDLNYPSFIALYTNETAATLS-----QKFVRTVTNVGNGPANYSINMIVP  683

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N NV+V P +L F+ K +K SY L +E        +VFGS+TWV+  G H V SPIV
Sbjct  684  SNTNVSVYPSRLSFSSKYEKLSYTLTVEYSGNRTGEVVFGSITWVDVIGLHAVTSPIV  741



>ref|XP_009771925.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=781

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            D   A+PL MGAGH++PN+ALDPGL+YD + QDYINLIC++ FT    +T  R+S+  +N
Sbjct  599  DGMVATPLDMGAGHVDPNKALDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYHN  658

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY  K+    N  V++
Sbjct  659  CSNPSADLNYPSFIALYPFSLEGNFTWLEQKFRRTLTNVGKGGATYKVKIETPKNSTVSM  718

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF KK++KQSY L I            GS+TWVE  G H VRSPIV
Sbjct  719  SPKTLVFKKKNEKQSYTLTIRYIGDENQSRNVGSITWVEENGNHSVRSPIV  769



>ref|XP_008444560.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 121/178 (68%), Gaps = 6/178 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG +N  A+PLAMG+GH+NPN+A+DP LIYDV  QDY+N++CAL +T N  + I R+
Sbjct  583  IKDIGNNNKFATPLAMGSGHVNPNKAVDPDLIYDVGIQDYVNVLCALNYTENQIRIITRS  642

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNR---VQEFHRTLTNLGDGISTYSAKLTPI  403
             S NC NPSLDLNYPSFI    AN++ S   +   + EF RTLT +G+  +TY AKL  +
Sbjct  643  DSNNCENPSLDLNYPSFIII--ANSSDSKTGKRKILGEFKRTLTKIGENRATYEAKLRGM  700

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
                V V P  L F +K+ K S++L+I A S     +VFG L+W E  G+H+V+SPIV
Sbjct  701  KGFKVRVKPRILEFKRKNQKLSFELKI-AGSAEESNVVFGYLSWAEVGGRHIVQSPIV  757



>ref|XP_006345400.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 111/171 (65%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSY--N  562
            DN  A+PL MGAGH++PN+ALDPGL+YD + QDYINLIC++ FT    +T  R+S+   N
Sbjct  595  DNFVATPLDMGAGHVDPNKALDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYDN  654

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN G G +TY  K+    N  V+V
Sbjct  655  CSNPSADLNYPSFIALYPFSLEGNFTWLEQKFRRTLTNAGKGRATYKVKIETPKNSTVSV  714

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF +K+DKQSY L I            GS+TWVE  G H VRSPIV
Sbjct  715  SPRTLVFKEKNDKQSYTLSIRYIGDSDQSRNVGSITWVEENGNHSVRSPIV  765



>ref|NP_001145972.1| uncharacterized protein LOC100279499 precursor [Zea mays]
 gb|ACL52959.1| unknown [Zea mays]
Length=774

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 19/187 (10%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII--  580
            I+D+G  N  ASPLAMG+GHI+P RA+DPGL+YD + +DY+ L+CA+ +T    +T++  
Sbjct  588  IKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQ  647

Query  579  --RTSSY--NCSNPSLDLNYPSFIAFFPANATLSDPNR---VQEFHRTLTNLGDGISTYS  421
               +SSY  +C+  SLDLNYPSFIAFF       DPN     + F RT+TN+GDG ++YS
Sbjct  648  SPSSSSYAVDCTGASLDLNYPSFIAFF-------DPNGGSVERTFTRTVTNVGDGPASYS  700

Query  420  AKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPST--MGDFLVFGSLTWVENAGKHV  247
             K+  +  + V V PDKL F  K++KQ Y L I    T   GD L  GSLTWV++AGK+ 
Sbjct  701  VKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTNKSGDVL-HGSLTWVDDAGKYT  759

Query  246  VRSPIVA  226
            VRSPIVA
Sbjct  760  VRSPIVA  766



>gb|AFW81831.1| putative subtilase family protein [Zea mays]
Length=774

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 125/187 (67%), Gaps = 19/187 (10%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII--  580
            I+D+G  N  ASPLAMG+GHI+P RA+DPGL+YD + +DY+ L+CA+ +T    +T++  
Sbjct  588  IKDMGNRNHPASPLAMGSGHIDPARAVDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQ  647

Query  579  --RTSSY--NCSNPSLDLNYPSFIAFFPANATLSDPNR---VQEFHRTLTNLGDGISTYS  421
               +SSY  +C+  SLDLNYPSFIAFF       DPN     + F RT+TN+GDG ++YS
Sbjct  648  SPSSSSYAVDCTGASLDLNYPSFIAFF-------DPNGGSVERTFTRTVTNVGDGPASYS  700

Query  420  AKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPST--MGDFLVFGSLTWVENAGKHV  247
             K+  +  + V V PDKL F  K++KQ Y L I    T   GD L  GSLTWV++AGK+ 
Sbjct  701  VKVLGLSGLTVIVSPDKLAFGGKNEKQKYTLVIRGKMTNKSGDVL-HGSLTWVDDAGKYT  759

Query  246  VRSPIVA  226
            VRSPIVA
Sbjct  760  VRSPIVA  766



>gb|KHN04972.1| Subtilisin-like protease [Glycine soja]
Length=454

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D       ASPLAMGAG I PNRALDPGLIYD + Q+Y+NL+CAL +T N   +I R
Sbjct  275  PIRDNANLFQYASPLAMGAGEIEPNRALDPGLIYDATPQNYVNLLCALGYTNNQILSITR  334

Query  576  TSSYNCS-NPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PI  403
            + SY CS NPS DLNYPSFI  + +N T S    V+EF R +TN+GDG +TY  K+T P 
Sbjct  335  SRSYECSANPSSDLNYPSFIVLY-SNKTRST---VREFRRIVTNVGDGAATYKVKVTQPK  390

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            G+V V V P+ L F  K++KQSY + ++      + + FG + WVE+ G   VRSPIV
Sbjct  391  GSV-VKVSPETLAFGYKNEKQSYSVTVKYTRNKKENISFGDIVWVEDGGARTVRSPIV  447



>gb|AAO62352.1| subtilase [Casuarina glauca]
Length=764

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 114/176 (65%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G D+  ASPLAMGAG+I+PN AL+PGL+YD + QDYINL+C++ F       IIR
Sbjct  586  PIRDNGLDHQVASPLAMGAGNIDPNCALEPGLVYDATPQDYINLLCSMNFDRTQILAIIR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            T SYNCSNPS DLNYPSFIAF        +   V++F RT+TN+GD ++ Y+A +     
Sbjct  646  TRSYNCSNPSSDLNYPSFIAFHNGK----NDTVVKKFRRTVTNVGDAVAIYNASIAAPRG  701

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V V P  LVF +K +++S+ L ++          FG+L W    GKH+VRSPIV
Sbjct  702  SRVVVYPQTLVFKEKYEQKSFTLTMKFKRGPKMDTSFGALVWTHENGKHIVRSPIV  757



>gb|ACA64704.1| subtilase [Nicotiana tabacum]
Length=781

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 110/171 (64%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            D   A+PL MGAGH+NPNRALDPGL+YD + QDYINLIC++ FT    +T  R+S+   N
Sbjct  599  DGMVATPLDMGAGHVNPNRALDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYNN  658

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CS+P  DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY  K+    N  V+V
Sbjct  659  CSSPCADLNYPSFIALYPFSLEGNFTWLKQKFRRTLTNVGKGGTTYKVKIETPKNSTVSV  718

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF KK++KQSY L I            GS+TWVE  G H VRSPIV
Sbjct  719  SPKTLVFKKKNEKQSYTLTIRYIGDENQSRNVGSITWVEENGNHSVRSPIV  769



>ref|XP_010320326.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 117/178 (66%), Gaps = 7/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G + + A+PLAMGAG +NPN AL+PGLIYD + QDYINL+CA+KFT     TI R
Sbjct  569  PIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQDYINLLCAMKFTHKQILTITR  628

Query  576  TSSYNCSNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            +S+Y C N S DLNYPSFIA +     ATLS     Q+F RT+TN+G+G + YS  +   
Sbjct  629  SSTYTCQNASSDLNYPSFIAPYTNETTATLS-----QKFVRTVTNVGNGPANYSINMVVP  683

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N N++V P +L F+ K +K SY L IE        +VFGSLTWV+  G H V S IV
Sbjct  684  SNTNISVYPSRLSFSSKYEKLSYTLTIEYSGNKTGEVVFGSLTWVDVIGLHAVTSSIV  741



>emb|CAA07062.1| SBT4E protein [Solanum lycopersicum]
Length=777

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTS-SY-N  562
            DN  A+PL MGAGH++PNRALDPGL+YD + QD+INLIC++ FT    +T  R+S SY N
Sbjct  595  DNFVATPLDMGAGHVDPNRALDPGLVYDATPQDHINLICSMNFTEEQFKTFARSSASYDN  654

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIA +P +   +     Q+F RTLTN+G G +TY  +     N  V+V
Sbjct  655  CSNPSADLNYPSFIALYPFSLEENFTWLEQKFRRTLTNVGKGGATYKVQTETPKNSIVSV  714

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF +K+DKQSY L I +          GS+TWVE  G H VRSPIV
Sbjct  715  SPRTLVFKEKNDKQSYTLSIRSIGDSDQSRNVGSITWVEENGNHSVRSPIV  765



>ref|XP_007147252.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
 gb|ESW19246.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
Length=765

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 118/176 (67%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI++ G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+CA+ FT      I R
Sbjct  584  PIEENGELFQRASPLAMGAGLIDPNRALDPGLIYDATPQDYVNLLCAMNFTQAQILAITR  643

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +  YNCS+PS D+NYPSF+AF    +   +    ++F R++T +GDG + Y+A+++    
Sbjct  644  SKDYNCSSPSYDVNYPSFVAFSVDKSVAVE----RKFRRSVTYVGDGSAVYTARVSSSNG  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              ++V P++LVF  K +K+ + L +++     + + FGSL WVE  G+HVVRSP+V
Sbjct  700  TQISVSPNRLVFKAKYEKRKFSLMLKSEMKKENVVPFGSLEWVEETGRHVVRSPLV  755



>ref|XP_007207210.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
 gb|EMJ08409.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
Length=739

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +   ASPLAMGAG I+PNRAL+PGLIYD + QDY+NL+C+  FT      I R
Sbjct  561  PIRDDGDNFNFASPLAMGAGQIDPNRALEPGLIYDATPQDYVNLLCSTNFTRKQILAITR  620

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CSNPS DLNYPSFIA +  N       +VQ+F RT+TN+GDG + Y A +     
Sbjct  621  SYAYDCSNPSCDLNYPSFIALY--NDHHKTKTKVQKFQRTVTNVGDGAARYKAAVIAPKG  678

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F +  +KQS+ + I+  +     +  G+L W+E  GK+ VRSPIV
Sbjct  679  SKVTVSPEILIFGETYEKQSFTVTIKYKAKKKGTVSSGALVWIEQNGKYTVRSPIV  734



>ref|XP_011074394.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=761

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 115/174 (66%), Gaps = 12/174 (7%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCS  556
            DN  A PL MG+G ++PNRALDPGL+YD S QD +NL+C++ FT   TQTIIR SSYNCS
Sbjct  587  DNTVALPLGMGSGLVDPNRALDPGLVYDASQQDLVNLVCSMNFTLEQTQTIIR-SSYNCS  645

Query  555  NPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVP  376
             PS +LNYPSFIA +  N+        + F RTLTN+GDG +TY  KL    N  + + P
Sbjct  646  TPSSNLNYPSFIAIY--NSPDQGRTLTRRFQRTLTNVGDGAATYRVKLEKPKNTKIQIRP  703

Query  375  DKLVFTKKSDKQSYKLRI--EAPSTMGDFLVF---GSLTWVENAGKHVVRSPIV  229
              LVF KK +KQSY L I  +AP    DF      GS+TW++N GK+ VRSPI+
Sbjct  704  QILVFKKKYEKQSYSLTITFKAP----DFTTGAPDGSITWIDNRGKYSVRSPIM  753



>ref|XP_010112176.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32842.1| Subtilisin-like protease [Morus notabilis]
Length=344

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 111/176 (63%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +   A PLA+GAG I+ NRALDPGLIYD + QDY+NL+C+  FT      II 
Sbjct  166  PIRDYGNNLQFAFPLAIGAGQIDSNRALDPGLIYDATPQDYVNLLCSTNFTKKQILAIIN  225

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            T+ Y+C     DLNYPSFIA +  +A   D    Q++ RTLTN+G+ + TY A +T    
Sbjct  226  TNKYDCPRAYYDLNYPSFIALYHDHAKWMD----QKYTRTLTNVGESVVTYKAMVTAPNF  281

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V V P+ LVF KK +++SY L I+    M   +  GSL WVE+ GKH VRSPIV
Sbjct  282  SEVVVSPNVLVFMKKHERKSYNLTIKYKGNMERRVSSGSLVWVEDNGKHTVRSPIV  337



>ref|XP_009342993.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 113/176 (64%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PNRALDPGLIYD + Q+Y+NL+C+  FT N   +I R
Sbjct  586  PILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQEYVNLLCSTNFTRNQILSITR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CS PS DLNYPSFIA   +N       RVQ F RT+TN+GDG + Y A +     
Sbjct  646  SHAYDCSKPSSDLNYPSFIAL--SNNDHKTKTRVQTFQRTVTNVGDGAARYMASVIAPKG  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F  K +KQS+ + I   +        G+L W+E  GK+ VRSPIV
Sbjct  704  SQVTVSPEILIFAYKYEKQSFTVTINFNAKKKGNASSGALVWIEQNGKYTVRSPIV  759



>gb|KHN14785.1| Subtilisin-like protease [Glycine soja]
Length=683

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 119/179 (66%), Gaps = 7/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+CAL +T N   TI R
Sbjct  502  PIRDNGNPLQYASPLAMGAGEIDPNRALDPGLIYDATPQDYVNLLCALGYTHNQILTITR  561

Query  576  TSSYNC--SNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-P  406
            + SYNC  + PS DLNYPSFI  + +N T S    V+EF RT+TN+GDG +TY  K+T P
Sbjct  562  SKSYNCPANKPSSDLNYPSFIVLY-SNKTKS--ATVREFRRTVTNVGDGAATYKVKVTQP  618

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             G+V V V P+ L F  K++KQSY + I+      + + FG + WV +     VRSPIV
Sbjct  619  KGSV-VKVSPETLAFGYKNEKQSYSVIIKYTRNKKENISFGDIVWVGDGDARTVRSPIV  676



>gb|EYU45084.1| hypothetical protein MIMGU_mgv1a001942mg [Erythranthe guttata]
Length=736

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 117/177 (66%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D   +  AA+PLAMG+GHI+PNRALDPGLIY+V+  DY+NL+C++ FT   T++I+R
Sbjct  559  PIRDSLLNFEAATPLAMGSGHIDPNRALDPGLIYNVTRHDYVNLVCSMNFTREQTKSILR  618

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             SSY+CS PS DLNYP+FIA +  N   +   RV  F R +TN+ DG S+Y  +L     
Sbjct  619  -SSYDCSTPSSDLNYPAFIAIYKQNREGTVMTRV--FKRRVTNVWDGPSSYRVELQLPKY  675

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAG-KHVVRSPIV  229
              VTV P  LVF KK ++ SY+L +      G     GS+TW E AG KH VRSPIV
Sbjct  676  TKVTVRPTTLVFNKKYEELSYQLTVSYSGGNGSLPAHGSITWTEEAGRKHSVRSPIV  732



>emb|CAA07060.1| SBT4C protein [Solanum lycopersicum]
Length=779

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 113/173 (65%), Gaps = 7/173 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS--YN  562
            D+  ASPL +G+GH++PNRALDPGL+YD + QDYINLIC+L FT    +T  R+S+  +N
Sbjct  598  DDMVASPLGIGSGHVDPNRALDPGLVYDATPQDYINLICSLNFTEEQFKTFARSSANYHN  657

Query  561  CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            CSNPS DLNYPSFIAF+  +   + P   Q+F RTLTN+G   +TY  K+    N  ++V
Sbjct  658  CSNPSADLNYPSFIAFYSYSQAGNYPWLEQKFRRTLTNVGKDGATYEVKIESPKNSTISV  717

Query  381  VPDKLVFTKKSDKQSYKL--RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             P  LVF  K++KQSY L  R       G     GS+TWVE  G H VRSP+V
Sbjct  718  SPQTLVFKNKNEKQSYTLTIRYRGDEKGGQ---DGSITWVEKNGNHSVRSPMV  767



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 113/176 (64%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PNRALDPGLIYD + Q+Y+NL+C+  FT N   +I R
Sbjct  620  PILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQEYVNLLCSTNFTRNQILSITR  679

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CS PS DLNYPSFIA   +N       RVQ F RT+TN+GDG + Y A +     
Sbjct  680  SHAYDCSKPSSDLNYPSFIAL--SNNDHKTKTRVQTFQRTVTNVGDGAARYMASVIAPKG  737

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F  K +KQS+ + I   +        G+L W+E  GK+ VRSPIV
Sbjct  738  SQVTVSPEILIFAYKYEKQSFTVTINFNAKKKGNASSGALVWIEQNGKYTVRSPIV  793



>ref|XP_003535388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 119/179 (66%), Gaps = 7/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G     ASPLAMGAG I+PNRALDPGLIYD + QDY+NL+CAL +T N   TI R
Sbjct  588  PIRDNGNPLQYASPLAMGAGEIDPNRALDPGLIYDATPQDYVNLLCALGYTHNQILTITR  647

Query  576  TSSYNC--SNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-P  406
            + SYNC  + PS DLNYPSFI  + +N T S    V+EF RT+TN+GDG +TY  K+T P
Sbjct  648  SKSYNCPANKPSSDLNYPSFIVLY-SNKTKS--ATVREFRRTVTNVGDGAATYKVKVTQP  704

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             G+V V V P+ L F  K++KQSY + I+      + + FG + WV +     VRSPIV
Sbjct  705  KGSV-VKVSPETLAFGYKNEKQSYSVIIKYTRNKKENISFGDIVWVGDGDARTVRSPIV  762



>ref|XP_008370912.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 4/177 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PN ALDPG IYD + Q+Y+NL+C+  FT N   +I R
Sbjct  586  PILDDGDNFXFASPLAMGAGHIDPNXALDPGJIYDATPQEYVNLLCSTNFTRNQILSITR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIG  400
            + +Y+CS PS DLNYPSFIA +  +       RVQ F RT+TN+GDG + Y A +T P+G
Sbjct  646  SHAYDCSKPSSDLNYPSFIALYXNHHKTK--KRVQTFQRTVTNVGDGAARYRASVTAPMG  703

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +  VTV P+ L+F  K +KQS+ + +   +        G+L W+E  GK+ VRSPIV
Sbjct  704  S-QVTVSPEILIFAYKYEKQSFTVTLNFNAKKKGNASSGALVWIEQNGKYTVRSPIV  759



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 111/179 (62%), Gaps = 7/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI + G     ASPLAMGAGHI+PNRALDPGL+YD + QDYINL+C++ +       I+R
Sbjct  579  PIHENGKKFHLASPLAMGAGHIDPNRALDPGLVYDATPQDYINLLCSMNYNKAQILAIVR  638

Query  576  TSSYNCSN-PSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            + SY CSN PS DLNYPSFIAF  +    S    V  F RT+TN+GDG +TY A +T   
Sbjct  639  SDSYTCSNDPSSDLNYPSFIAFHNSTCRRS----VNTFQRTVTNVGDGAATYKATVTAPK  694

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIE--APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +  V V P  L F  K +KQSY L I      T    + FG+L W    GKH+VRSPIV
Sbjct  695  DSRVIVSPQTLAFGSKYEKQSYNLTIINFTRDTKRKDISFGALVWANENGKHMVRSPIV  753



>ref|XP_010028239.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=762

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 123/181 (68%), Gaps = 6/181 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    +  ASPLA G+GHI+PN+ALDPGL+YD+ ++DY+NL+CA+K++    + II 
Sbjct  576  PIKDAANFDLPASPLATGSGHIDPNKALDPGLVYDLQAEDYLNLLCAMKYSQKKIK-IIA  634

Query  576  TSSYNCSNPS----LDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT  409
             SS++C + S       NYPSFIA F  +        V+EF R +TN+G+  S+YSA++ 
Sbjct  635  KSSHSCRDASNSSRSSFNYPSFIALF-GDGEAGSGAVVREFRREVTNVGEDQSSYSARVV  693

Query  408  PIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             +    V V P +LVF ++++K+ YKL +E P  + D LV GSL+WV++ GK++VRSPIV
Sbjct  694  GMEGWKVRVDPPRLVFRQRNEKKRYKLTVEGPRVLRDGLVHGSLSWVDDRGKYIVRSPIV  753

Query  228  A  226
            A
Sbjct  754  A  754



>ref|XP_008218400.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=766

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +   ASPLAMGAG I+PNRAL+PGLIYD + QDY+NL+C+  FT      I R
Sbjct  588  PIRDDGDNFNFASPLAMGAGQIDPNRALEPGLIYDATPQDYVNLLCSTNFTRKQILAITR  647

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CSNPS DLNYPSFI  +  N       +VQ+F RT+TN+G+G + Y A +     
Sbjct  648  SHAYDCSNPSCDLNYPSFITLY--NDHHKTKTKVQKFQRTVTNVGEGAARYKAAVIAPKG  705

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F +  +KQS+ + I+  +     +  G+L W+E  GK+ VRSPIV
Sbjct  706  SKVTVSPEILIFGETYEKQSFTVTIKYKAKKKGTVSSGALVWIEQNGKYTVRSPIV  761



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 120/178 (67%), Gaps = 8/178 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+++  +   A+PL +G+G ++PNRAL+PGLIYD + QD +NL+C++ FT   TQTI++
Sbjct  554  PIREV--NGTVATPLGIGSGQVDPNRALNPGLIYDANIQDLVNLVCSMNFTRKQTQTIVK  611

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNR--VQEFHRTLTNLGDGISTYSAKLTPI  403
            +++YNCSNPS DLNYPSF+A   +    +D  R   + F RT+TN+GDG + Y  K+   
Sbjct  612  STNYNCSNPSSDLNYPSFVALTHS----ADIGRFVTRRFKRTVTNVGDGAAKYRVKVEVP  667

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N  V V P  LVF KK++K SY ++I   + +      GSLTW+E +GK+ VRSPI+
Sbjct  668  ANTTVRVRPHTLVFQKKNEKLSYIVKIRYNADIDTLHRAGSLTWIEQSGKYTVRSPIM  725



>ref|XP_009343011.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 113/176 (64%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PNRALDPGLIYD + Q+Y+NL+C+  FT N   +I R
Sbjct  586  PILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQEYVNLLCSTNFTRNQILSITR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CS PS DLNYPSFIA   +N       RVQ F R +TN+GDG + Y A +T    
Sbjct  646  SHAYDCSKPSSDLNYPSFIAL--SNNDHKTKTRVQTFQRAVTNVGDGAARYRASVTSPKG  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F  K +KQS+ + +   +        G+L W+E  GK+ VRSPIV
Sbjct  704  SQVTVSPEILIFAYKYEKQSFTVTLNYKAKKKGKASSGALVWIEQNGKYTVRSPIV  759



>ref|XP_009338017.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 113/176 (64%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PNRALDPGLIYD + Q+Y+NL+C+  FT N   +I R
Sbjct  586  PILDDGDNFNFASPLAMGAGHIDPNRALDPGLIYDATPQEYVNLLCSTNFTRNQILSITR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CS PS DLNYPSFIA   +N       RVQ F R +TN+GDG + Y A +T    
Sbjct  646  SHAYDCSKPSSDLNYPSFIAL--SNNDHKTKTRVQTFQRAVTNVGDGAARYRASVTSPKG  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F  K +KQS+ + +   +        G+L W+E  GK+ VRSPIV
Sbjct  704  SQVTVSPEILIFAYKYEKQSFTVTLNYKAKKKGKASSGALVWIEQNGKYTVRSPIV  759



>dbj|BAJ90426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  756  PIQDI--GFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+D+  G  N  ASPLAMG+GHI+PNRAL PGL+Y+    DYI L+CA+ +T    +T+
Sbjct  558  PIKDMSGGNQNGPASPLAMGSGHIDPNRALAPGLVYEAGPYDYIKLMCAMNYTTAQIKTV  617

Query  582  IRTSS-YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
             ++S+  +C   SLDLNYPSFIA+F       D    + F RT+TN+GDG ++YSA +  
Sbjct  618  AQSSAPVDCVGASLDLNYPSFIAYF-------DTAGEKTFARTVTNVGDGPASYSATVEG  670

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEA-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +  + V+VVPD+LVF  K +KQ YK+ ++     M + ++ GSLTWV++ GK+ VRSP+V
Sbjct  671  LDGLKVSVVPDRLVFGGKHEKQRYKVVVQVRDELMPEVVLHGSLTWVDDNGKYTVRSPVV  730



>ref|XP_002441162.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
 gb|EES19592.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
Length=744

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 126/188 (67%), Gaps = 20/188 (11%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII--  580
            I+D+G  N  ASPLAMG+GHI+P RA+DPGL+YD +  DY+ L+CA+ +T    +T++  
Sbjct  557  IKDMGNRNHPASPLAMGSGHIDPTRAVDPGLVYDAAPGDYVKLMCAMNYTAAQIRTVVTQ  616

Query  579  --RTSSY--NCSNPSLDLNYPSFIAFFPANATLSDPNR----VQEFHRTLTNLGDGISTY  424
               +SSY  +C+  +LDLNYPSFIAFF       DPN      + F RT+TN+G G ++Y
Sbjct  617  SPSSSSYAVDCTGATLDLNYPSFIAFF-------DPNGGAVVERTFTRTVTNVGGGPASY  669

Query  423  SAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL--RIEAPSTMGDFLVFGSLTWVENAGKH  250
            +AK+T +  + V V P+KL F  K++KQ Y L  R +  S  G+ L  G+LTWV++AGK+
Sbjct  670  TAKVTGLSGLTVIVSPEKLAFGGKNEKQKYTLVIRGKMTSKSGNVL-HGALTWVDDAGKY  728

Query  249  VVRSPIVA  226
             VRSPIVA
Sbjct  729  TVRSPIVA  736



>dbj|BAJ88973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  756  PIQDI--GFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+D+  G  N  ASPLAMG+GHI+PNRAL PGL+Y+    DYI L+CA+ +T    +T+
Sbjct  578  PIKDMSGGNQNGPASPLAMGSGHIDPNRALAPGLVYEAGPYDYIKLMCAMNYTTAQIKTV  637

Query  582  IRTSS-YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
             ++S+  +C   SLDLNYPSFIA+F       D    + F RT+TN+GDG ++YSA +  
Sbjct  638  AQSSAPVDCVGASLDLNYPSFIAYF-------DTAGEKTFARTVTNVGDGPASYSATVEG  690

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEA-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +  + V+VVPD+LVF  K +KQ YK+ ++     M + ++ GSLTWV++ GK+ VRSP+V
Sbjct  691  LDGLKVSVVPDRLVFGGKHEKQRYKVVVQVRDELMPEVVLHGSLTWVDDNGKYTVRSPVV  750



>ref|XP_003638681.1| Subtilisin-like protease [Medicago truncatula]
Length=184

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 116/177 (66%), Gaps = 20/177 (11%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG  N  A+PLA+GA +++  RALDPGL+YDV +QDY+NL+  L FT  H  TI R+
Sbjct  20   IKDIGEGNKVATPLALGASYVDTTRALDPGLLYDVGAQDYVNLLYGLNFTQKHITTITRS  79

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            +  +CS PSLD+N+P FIAFF  N   S   R+QEFH+T+TN+G                
Sbjct  80   TFNDCSKPSLDINHPFFIAFF--NGGNSSWRRIQEFHKTVTNVG---------------F  122

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            +V+V+P+KLVF +K++K  +KLR E  S T    L FG LTW++ +  HVVRSP+V 
Sbjct  123  HVSVIPNKLVFHEKNEKLRFKLRNEVGSMTRLKKLDFGYLTWMDVS--HVVRSPVVV  177



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 111/172 (65%), Gaps = 7/172 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNC  559
            DN  A+ L MGAGH++PNRALDPGLIYD + QDY+NL+C+L FT    +TI R+S+ +NC
Sbjct  594  DNKPATSLDMGAGHVDPNRALDPGLIYDTTPQDYVNLLCSLNFTEEQFKTIARSSTNHNC  653

Query  558  SNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVT  385
            SNPS D+NYPSFIAFF    N T  +    Q+F RT+TN+G   + Y  K+    N  V+
Sbjct  654  SNPSSDINYPSFIAFFSPEGNFTFLE----QKFMRTVTNVGSAAAKYRVKVKAPRNSKVS  709

Query  384  VVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            V P  LVF KK+ K +Y L I         +  GS+TWVE  G H VRSPIV
Sbjct  710  VSPQTLVFKKKNQKLNYSLTIRYKDDAEQEVQSGSITWVEENGNHTVRSPIV  761



>dbj|BAJ88882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 123/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  756  PIQDI--GFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+D+  G  N  ASPLAMG+GH++PNRAL+PGL+YD    DYI L+CA+ +T    +T+
Sbjct  568  PIKDMSGGNQNGPASPLAMGSGHLDPNRALNPGLVYDAGPGDYIKLMCAMNYTTAQIKTV  627

Query  582  IRTSS-YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
             ++S+  +C+  SLDLNYPSFIAFF       D    + F RT+TN+GDG + Y+A +  
Sbjct  628  AQSSAPVDCAGASLDLNYPSFIAFF-------DTTGERAFVRTVTNVGDGPAGYNATVEG  680

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEA-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +  + VTVVP++LVF  K++KQ Y + I+     + D ++ GSLTW+++ GK+ VRSPIV
Sbjct  681  LDGLKVTVVPNRLVFDGKNEKQRYTVMIQVRDDLLPDVVLHGSLTWMDDNGKYTVRSPIV  740



>dbj|BAJ87233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 123/180 (68%), Gaps = 11/180 (6%)
 Frame = -2

Query  756  PIQDI--GFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTI  583
            PI+D+  G  N  ASPLAMG+GH++PNRAL+PGL+YD    DYI L+CA+ +T    +T+
Sbjct  568  PIKDMSGGNQNGPASPLAMGSGHLDPNRALNPGLVYDAGPGDYIKLMCAMNYTTAQIKTV  627

Query  582  IRTSS-YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
             ++S+  +C+  SLDLNYPSFIAFF       D    + F RT+TN+GDG + Y+A +  
Sbjct  628  AQSSAPVDCAGASLDLNYPSFIAFF-------DTTGERAFVRTVTNVGDGPAGYNATVEG  680

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEA-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +  + VTVVP++LVF  K++KQ Y + I+     + D ++ GSLTW+++ GK+ VRSPIV
Sbjct  681  LDGLKVTVVPNRLVFDGKNEKQRYTVMIQVRDDLLPDVVLHGSLTWMDDNGKYTVRSPIV  740



>ref|XP_006345494.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=754

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 110/172 (64%), Gaps = 7/172 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNC  559
            DN  A+ L MGAGH++PNRALDPGLIYD + QDY+NL+C+L FT    +TI R+S+ +NC
Sbjct  579  DNKPATSLDMGAGHVDPNRALDPGLIYDTTPQDYVNLLCSLNFTEEQFKTIARSSANHNC  638

Query  558  SNPSLDLNYPSFIAFF--PANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVT  385
            SNPS D+NYPSFIAFF    N T  +    Q+F RT+TN+G   + Y  K+    N  V+
Sbjct  639  SNPSSDINYPSFIAFFSPEGNFTFLE----QKFRRTVTNVGSAAAKYRVKVKAPRNSKVS  694

Query  384  VVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            V P  LVF KK+ K SY L I         +  GS+TWVE    H VRSPIV
Sbjct  695  VSPQTLVFRKKNQKLSYSLTIRYKDDAQQEVQSGSITWVEENRNHTVRSPIV  746



>gb|KJB58523.1| hypothetical protein B456_009G213500 [Gossypium raimondii]
Length=759

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 114/177 (64%), Gaps = 12/177 (7%)
 Frame = -2

Query  756  PIQDIGFDNAA-ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+D G  N   ASPLAMGAG I+PN+ALDPGLIYD + QDY+NL+C + FT     TI 
Sbjct  571  PIRDNGDVNLTFASPLAMGAGQIDPNQALDPGLIYDATPQDYVNLMCTMNFTQKQIMTIT  630

Query  579  RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPN----RVQEFHRTLTNLGDGISTYSAKL  412
            R+ SY+CSNPS DLNYPSFIA +       DPN     V+ F+RT+TN+G+G +TY  ++
Sbjct  631  RSKSYDCSNPSSDLNYPSFIALY-------DPNVPKTSVKIFNRTVTNVGEGSATYKVEI  683

Query  411  TPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVR  241
                +  + V P+ LVF K  +KQ +++ I+  S     + FG L W+E  GKH VR
Sbjct  684  VQPEDSIIAVSPETLVFGKTYEKQCFRVSIKYRSNKTGKVSFGELVWIEANGKHKVR  740



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G  +  ASPLAMGAG I+PN+ALDPG IYD + QDY+NL+C   +T     TI R
Sbjct  582  PIMDNGNLSQFASPLAMGAGEIDPNKALDPGFIYDATPQDYVNLLCDFGYTHKQILTITR  641

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +  YNC NPS DLNYPSFI  +           VQ+F R++TN+GDG ++Y  K+T    
Sbjct  642  SKVYNCDNPSSDLNYPSFIVLYGNKKR----TMVQKFLRSVTNVGDGAASYKVKVTKPKG  697

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLV-FGSLTWVENAGKHVVRSPIV  229
              VTV+P+KL F  K++K SY + I+      +  V FG + W+E  G   VRSPIV
Sbjct  698  CVVTVLPEKLTFNYKNEKLSYTVEIKYKRNKKELNVSFGDIVWIEEGGARTVRSPIV  754



>ref|XP_007143987.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
 gb|ESW15981.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
Length=763

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G     ASPLAMGAG I+PN+ALDPG IYD + +DY+NL+CAL ++ N   TI R
Sbjct  584  PIRDNGNPLQYASPLAMGAGEIDPNKALDPGFIYDATPEDYVNLLCALGYSQNQILTITR  643

Query  576  TSSYNCS-NPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            + +Y CS NPS DLNYPSFI  + +N T S    V++F RT+TN+GDG +TY  K+    
Sbjct  644  SKTYKCSDNPSSDLNYPSFIVLY-SNKTRS---TVKKFRRTVTNVGDGAATYRVKVKQPK  699

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               V V P+ L F  +++KQ+Y + I+      + + FG + WVE+ G   VRSPIV
Sbjct  700  GAAVKVSPETLTFGYRNEKQNYSVTIKYRRNKKESIPFGDIVWVEDGGARKVRSPIV  756



>ref|XP_008370910.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=651

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 111/176 (63%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PN ALDPGLIYD + Q+Y+NL+C+  FT N   +I R
Sbjct  473  PILDDGDNFXFASPLAMGAGHIDPNXALDPGLIYDATPQEYVNLLCSTNFTRNQILSITR  532

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CS PS DLNYPSFIA +  N       RVQ F RT+TN+GD  + Y A +T    
Sbjct  533  SHAYDCSKPSSDLNYPSFIALY--NNHHKTKKRVQTFQRTVTNVGDXAARYRASVTAPKG  590

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F  K +KQS+ + +   +        G+L W+E  GK+  RSPIV
Sbjct  591  SQVTVSPEILIFAYKYEKQSFTVTLNYKAKKKGKASSGALVWIEQNGKYTXRSPIV  646



>gb|KHN43135.1| Subtilisin-like protease [Glycine soja]
Length=610

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI++ G     ASPLAMGAG I+PNRALDPGLIYD S QDY+NL+CA+  T      I R
Sbjct  424  PIEESGDWPQRASPLAMGAGLIDPNRALDPGLIYDASPQDYVNLLCAMNLTQAQIMAITR  483

Query  576  TSSY-NCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            + +Y NCS  S DLNYPSF+AF+   +   +     +F R +T +GDG + Y+A+++   
Sbjct  484  SKAYSNCSRASYDLNYPSFVAFYADKSVKVE----TKFRRIVTYVGDGPAVYTARVSSYN  539

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               ++V P++LVF  K +K+ + L  ++       + FGSL WVE  G+H+VRSP+V
Sbjct  540  GTAISVSPNRLVFKNKHEKRKFTLSFKSQMDKDYDVAFGSLQWVEETGRHLVRSPVV  596



>ref|XP_009608286.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=765

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 8/179 (4%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+    D  A S LAMGAG ++PNRA+DPGLIYD + QDY+NL+C++  T    +TI R
Sbjct  583  PIKSADNDKDATS-LAMGAGLVDPNRAVDPGLIYDATPQDYVNLLCSMNLTVEQFKTIAR  641

Query  576  TSS-YNCSNPSLDLNYPSFIAFFP--ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP  406
            +S+ +NCSNPS D+NYPSFIA F    N T  +    Q+F RT+TN+G G +TY  K+  
Sbjct  642  SSAKHNCSNPSNDINYPSFIALFSPYGNYTWLE----QKFKRTVTNVGVGAATYKVKVRA  697

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              N ++++ P  LVF KK+ KQ Y L I       D    GS+TWVE  G H VRSPIV
Sbjct  698  PENSSISISPQTLVFEKKNQKQDYTLTIRYKGVAEDQAQSGSITWVEENGHHTVRSPIV  756



>ref|XP_008355893.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 110/176 (63%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G +   ASPLAMGAGHI+PN ALDPGLIYD + Q+Y+NL+C+  FT N   +I R
Sbjct  586  PILDDGDNFXFASPLAMGAGHIDPNXALDPGLIYDATPQEYVNLLCSTNFTRNQILSITR  645

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +Y+CS PS DLNYPSFIA +  N       R Q F RT+TN+GD  + Y A +T    
Sbjct  646  SHAYDCSKPSSDLNYPSFIALY--NNHHKTKKRXQTFQRTVTNVGDXAARYRASVTAPXG  703

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              VTV P+ L+F  K +KQS+ + +   +        G+L W+E  GK+  RSPIV
Sbjct  704  SQVTVSPEILIFAYKYEKQSFTVTLNXXAKKKGKASSGALVWIEQNGKYTXRSPIV  759



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 125/181 (69%), Gaps = 7/181 (4%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+D+G  N  ASPLAMG+GHI+P+RA+DPGL+YD + +DY+ L+CA+ FT    +T+ +T
Sbjct  576  IKDMGNRNHPASPLAMGSGHIDPSRAVDPGLVYDAAPEDYVKLMCAMNFTAEQIRTVAQT  635

Query  573  SS---YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            SS    +C+  SLDLNYPSFIA F  + + +   R   F RT+TN+G   ++YSAK+  +
Sbjct  636  SSSYAVDCAGASLDLNYPSFIALFNPDGSGAG-ERTFTFTRTVTNVGGVPASYSAKVVGL  694

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKL--RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              + V V PD+LVF  K++KQ Y L  R +  S  GD L  GSLTWV++AGK+ VRSPIV
Sbjct  695  KGLTVAVTPDRLVFNGKNEKQKYTLVIRGQMNSNTGDVLQ-GSLTWVDDAGKYTVRSPIV  753

Query  228  A  226
            A
Sbjct  754  A  754



>ref|XP_003553772.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI++ G     ASPLAMGAG I+PNRALDPGL+YD S QDY+NL+CA+  T      I R
Sbjct  577  PIEESGDWPQRASPLAMGAGLIDPNRALDPGLVYDASPQDYVNLLCAMNLTQAQIMAITR  636

Query  576  TSSY-NCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
            + +Y NCS  S DLNYPSF+AF+   +   +     +F R +T +GDG + Y+A+++   
Sbjct  637  SKAYSNCSRASYDLNYPSFVAFYADKSVKVE----TKFRRIVTYVGDGPAVYTARVSSYN  692

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
               ++V P++LVF  K +K+ + L  ++       + FGSL WVE  G+H+VRSP+V
Sbjct  693  GTAISVSPNRLVFKNKHEKRKFTLSFKSQMDKDYDVAFGSLQWVEETGRHLVRSPVV  749



>gb|EAZ14292.1| hypothetical protein OsJ_04216 [Oryza sativa Japonica Group]
Length=699

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I D+     AA+PLAMG+GHI+PNRA DPGL+YD    DY+ L+CA+ +  +  + + + 
Sbjct  512  INDMARAGHAATPLAMGSGHIDPNRAADPGLVYDAVPGDYVELMCAMGYNLSDIRAVTQW  571

Query  573  SSY--NCSNPSL-DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP-  406
            S+Y  NCS  S  DLNYPSFIA+F   +  +     + F R +TN+G G ++Y AK+   
Sbjct  572  STYAVNCSGASSPDLNYPSFIAYFDRRSAAAAAAETKTFVRVVTNVGAGAASYRAKVKGN  631

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            +G + V+V P +LVF KK + Q Y L +       D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  632  LGGLAVSVTPSRLVFGKKGETQKYTLVLRGKIKGADKVLHGSLTWVDDAGKYTVRSPIVA  691



>ref|XP_006847107.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
 gb|ERN08688.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
Length=757

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 6/166 (4%)
 Frame = -2

Query  723  ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSL  544
            A+PL MGAGH+NPN A+DPGLIYD   +DY+NL+CAL +T N  +TI R S+Y CS PSL
Sbjct  583  ATPLDMGAGHVNPNSAMDPGLIYDAGPEDYVNLLCALNYTQNQIKTITRGSNYTCSKPSL  642

Query  543  DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP-IGNVNVTVVPDKL  367
            DLNYP+F+AF   +  +S     Q F R LTN+GD +S Y+ + T  +    V VVP+ L
Sbjct  643  DLNYPAFVAFCDNSDQVS-----QAFKRVLTNVGDRVSVYNVRTTTGLEGFTVKVVPETL  697

Query  366  VFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +F ++ +K+ + + IE   T    ++ G + W     KHVVR+P+V
Sbjct  698  IFERRYEKREFSVSIEGKLTSDSPVIHGYVIWEAAYSKHVVRTPVV  743



>ref|NP_001044922.1| Os01g0868900 [Oryza sativa Japonica Group]
 dbj|BAB89803.1| putative subtilisin-like protease [Oryza sativa Japonica Group]
 dbj|BAF06836.1| Os01g0868900 [Oryza sativa Japonica Group]
Length=760

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I D+     AA+PLAMG+GHI+PNRA DPGL+YD    DY+ L+CA+ +  +  + + + 
Sbjct  573  INDMARAGHAATPLAMGSGHIDPNRAADPGLVYDAVPGDYVELMCAMGYNLSDIRAVTQW  632

Query  573  SSY--NCSNPSL-DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP-  406
            S+Y  NCS  S  DLNYPSFIA+F   +  +     + F R +TN+G G ++Y AK+   
Sbjct  633  STYAVNCSGASSPDLNYPSFIAYFDRRSAAAAAAETKTFVRVVTNVGAGAASYRAKVKGN  692

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            +G + V+V P +LVF KK + Q Y L +       D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  693  LGGLAVSVTPSRLVFGKKGETQKYTLVLRGKIKGADKVLHGSLTWVDDAGKYTVRSPIVA  752



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 112/172 (65%), Gaps = 7/172 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNC  559
            +N+  + LAMGAG ++PNRA+DPGLIYD + QDY+NL+C++ FT +  +TI R+S+ +NC
Sbjct  589  NNSDTTSLAMGAGLVDPNRAVDPGLIYDATPQDYVNLLCSMNFTSDQFKTIARSSAKHNC  648

Query  558  SNPSLDLNYPSFIAFFP--ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVT  385
            SNPS D+NYPSFIA F    N T  +    ++F RT+TN+G   + Y AK+    N  ++
Sbjct  649  SNPSDDINYPSFIALFNPIGNYTWLE----KKFRRTVTNVGASAAKYVAKVIAPKNSTIS  704

Query  384  VVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            + P  LVF KK+ KQ Y L I       D    GS+TWVE  G H VRSPIV
Sbjct  705  ISPQTLVFEKKNQKQDYTLTIRYKGIADDQAQSGSITWVEENGHHTVRSPIV  756



>ref|XP_009769987.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009769988.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
Length=765

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 110/172 (64%), Gaps = 7/172 (4%)
 Frame = -2

Query  735  DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNC  559
            DN  A+ LAMGAG ++PNRA+DPGLIYD + Q Y+NL+C++  T    +TI R+S+ +NC
Sbjct  589  DNKDATSLAMGAGVVDPNRAVDPGLIYDATPQHYVNLLCSMNLTVEQFKTIARSSAKHNC  648

Query  558  SNPSLDLNYPSFIAFFP--ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVT  385
            SNPS D+NYPSFIA F    N T  +    Q+F RT+TN+G G +TY  K+    N  ++
Sbjct  649  SNPSNDINYPSFIALFSPYGNYTWLE----QKFKRTVTNVGAGAATYKVKVKAPENSTIS  704

Query  384  VVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            + P  LVF KK+ KQ Y L I     + D    G++TWVE  G H V SPIV
Sbjct  705  LFPQTLVFEKKNQKQEYTLTIRYKGVVEDQAQSGAITWVEENGHHTVSSPIV  756



>ref|XP_011468374.1| PREDICTED: uncharacterized protein LOC101302380 [Fragaria vesca 
subsp. vesca]
Length=1517

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 109/176 (62%), Gaps = 2/176 (1%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D G +   ASPLAMGAG I+PNRAL+PGLIYD + QDY+NL+C+  FT      I R
Sbjct  560  PIRDNGDNFNFASPLAMGAGQIDPNRALEPGLIYDATIQDYVNLLCSTNFTRKQILAITR  619

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            +  Y+CS  S DLNYPSFIA +  +   +   RVQ+F RT+TN+GDG + Y   +T    
Sbjct  620  SHEYDCSKASSDLNYPSFIALYGQHH--AKKLRVQKFQRTVTNVGDGAAKYKVFVTAPNG  677

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
              V V P+ L F    +KQSY + I+        + FG L WVE  GK+ VRSPIV
Sbjct  678  STVIVSPEILNFANIYEKQSYTVTIKYKGDKQKKVSFGELVWVEENGKYKVRSPIV  733


 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 111/177 (63%), Gaps = 2/177 (1%)
 Frame = -2

Query  756   PIQDIGFDN-AAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
             PI+D G  N   ASPLAMGAG ++PNRAL+PGLIYD + QDY+NL+C+  FT      I 
Sbjct  1334  PIRDNGDHNFNPASPLAMGAGQVDPNRALEPGLIYDATPQDYVNLLCSTNFTAKQILAIT  1393

Query  579   RTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIG  400
             R+ +Y+C NPS DLNYPSFIA +      +   +VQ+F RT+TN+G G +TY A +    
Sbjct  1394  RSPAYDCFNPSSDLNYPSFIALYDRRHD-TKKLKVQKFQRTVTNVGHGAATYKASVIAPQ  1452

Query  399   NVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
                VTV PD L F++K +KQSY L I         + FG + W     K++VRSPIV
Sbjct  1453  GSKVTVSPDTLFFSEKYEKQSYTLTISYKGKKKGNVSFGEIVWAVVDLKYMVRSPIV  1509



>ref|XP_009608285.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 107/168 (64%), Gaps = 7/168 (4%)
 Frame = -2

Query  723  ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNCSNPS  547
            A+ LAMGAG ++PNRA+DPGLIYD + QDY+NL+C++  T    +TI R+S+ +NCSNPS
Sbjct  599  ATSLAMGAGLVDPNRAVDPGLIYDATPQDYVNLLCSMNLTVEQFKTIARSSAKHNCSNPS  658

Query  546  LDLNYPSFIAFFP--ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPD  373
             D+NYPSFIA F    N T  +    Q+F RT+TN+G   +TY  K+    N  +++ P 
Sbjct  659  NDINYPSFIALFSPYGNYTWLE----QKFKRTVTNVGAAAATYKVKVRAPKNSTISISPQ  714

Query  372  KLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             LVF KK  KQ Y L I       D    GS+TWVE  G H VRSPIV
Sbjct  715  TLVFEKKYQKQDYSLTIRYKGVAEDQAQSGSITWVEENGHHTVRSPIV  762



>ref|XP_006339058.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 112/170 (66%), Gaps = 5/170 (3%)
 Frame = -2

Query  732  NAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNCS  556
            N+  + LAMGAG ++PNRA+DPGLIYD + QDY+NL+C++ FT     TI R+S+ +NCS
Sbjct  590  NSNTTSLAMGAGLVDPNRAVDPGLIYDATPQDYVNLLCSMNFTLEQFNTIARSSAKHNCS  649

Query  555  NPSLDLNYPSFIAFFPANATLSDPNRVQE-FHRTLTNLGDGISTYSAKLTPIGNVNVTVV  379
            NPS D+NYPSFIA F   + +   +R+++ F RT+TN+G G + Y AK+    +  +++ 
Sbjct  650  NPSDDINYPSFIALF---SPIGKYSRLEKKFRRTVTNVGAGAAKYVAKVIAPKSSTISIS  706

Query  378  PDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            P  LVF KK+ KQ Y L I       D    GS+TWVE  G H VRSPIV
Sbjct  707  PQTLVFEKKNQKQDYTLTIRYKGIADDQAQSGSITWVEENGHHTVRSPIV  756



>ref|XP_009769989.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=771

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 109/168 (65%), Gaps = 7/168 (4%)
 Frame = -2

Query  723  ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNCSNPS  547
            A+ LAMGAG ++PNRA+DPGL+YD + QDY+NL+C++  T    +TI R+S+ +NCSNPS
Sbjct  599  ATSLAMGAGLVDPNRAVDPGLVYDSTPQDYVNLLCSMNLTVAQFRTIARSSAKHNCSNPS  658

Query  546  LDLNYPSFIAFFP--ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPD  373
             D+NYPSFIA F    N T  +    Q+F RT+TN+G G +TY  K+    N  +++ P 
Sbjct  659  NDINYPSFIALFSPYGNYTWLE----QKFKRTVTNVGVGAATYKVKVKAPKNSTISISPQ  714

Query  372  KLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             LVF KK+ KQ Y L I       D    GS+TWVE  G H VRSPIV
Sbjct  715  TLVFEKKNQKQDYYLTIRYKGIAEDQAQSGSITWVEENGHHTVRSPIV  762



>gb|EEC71868.1| hypothetical protein OsI_04579 [Oryza sativa Indica Group]
Length=557

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I D+     AA+PLAMG+GHI+PNRA DPGL+YD    DY+ L+CA+ +  +  + + + 
Sbjct  371  INDMARAGHAATPLAMGSGHIDPNRAADPGLVYDAVPGDYVELMCAMGYNLSDIRAVTQW  430

Query  573  SSY--NCSNP-SLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP-  406
            S+Y  NCS   S DLNYPSFIA+F   +  +     + F R +TN+G G ++Y AK+   
Sbjct  431  STYAVNCSGALSPDLNYPSFIAYFDRRSAAA-AAETKTFVRVVTNVGAGAASYRAKVKGN  489

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
            +G + V+V P +LVF KK + Q Y L +       D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  490  LGGLAVSVTPSRLVFGKKGETQKYTLVLRGKIKGADKVLHGSLTWVDDAGKYTVRSPIVA  549



>ref|XP_004249504.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 112/178 (63%), Gaps = 4/178 (2%)
 Frame = -2

Query  756  PIQDIGF-DNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI+ I +   + A+ L+MGAG ++PNRA+DPGLIYD + QDY+NL+C++ FT    +TI 
Sbjct  584  PIKTIDYLRTSYATSLSMGAGLVDPNRAVDPGLIYDATPQDYVNLLCSMNFTAKQFKTIA  643

Query  579  RTSS-YNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            R+S+ +NC NPS D+NYPSFIA +  N   +     Q+F RT+TN+G G + Y  K+   
Sbjct  644  RSSAKHNCENPSDDINYPSFIALYVPNGDYAWLE--QKFKRTVTNVGPGAAIYKVKVKAP  701

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             N  +++ P  LVF KK  KQ Y L I       D    GS+TWVE  G H VRSPIV
Sbjct  702  INSTISISPQTLVFEKKHQKQDYTLTIRYRGIEFDQAQSGSVTWVEKNGHHTVRSPIV  759



>gb|EMT05720.1| Subtilisin-like protease [Aegilops tauschii]
Length=556

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 112/169 (66%), Gaps = 9/169 (5%)
 Frame = -2

Query  726  AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNCSNP  550
            AA PLAMG+GHI+PNR+LDPGL+YD    DYI L+CA+ FT    +T++++S   +C++ 
Sbjct  385  AADPLAMGSGHIDPNRSLDPGLVYDAGPDDYIKLMCAMNFTAAQIKTVVQSSGPMDCASA  444

Query  549  SLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDK  370
            +LDLNYPSFIAFF  N         + F RT+TN+GDG   Y+A +  +    V  VP++
Sbjct  445  TLDLNYPSFIAFFDYNGG------EKTFTRTVTNVGDGPVRYNATVEGLDGGKVRGVPNR  498

Query  369  LVFTKKSDKQSYK--LRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            L+   K +KQ Y   +R+     + + +++GSLTWV++ GK+ VRSPIV
Sbjct  499  LLLCGKHEKQRYTVVVRVGDSQIIPEVVLYGSLTWVDDTGKYTVRSPIV  547



>gb|KCW54937.1| hypothetical protein EUGRSUZ_I00910, partial [Eucalyptus grandis]
Length=747

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+D    +  ASPLA G+GHI+PN+ALDPGL+YD+ ++DY+NL+CA+K++    + II 
Sbjct  576  PIKDAANFDLPASPLATGSGHIDPNKALDPGLVYDLQAEDYLNLLCAMKYSQKKIK-IIA  634

Query  576  TSSYNCSNPS----LDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLT  409
             SS++C + S       NYPSFIA F  +        V+EF R +TN+G+  S+YSA++ 
Sbjct  635  KSSHSCRDASNSSRSSFNYPSFIALF-GDGEAGSGAVVREFRREVTNVGEDQSSYSARVV  693

Query  408  PIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHV  247
             +    V V P +LVF ++++K+ YKL +E P  + D LV GSL+WV++ GK++
Sbjct  694  GMEGWKVRVDPPRLVFRQRNEKKRYKLTVEGPRVLRDGLVHGSLSWVDDRGKYI  747



>gb|EAY76626.1| hypothetical protein OsI_04578 [Oryza sativa Indica Group]
Length=551

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G  +AAASPLA+GAG ++PN A+DPGL+YD   +D++ L+C+  FT      I R
Sbjct  378  PIGDAGHGDAAASPLAIGAGQVDPNAAMDPGLVYDAGPEDFVELLCSTNFTAAQIMAITR  437

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +YNCS  + D+NYPSFIA F AN T  D      F RT+TN+G G +TY A      N
Sbjct  438  SKAYNCSFSTNDMNYPSFIAVFGANDTSGD----MRFSRTVTNVGAGAATYRAFSVSPSN  493

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRS  238
            V VTV P+ LVFT+     S+ + +   +  G    FG++ W + +GK+ VR+
Sbjct  494  VEVTVSPETLVFTEVGQTASFLVDLNLTAPTGGEPAFGAVIWADVSGKYEVRT  546



>gb|EEE55729.1| hypothetical protein OsJ_04215 [Oryza sativa Japonica Group]
Length=715

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G  +AAASPLA+GAG ++PN A+DPGL+YD   +D++ L+C+  FT      I R
Sbjct  542  PIGDAGHGDAAASPLAIGAGQVDPNAAMDPGLVYDAGPEDFVELLCSTNFTAAQIMAITR  601

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +YNCS  + D+NYPSFIA F AN T  D      F RT+TN+G G +TY A      N
Sbjct  602  SKAYNCSFSTNDMNYPSFIAVFGANDTSGD----MRFSRTVTNVGAGAATYRAFSVSPSN  657

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            V VTV P+ LVFT+     S+ + +   +  G    FG++ W + +GK+ VR+  V
Sbjct  658  VEVTVSPETLVFTEVGQTASFLVDLNLTAPTGGEPAFGAVIWADVSGKYEVRTHYV  713



>gb|KEH23384.1| subtilisin-like serine protease [Medicago truncatula]
Length=515

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = -2

Query  678  ALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANA  499
            A++PGL+YD + QDY+N +C LKFT     TI R+SS+ C N SLDLNYPSFIAF+    
Sbjct  363  AMNPGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCENTSLDLNYPSFIAFYNKKT  422

Query  498  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  319
                 + V  F+RT+TN+GDG +TYSAK+T      V V+P+ L F+ +++KQSY + I+
Sbjct  423  R----SMVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRVLPEILTFSYRNEKQSYYIIIK  478

Query  318  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
                   ++ FG L W+E+ G H VRSPIV
Sbjct  479  CDMYKKKYVSFGDLVWIEDGGVHTVRSPIV  508



>dbj|BAD82002.1| putative subtilase [Oryza sativa Japonica Group]
Length=757

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D G  +AAASPLA+GAG ++PN A+DPGL+YD   +D++ L+C+  FT      I R
Sbjct  584  PIGDAGHGDAAASPLAIGAGQVDPNAAMDPGLVYDAGPEDFVELLCSTNFTAAQIMAITR  643

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
            + +YNCS  + D+NYPSFIA F AN T  D      F RT+TN+G G +TY A      N
Sbjct  644  SKAYNCSFSTNDMNYPSFIAVFGANDTSGD----MRFSRTVTNVGAGAATYRAFSVSPSN  699

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            V VTV P+ LVFT+     S+ + +   +  G    FG++ W + +GK+ VR+  V
Sbjct  700  VEVTVSPETLVFTEVGQTASFLVDLNLTAPTGGEPAFGAVIWADVSGKYEVRTHYV  755



>gb|KEH18652.1| subtilase family protein, putative [Medicago truncatula]
Length=253

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 108/176 (61%), Gaps = 29/176 (16%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I+DIG  N  A+PLA+GA +++  RALDPGL+YDV +QDY+NL+  L FT  H  TI R+
Sbjct  98   IKDIGEGNKVATPLALGASYVDTTRALDPGLLYDVGAQDYVNLLYGLNFTQKHITTITRS  157

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNV  394
            +  +CS PSLD+N+P FIAFF                          + Y A +TPI   
Sbjct  158  TFNDCSKPSLDINHPFFIAFF--------------------------NVYVANITPIKGF  191

Query  393  NVTVVPDKLVFTKKSDKQSYKLRIEAPS-TMGDFLVFGSLTWVENAGKHVVRSPIV  229
            +V+V+P+KLVF +K++K  +KLR E  S T    L FG LTW++ +  HVVRSP+V
Sbjct  192  HVSVIPNKLVFHEKNEKLRFKLRNEVGSMTRLKKLDFGYLTWMDVS--HVVRSPVV  245



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 110/172 (64%), Gaps = 5/172 (3%)
 Frame = -2

Query  732  NAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR--TSSYNC  559
            N   +P  +G G I+PNRALDPGLIYD + QDY+NL+C++ FT +  +TI R  T+ +NC
Sbjct  599  NEPTTPYGIGPGLIDPNRALDPGLIYDATPQDYVNLLCSMNFTEDEFKTIARSATNHHNC  658

Query  558  SNPSLDLNYPSFIAFFPANATLSD-PNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTV  382
            SN S DLNYPSF A +  +   ++ P  V++F RT+TN+G G + Y A +    N +++V
Sbjct  659  SNASDDLNYPSFTALYEFDRDGNNYPLLVKKFTRTVTNVGSGAARYKALVEVPKNTSISV  718

Query  381  VPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVF--GSLTWVENAGKHVVRSPI  232
             P  L F KK +K+SY L I       +  VF  GS+TWVE  GKH VRSPI
Sbjct  719  SPQVLTFGKKYEKKSYTLTIRYRGEGHESYVFNYGSITWVEQNGKHTVRSPI  770



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 107/175 (61%), Gaps = 5/175 (3%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI+++  D   A P  +G+G ++PNRAL+PGLIYD S+QD +NL+C++ FT   T+TI R
Sbjct  555  PIKEV--DRMLAVPTGIGSGQVDPNRALNPGLIYDASTQDLVNLVCSMNFTREQTETITR  612

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S++NCS P  DLNYPSFIA +    T     R   F RTLTN+G G +TY  K+    N
Sbjct  613  -SNFNCSTPYPDLNYPSFIALYEFAQTGRRLTR--SFKRTLTNVGKGGATYRVKVEAPSN  669

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPI  232
              V V P  LVF +K +K SY L I   +        GS+TW +  GK+ VRSPI
Sbjct  670  ATVRVRPKTLVFREKYEKLSYSLSIRYLAGFFPPATPGSITWTDETGKYSVRSPI  724



>ref|XP_004972264.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 111/178 (62%), Gaps = 6/178 (3%)
 Frame = -2

Query  756  PIQDIGFDNAA-ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTII  580
            PI D G  NA  ASPLAMG+GH++PN A+DPGL++D   +D++ L+CA  +T      I 
Sbjct  585  PITDAGSGNATIASPLAMGSGHVDPNAAMDPGLVFDAGPEDFVALLCAANYTNAQIMAIT  644

Query  579  RTS-SYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPI  403
            R+S +YNCS+ S D+NYPSF+A F ANAT SD      F RT+TN+G G + Y A     
Sbjct  645  RSSAAYNCSSASSDVNYPSFVAIFGANATSSD----MRFKRTVTNVGAGSTVYHASWVSP  700

Query  402  GNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
             NV+V+V P  L F+      S+++ I+  +  G    FG++ W + +GK+ VR+P V
Sbjct  701  RNVDVSVSPATLEFSTVGQTASFEVDIKLSAPTGGEPAFGAVVWADVSGKYRVRTPYV  758



>gb|KCW44172.1| hypothetical protein EUGRSUZ_L024071, partial [Eucalyptus grandis]
Length=360

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 103/167 (62%), Gaps = 5/167 (3%)
 Frame = -2

Query  726  AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPS  547
            AA+PL  GAGHINPN+A+DPGLIYD++ QDYI  +C+L +T      +IR   +NCS   
Sbjct  196  AATPLDFGAGHINPNKAMDPGLIYDLNLQDYIEFLCSLGYTDKQMSAVIRRGQWNCSRSD  255

Query  546  LDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKL  367
             DLNYPSFIA + +N T S   +V+ F+R +TN+GD  S Y A +     + V V P  L
Sbjct  256  GDLNYPSFIAVY-SNKTGSP--KVKSFNRVVTNVGDDSSVYQAIVASPKEMTVIVQPSNL  312

Query  366  VFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             FT   +KQS+ L IE    +   + +G L WV+    HVV SPIVA
Sbjct  313  TFTHMYEKQSFHLTIEV-DQLATGVTYGYLKWVDQH-NHVVSSPIVA  357



>gb|ABN05870.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
Length=511

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = -2

Query  675  LDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  496
            L  GL+YD + QDY+N +C LKFT     TI R+SS+ C N SLDLNYPSFIAF+     
Sbjct  360  LGNGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCENTSLDLNYPSFIAFYNKKT-  418

Query  495  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  316
                + V  F+RT+TN+GDG +TYSAK+T      V V+P+ L F+ +++KQSY + I+ 
Sbjct  419  ---RSMVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRVLPEILTFSYRNEKQSYYIIIKC  475

Query  315  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
                  ++ FG L W+E+ G H VRSPIV
Sbjct  476  DMYKKKYVSFGDLVWIEDGGVHTVRSPIV  504



>ref|XP_008776814.1| PREDICTED: cucumisin [Phoenix dactylifera]
Length=147

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -2

Query  726  AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPS  547
            AA+PLA+ +GHI PNRALDPGL+ D S  DY+  +CA+K+     + I +  S++CS+ S
Sbjct  8    AATPLAIRSGHIEPNRALDPGLVCDASIDDYVRFLCAMKYISKQIKMITKIYSFDCSHAS  67

Query  546  LDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKL  367
            LDLNYPSFIAFF  N T++    V+EF R +T++   + +Y+AK+  +    + V+ +KL
Sbjct  68   LDLNYPSFIAFFNRNKTVASDKVVREFQRMVTDVAHAMVSYNAKVVAMKGFAIRVMQEKL  127

Query  366  VFTKKSDKQSYKL  328
            VF +K +K+S+ L
Sbjct  128  VFHEKYEKKSFAL  140



>ref|XP_010547521.1| PREDICTED: subtilisin-like protease SDD1 [Tarenaya hassleriana]
Length=755

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 119/182 (65%), Gaps = 6/182 (3%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNH-TQTIIR  577
            I+DIG  +  A+PLA+GAGH+NPN+AL+PGLIYD + QD+IN +C +   P    + I R
Sbjct  567  IKDIGDKHRPANPLAIGAGHVNPNKALNPGLIYDSTPQDFINFLCHVAKNPMKLVKAITR  626

Query  576  TSSYN-CSNPSLDLNYPSFIAFFPANATLSDPNR--VQEFHRTLTNLGDGISTYSAKLTP  406
            ++  N C NPS DLNYP+ IA+F A    S  N+   + F RTLTN+G+    YS ++  
Sbjct  627  SNLSNICRNPSPDLNYPAIIAYFTAYQDNSGSNQTATKVFRRTLTNVGEAKRNYSVRVRG  686

Query  405  IGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPST-MGDFLVFGSLTWVEN-AGKHVVRSPI  232
            +  +NV V P KLVF +K ++ SY +R+E+P   + + ++ G ++WV++  GK+ V  P+
Sbjct  687  LEGLNVVVEPKKLVFNEKYERLSYTVRLESPRMLLQENVIHGFVSWVDDEEGKYEVSCPV  746

Query  231  VA  226
            +A
Sbjct  747  LA  748



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 103/167 (62%), Gaps = 5/167 (3%)
 Frame = -2

Query  726  AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPS  547
            AA+PL  GAGHINPN+A+DPGLIYD++ QDYI  +C+L +T      +IR   +NCS   
Sbjct  601  AATPLDFGAGHINPNKAMDPGLIYDLNLQDYIEFLCSLGYTDKQMSAVIRRGQWNCSRSD  660

Query  546  LDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKL  367
             DLNYPSFIA + +N T S   +V+ F+R +TN+GD  S Y A +     + V V P  L
Sbjct  661  GDLNYPSFIAVY-SNKTGSP--KVKSFNRVVTNVGDDSSVYQAIVASPKEMTVIVQPSNL  717

Query  366  VFTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             FT   +KQS+ L IE    +   + +G L WV+    HVV SPIVA
Sbjct  718  TFTHMYEKQSFHLTIEV-DKLATGVTYGYLKWVDQH-NHVVSSPIVA  762



>ref|XP_006847081.1| hypothetical protein AMTR_s00017p00213940 [Amborella trichopoda]
 gb|ERN08662.1| hypothetical protein AMTR_s00017p00213940 [Amborella trichopoda]
Length=516

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 108/183 (59%), Gaps = 14/183 (8%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D+ ++  A +PL  G+GHI+PNRA+DPGLIYD+  QDYI+ +C+L +T    + I R
Sbjct  338  PILDM-YNGIARTPLDYGSGHIDPNRAMDPGLIYDIGVQDYIDFVCSLNYTQKQVRIITR  396

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S+Y C+  + D+NYPSF+     N +       Q F R LTN+ D  + Y A +     
Sbjct  397  RSNYTCTTSNFDINYPSFMVILYNNVS------SQTFKRVLTNVQDSPAVYHAMVEAQIG  450

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEA------PSTMGDFLVFGSLTWVENAGKHVVRSP  235
            +NVTV P  L F  K   Q++ LR++       P++ G    +G L+W++   KHVVRSP
Sbjct  451  MNVTVEPQALSFGPKGSTQAFTLRVDVDLGGMRPNS-GYIGNYGHLSWIDKEHKHVVRSP  509

Query  234  IVA  226
            IV+
Sbjct  510  IVS  512



>dbj|BAJ89456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 12/172 (7%)
 Frame = -2

Query  726  AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSS-YNCSNP  550
            AA PLAMG+GHI+PNR+LDPGL+YD    DYI L+CA+ FT    +T+ ++S   +C+  
Sbjct  607  AAYPLAMGSGHIDPNRSLDPGLVYDAGPDDYIKLMCAMNFTTAQIKTVAQSSGPVDCTGG  666

Query  549  SL-DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN--VNVTVV  379
            +  DLNYPSFIAFF  +         + F R +TN+ DG + Y+A +  +    V V+V+
Sbjct  667  ATHDLNYPSFIAFFDYDGG------EKTFARAVTNVRDGPARYNATVEGLDGVKVKVSVM  720

Query  378  PDKLVFTKKSDKQSYK--LRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            P++LVF  K +KQ Y   +R+       + +++GSLTWV++ GK+ VRSPIV
Sbjct  721  PNRLVFGGKHEKQRYTVVVRVGGRQITPEQVLYGSLTWVDDTGKYTVRSPIV  772



>ref|XP_007224572.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
 gb|EMJ25771.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
Length=760

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 99/169 (59%), Gaps = 13/169 (8%)
 Frame = -2

Query  723  ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSL  544
            A+PL  GAGHINPNRA++PGLIYD+  QDYI  +C L +T      +IR S ++C     
Sbjct  597  ATPLEFGAGHINPNRAMNPGLIYDMDVQDYIEFLCGLGYTAKQMSAVIRRSQWSCRQQPT  656

Query  543  DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLV  364
            +LNYPSFIA F  N T   P + + F R +TN+GDG S Y A L     + + V P  L 
Sbjct  657  ELNYPSFIAIF--NGTDGSP-KAKNFSRVVTNVGDGTSIYKAFLEVPSGMKIAVEPSSLT  713

Query  363  FTKKSDKQSYKLRIE----APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            FT K+ +Q + LR+E    AP      + +G L W++    H+V SP+V
Sbjct  714  FTGKNQEQDFVLRVEIDNNAPK-----VTYGYLKWIDQQ-NHIVSSPVV  756



>gb|KJB84344.1| hypothetical protein B456_N019700, partial [Gossypium raimondii]
Length=255

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 98/188 (52%), Gaps = 22/188 (12%)
 Frame = -2

Query  738  FDNA-----------AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHT  592
            FDNA           A +PL  GAGHINPN+A+DPGL+YD+  QDYIN +C L +T    
Sbjct  69   FDNANGRIIDMTTGVAGTPLDFGAGHINPNKAMDPGLVYDIEIQDYINYLCGLNYTGKQI  128

Query  591  QTIIRTSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKL  412
            +TI     +NC + +LDLNYPSFI      +T         F R LTN+ +G S Y A +
Sbjct  129  RTITGMRQFNCDSATLDLNYPSFIILLNNTSTTG-----TTFRRELTNVAEGSSVYRAVV  183

Query  411  TPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGD------FLVFGSLTWVENAGKH  250
                 +   V P  + F  K  K  ++L +E    +G       F  +G L+W E  GKH
Sbjct  184  RAPSGMKAVVQPATITFAGKYSKAKFQLTVEIDVGVGSIPESDYFGNYGFLSWYEVNGKH  243

Query  249  VVRSPIVA  226
             V SPIV+
Sbjct  244  QVTSPIVS  251



>gb|KCW68720.1| hypothetical protein EUGRSUZ_F02324 [Eucalyptus grandis]
Length=391

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 100/171 (58%), Gaps = 13/171 (8%)
 Frame = -2

Query  726  AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPS  547
            AA+PL  G GH+NPN ++DPG IYD++ QDYI  +C+L +T      +IR   +NCS  +
Sbjct  227  AATPLDFGVGHVNPNNSMDPGFIYDLNLQDYIEFLCSLGYTEKQMSAVIRRGQWNCSQSN  286

Query  546  LDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKL  367
             DLNYPSF+  F   +  +D  +V+ F R LTN+GD  S Y A +     + VT+ P  L
Sbjct  287  GDLNYPSFVTIF---SNKTDSTKVKSFKRVLTNVGDDSSVYQAIVECPKEMKVTLQPSNL  343

Query  366  VFTKKSDKQSY----KLRIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  226
             FT K +KQ++    K+ + AP      + +G L WV+    HVV  PIVA
Sbjct  344  TFTHKHEKQNFHLIMKVDMSAPR-----VTYGYLKWVDQR-NHVVSRPIVA  388



>ref|XP_008220348.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=781

 Score =   140 bits (352),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 99/169 (59%), Gaps = 13/169 (8%)
 Frame = -2

Query  723  ASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYNCSNPSL  544
            A+PL  GAGHINPN+A++PGL+YD+  QDYI  +C L +T      +IR S ++C     
Sbjct  618  ATPLEFGAGHINPNKAMNPGLVYDMDVQDYIEFLCGLGYTAKQMSAVIRRSQWSCRQQPT  677

Query  543  DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLV  364
            +LNYPSFIA F  N T   P + + F R +TN+GDG S Y A L     + + V P  L 
Sbjct  678  ELNYPSFIAIF--NGTDGSP-KAKNFSRVVTNVGDGTSIYKAFLEVPSGMKIAVEPSSLT  734

Query  363  FTKKSDKQSYKLRIE----APSTMGDFLVFGSLTWVENAGKHVVRSPIV  229
            FT K+ +Q + LR+E    AP      + +G L W++    H+V SP+V
Sbjct  735  FTGKNQEQGFVLRVEIDNNAPK-----VTYGYLKWIDQQ-NHIVSSPVV  777



>ref|XP_006495263.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=785

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 107/183 (58%), Gaps = 14/183 (8%)
 Frame = -2

Query  753  IQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRT  574
            I DI    AA +PL  GAGHINPN+A+DPGL+YD+  QDY+N +CA+ +T    + +  T
Sbjct  602  ITDIS-TGAAGTPLDFGAGHINPNKAMDPGLVYDIEIQDYLNYLCAMNYTSQQIRIVTGT  660

Query  573  SSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKL-TPIGN  397
            S + C + +LDLNYPSFI     + T S       F R LTN+ D  STY+A +  P+G 
Sbjct  661  SDFTCEHGNLDLNYPSFIIILNNSNTAS-----FTFKRVLTNVADTRSTYTAAVKAPVG-  714

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRI-----EAPSTMGDFLV-FGSLTWVENAGKHVVRSP  235
            + VT+ P  L F  K  K  + L +      A S   +FL  FG LTW E  GKH VRSP
Sbjct  715  MTVTLEPATLSFAGKFSKAEFNLTVNINLGNAFSPKSNFLGNFGYLTWYEVKGKHTVRSP  774

Query  234  IVA  226
            IVA
Sbjct  775  IVA  777



>ref|XP_010647877.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=693

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 101/182 (55%), Gaps = 11/182 (6%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D+     A +PL  GAGHINPN A+DPGL+YD+ +QDYIN +C L +T    + I R
Sbjct  510  PIMDM-TTGVAGTPLDFGAGHINPNMAMDPGLVYDIEAQDYINFLCGLNYTSKQIKIITR  568

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN  397
             S ++C   +LDLNYPSF+       T S       F R LTN+ D  S Y A +     
Sbjct  569  RSKFSCDQANLDLNYPSFMVLLNNTNTTS-----YTFKRVLTNVEDTYSVYQASVKQPSG  623

Query  396  VNVTVVPDKLVFTKKSDKQSYKLRIEA----PSTMGDFLV-FGSLTWVENAGKHVVRSPI  232
            + VTV+P  + FT +  K  + + +E          D++  +G LTW E  G HVVRSPI
Sbjct  624  MKVTVLPSTVSFTGRYSKAEFNMTVEINLGDAGPQSDYIGNYGYLTWREVNGTHVVRSPI  683

Query  231  VA  226
            V+
Sbjct  684  VS  685



>ref|XP_006847079.1| hypothetical protein AMTR_s00017p00212440 [Amborella trichopoda]
 gb|ERN08660.1| hypothetical protein AMTR_s00017p00212440 [Amborella trichopoda]
Length=762

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 111/186 (60%), Gaps = 20/186 (11%)
 Frame = -2

Query  756  PIQDIGFDNAAASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIR  577
            PI D+     A +PL  G+GHI+PN+A+DPGLIYD+S QDYI+ +C+L +T    + I R
Sbjct  584  PILDMT-TGVAGNPLDYGSGHIDPNKAMDPGLIYDLSVQDYIDFVCSLNYTQEQVRIITR  642

Query  576  TSSYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKL-TPIG  400
             S+Y C+  + D+NYPSF+     N +       Q F R LTN+ D  + Y A +  PIG
Sbjct  643  RSNYTCTTSNFDINYPSFMVILYNNVS------TQTFKRVLTNVQDSPAVYHAVVEAPIG  696

Query  399  NVNVTVVPDKLVFTKKSDKQSYKLRIEA------PST--MGDFLVFGSLTWVENAGKHVV  244
             +NVTV P  L F  K   Q++ LR+E       P +  +G+   +G L+W++   KHVV
Sbjct  697  -MNVTVEPQALSFGPKGSTQAFTLRVEVDLGGMRPESNYIGN---YGHLSWIDKEQKHVV  752

Query  243  RSPIVA  226
            RSPIV+
Sbjct  753  RSPIVS  758



>ref|XP_010446287.1| PREDICTED: subtilisin-like protease SDD1 [Camelina sativa]
Length=207

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 104/167 (62%), Gaps = 8/167 (5%)
 Frame = -2

Query  717  PLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNHTQTIIRTSSYN--CSNPSL  544
            PLA+GAGH++    L+PGLIYD S QD+IN +C           II  S+ +  C NPS 
Sbjct  39   PLAVGAGHVSTKNVLNPGLIYDTSPQDFINFLCHNAKQSRKLINIITRSNLSDACKNPSP  98

Query  543  DLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLV  364
             LNYPS IA+F      SD N  + F RTLTN+G+  ++YS ++  +  +NV V P +L+
Sbjct  99   YLNYPSIIAYF-----TSDQNGPKIFRRTLTNVGEAKTSYSVRVRGLKGLNVVVEPKRLM  153

Query  363  FTKKSDKQSYKLRIEAPSTMGDFLVFGSLTWV-ENAGKHVVRSPIVA  226
            F +K++K SY +R+E+P  + + +V+GS++W  E+  K  VR  +VA
Sbjct  154  FREKNEKLSYSVRLESPRALQENVVYGSVSWFDEDETKSEVRCSVVA  200



>emb|CDM85158.1| unnamed protein product [Triticum aestivum]
Length=764

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 112/185 (61%), Gaps = 14/185 (8%)
 Frame = -2

Query  756  PIQDIGF-----DNA-AASPLAMGAGHINPNRALDPGLIYDVSSQDYINLICALKFTPNH  595
            PI D G      DNA AASPLAMG+G ++PN A+DPGL+YD   +D++ L+C+  +T   
Sbjct  583  PITDAGAGFDGNDNATAASPLAMGSGQVSPNSAMDPGLVYDAGPKDFVELLCSANYTNAQ  642

Query  594  TQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSA  418
               I R+S +YNCS  S D+NYPSF+A F  NAT  +      F RT+T++G G +TY A
Sbjct  643  IAAITRSSTAYNCSFSSNDVNYPSFVASFGFNATSGE----MRFSRTVTSVGSGPATYHA  698

Query  417  KLTPIGNVNVTVVPDKLVFTKKSDKQSYK--LRIEAPSTMGDFLVFGSLTWVENAGKHVV  244
                  NV V V P  L F+    K S++  +++ AP T G  + +G+L W + +GK+ V
Sbjct  699  SWVSPSNVAVAVTPATLEFSGAGQKISFEVDIKLTAP-TPGGKVAYGALVWTDTSGKYRV  757

Query  243  RSPIV  229
            R+P V
Sbjct  758  RTPYV  762



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1593558888600