BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026A06

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612160.1|  PREDICTED: uncharacterized protein LOC104105529    177   5e-51   Nicotiana tomentosiformis
ref|XP_011074276.1|  PREDICTED: uncharacterized protein LOC105159041    176   9e-51   Sesamum indicum [beniseed]
ref|XP_004238010.1|  PREDICTED: uncharacterized protein LOC101259041    174   1e-49   Solanum lycopersicum
ref|XP_009773482.1|  PREDICTED: uncharacterized protein LOC104223708    170   3e-48   Nicotiana sylvestris
emb|CDP00933.1|  unnamed protein product                                167   3e-47   Coffea canephora [robusta coffee]
ref|XP_003526555.1|  PREDICTED: anaphase-promoting complex subuni...    157   4e-43   Glycine max [soybeans]
ref|XP_008338964.1|  PREDICTED: uncharacterized protein LOC103402004    153   2e-41   Malus domestica [apple tree]
ref|XP_003522769.1|  PREDICTED: uncharacterized protein LOC100799725    152   3e-41   Glycine max [soybeans]
ref|XP_010254565.1|  PREDICTED: uncharacterized protein LOC104595511    146   5e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002285656.1|  PREDICTED: uncharacterized protein LOC100248933    145   1e-38   Vitis vinifera
gb|KDP41492.1|  hypothetical protein JCGZ_15899                         145   2e-38   Jatropha curcas
ref|XP_004288856.2|  PREDICTED: uncharacterized protein LOC101291379    143   8e-38   Fragaria vesca subsp. vesca
gb|KJB58858.1|  hypothetical protein B456_009G228900                    142   1e-37   Gossypium raimondii
ref|XP_009376255.1|  PREDICTED: uncharacterized protein LOC103964966    142   3e-37   Pyrus x bretschneideri [bai li]
gb|EYU36449.1|  hypothetical protein MIMGU_mgv11b018096mg               139   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_008378598.1|  PREDICTED: uncharacterized protein LOC103441677    140   2e-36   
ref|XP_003635542.1|  PREDICTED: uncharacterized protein LOC100854495    138   4e-36   Vitis vinifera
ref|XP_007136324.1|  hypothetical protein PHAVU_009G035900g             138   7e-36   Phaseolus vulgaris [French bean]
ref|XP_004501659.1|  PREDICTED: uncharacterized protein LOC101488532    138   9e-36   Cicer arietinum [garbanzo]
ref|XP_006433807.1|  hypothetical protein CICLE_v10002461mg             137   1e-35   Citrus clementina [clementine]
ref|XP_011017014.1|  PREDICTED: uncharacterized protein LOC105120491    137   2e-35   Populus euphratica
ref|XP_002514058.1|  conserved hypothetical protein                     136   3e-35   Ricinus communis
ref|XP_006472445.1|  PREDICTED: uncharacterized protein LOC102615...    136   3e-35   Citrus sinensis [apfelsine]
emb|CAN68131.1|  hypothetical protein VITISV_043709                     144   4e-35   Vitis vinifera
ref|XP_008444918.1|  PREDICTED: uncharacterized protein LOC103488119    135   4e-35   Cucumis melo [Oriental melon]
ref|XP_003602892.1|  hypothetical protein MTR_3g100100                  135   1e-34   Medicago truncatula
gb|KHN08280.1|  hypothetical protein glysoja_017758                     134   1e-34   Glycine soja [wild soybean]
ref|XP_004152601.1|  PREDICTED: uncharacterized protein LOC101214...    134   1e-34   Cucumis sativus [cucumbers]
gb|AFK38269.1|  unknown                                                 134   3e-34   Medicago truncatula
ref|XP_008219242.1|  PREDICTED: uncharacterized protein LOC103319477    131   3e-33   Prunus mume [ume]
ref|XP_002301124.2|  hypothetical protein POPTR_0002s11190g             130   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010086878.1|  hypothetical protein L484_001326                   131   8e-33   
ref|XP_011097467.1|  PREDICTED: uncharacterized protein LOC105176382    129   2e-32   Sesamum indicum [beniseed]
ref|XP_007018249.1|  Tetratricopeptide repeat-like superfamily pr...    131   2e-32   
ref|XP_007141279.1|  hypothetical protein PHAVU_008G182700g             126   2e-31   Phaseolus vulgaris [French bean]
ref|XP_003544833.1|  PREDICTED: uncharacterized protein LOC100809739    123   3e-30   Glycine max [soybeans]
gb|KDO81212.1|  hypothetical protein CISIN_1g039398mg                   121   4e-30   Citrus sinensis [apfelsine]
gb|EYU39292.1|  hypothetical protein MIMGU_mgv1a013758mg                117   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_010060105.1|  PREDICTED: uncharacterized protein LOC104448032    115   2e-27   
gb|KCW66647.1|  hypothetical protein EUGRSUZ_F00428                     112   3e-26   Eucalyptus grandis [rose gum]
ref|XP_010680361.1|  PREDICTED: uncharacterized protein LOC104895521    112   3e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP01574.1|  unnamed protein product                                110   3e-25   Coffea canephora [robusta coffee]
ref|XP_008236271.1|  PREDICTED: uncharacterized protein LOC103335053    108   6e-25   Prunus mume [ume]
gb|KDP29775.1|  hypothetical protein JCGZ_18710                         108   7e-25   Jatropha curcas
ref|XP_009768508.1|  PREDICTED: uncharacterized protein LOC104219512    107   3e-24   Nicotiana sylvestris
ref|XP_009615438.1|  PREDICTED: uncharacterized protein LOC104108159    106   5e-24   Nicotiana tomentosiformis
ref|XP_009399759.1|  PREDICTED: uncharacterized protein LOC103984069    105   1e-23   
ref|XP_008792076.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   2e-23   
ref|XP_004250524.1|  PREDICTED: uncharacterized protein LOC101263566    102   1e-22   Solanum lycopersicum
ref|XP_006353161.1|  PREDICTED: uncharacterized protein LOC102601514  99.4    2e-21   Solanum tuberosum [potatoes]
ref|XP_010914908.1|  PREDICTED: uncharacterized protein LOC105040190  99.8    2e-21   Elaeis guineensis
ref|XP_011468687.1|  PREDICTED: uncharacterized protein LOC101313748  99.8    3e-21   Fragaria vesca subsp. vesca
ref|XP_010671644.1|  PREDICTED: uncharacterized protein LOC104888384  96.3    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009364809.1|  PREDICTED: uncharacterized protein LOC103954711  95.5    5e-20   Pyrus x bretschneideri [bai li]
ref|XP_010523303.1|  PREDICTED: uncharacterized protein LOC104801678  94.4    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_008338466.1|  PREDICTED: uncharacterized protein LOC103401529  94.0    2e-19   
ref|XP_010444514.1|  PREDICTED: uncharacterized protein LOC104727183  93.6    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010484348.1|  PREDICTED: uncharacterized protein LOC104762704  93.2    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002533521.1|  conserved hypothetical protein                   92.4    7e-19   Ricinus communis
ref|XP_007047767.1|  Tetratricopeptide repeat (TPR)-like superfam...  90.1    4e-18   
ref|NP_001147153.1|  TPR domain containing protein                    90.5    4e-18   Zea mays [maize]
ref|XP_002866676.1|  binding protein                                  87.8    2e-17   Arabidopsis lyrata subsp. lyrata
ref|NP_201355.1|  tetratricopeptide repeat domain-containing protein  87.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156466.1|  hypothetical protein PHAVU_003G288400g           87.0    5e-17   Phaseolus vulgaris [French bean]
ref|XP_007205948.1|  hypothetical protein PRUPE_ppa011845mg           85.1    1e-16   
ref|XP_006279866.1|  hypothetical protein CARUB_v10028558mg           89.0    2e-16   
gb|KJB40331.1|  hypothetical protein B456_007G058400                  85.5    3e-16   Gossypium raimondii
ref|XP_010462984.1|  PREDICTED: uncharacterized protein LOC104743621  84.7    3e-16   Camelina sativa [gold-of-pleasure]
dbj|BAK01291.1|  predicted protein                                    85.1    3e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007227059.1|  hypothetical protein PRUPE_ppa020513mg           82.0    1e-15   
gb|ABK23813.1|  unknown                                               81.6    4e-15   Picea sitchensis
gb|ABK26430.1|  unknown                                               81.6    4e-15   Picea sitchensis
gb|KEH20108.1|  TPR domain protein                                    79.7    1e-14   Medicago truncatula
ref|XP_004509789.1|  PREDICTED: uncharacterized protein LOC101502186  79.7    2e-14   Cicer arietinum [garbanzo]
ref|XP_003530607.1|  PREDICTED: uncharacterized protein LOC100813867  79.7    2e-14   Glycine max [soybeans]
ref|XP_003571513.1|  PREDICTED: uncharacterized protein LOC100820913  79.0    3e-14   Brachypodium distachyon [annual false brome]
ref|XP_002453513.1|  hypothetical protein SORBIDRAFT_04g007120        79.0    3e-14   
gb|ACN40942.1|  unknown                                               77.4    7e-14   Picea sitchensis
gb|KFK28222.1|  hypothetical protein AALP_AA8G488400                  75.9    3e-13   Arabis alpina [alpine rockcress]
ref|XP_006394020.1|  hypothetical protein EUTSA_v10005489mg           75.5    4e-13   
ref|XP_006852913.1|  hypothetical protein AMTR_s00033p00228810        75.5    4e-13   
ref|XP_006648441.1|  PREDICTED: uncharacterized protein LOC102700687  71.2    3e-12   
emb|CDY54712.1|  BnaA09g52440D                                        72.4    4e-12   Brassica napus [oilseed rape]
ref|XP_009112189.1|  PREDICTED: uncharacterized protein LOC103837585  72.4    4e-12   Brassica rapa
gb|KHN08984.1|  hypothetical protein glysoja_021806                   71.6    6e-12   Glycine soja [wild soybean]
ref|XP_004951519.1|  PREDICTED: uncharacterized protein LOC101758681  71.6    1e-11   Setaria italica
gb|EPS67993.1|  hypothetical protein M569_06781                       70.1    2e-11   Genlisea aurea
ref|XP_010089040.1|  Oligopeptidase A                                 69.7    6e-11   
emb|CDX81290.1|  BnaC09g07010D                                        67.8    2e-10   
gb|EEC72705.1|  hypothetical protein OsI_06297                        63.2    1e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001046241.1|  Os02g0204000                                     63.2    1e-08   
gb|ABK93348.1|  unknown                                               55.5    1e-06   Populus trichocarpa [western balsam poplar]
gb|KIJ83146.1|  hypothetical protein SD80_16210                       54.7    6e-06   Scytonema tolypothrichoides VB-61278
ref|WP_012411236.1|  hypothetical protein                             53.5    2e-05   Nostoc punctiforme
gb|KIE08373.1|  TPR repeat-containing photosystem I assembly prot...  52.8    3e-05   Tolypothrix bouteillei VB521301
ref|WP_041034696.1|  hypothetical protein                             52.0    5e-05   Tolypothrix campylonemoides
ref|WP_015130795.1|  hypothetical protein                             51.6    7e-05   Calothrix sp. PCC 7507
ref|WP_025270070.1|  hypothetical protein                             52.0    1e-04   Hippea sp. KM1
ref|XP_010030464.1|  PREDICTED: uncharacterized protein LOC104420296  51.6    2e-04   
ref|WP_017651780.1|  photosystem I assembly protein                   50.4    2e-04   Fortiea contorta
ref|XP_008382429.1|  PREDICTED: uncharacterized protein LOC103445188  49.7    2e-04   
ref|WP_015140712.1|  hypothetical protein                             50.1    2e-04   Nostoc sp. PCC 7524
ref|WP_017316228.1|  photosystem I assembly protein                   50.1    3e-04   Mastigocladopsis repens
ref|WP_017741839.1|  photosystem I assembly protein                   49.7    4e-04   Scytonema hofmannii
ref|WP_013192674.1|  hypothetical protein                             49.7    4e-04   Trichormus azollae
ref|WP_006197429.1|  hypothetical protein                             49.7    4e-04   Nodularia spumigena
ref|WP_017320436.1|  photosystem I assembly protein                   49.3    5e-04   cyanobacterium PCC 7702
ref|WP_027844742.1|  TPR repeat-containing photosystem I assembly...  48.9    7e-04   Mastigocoleus testarum
ref|WP_015193116.1|  Tetratricopeptide TPR_1 repeat-containing pr...  48.9    8e-04   Stanieria cyanosphaera



>ref|XP_009612160.1| PREDICTED: uncharacterized protein LOC104105529 [Nicotiana tomentosiformis]
Length=222

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +LFM+NIPQ  +SKL++R +A  +QA+RHFV GAQ L+QA+++     S   +LAKSA
Sbjct  24   FMFLFMYNIPQKFFSKLRLRNRA-DMQAKRHFVQGAQLLSQAKSSAAKDRSAAASLAKSA  82

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA+ AI +D +DAA H+LKA+AL++QGFKTSALD++++ALSPLA KSLS PE+A+AL 
Sbjct  83   EAEADLAIALDPRDAAAHILKALALDLQGFKTSALDSIDIALSPLAVKSLSEPEKADALF  142

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL+LAVS+  Q+DS +EDL ESVRLKGDNVK  CLLG+CYEKK L+EEA++ YE AL
Sbjct  143  KRAELRLAVSRRGQVDSVIEDLTESVRLKGDNVKAFCLLGDCYEKKGLTEEAQEVYEKAL  202

Query  219  KIQPDYSAAQDALARLTS  166
            K+QP+++ A++AL RL S
Sbjct  203  KVQPNFAPAREALDRLNS  220



>ref|XP_011074276.1| PREDICTED: uncharacterized protein LOC105159041 [Sesamum indicum]
Length=210

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 156/198 (79%), Gaps = 9/198 (5%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +LF+H+IPQ L+SKL++  +    +A+RHFVLGAQ L+QAR++ D S + R      A
Sbjct  21   FMFLFIHSIPQKLFSKLRLLSRRSNFEAKRHFVLGAQLLSQARSSSDRSLAHR------A  74

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA++AI ID KDAA H+LKA+ALE+QGFKTSALD++++ALSPLAAKSLS  ERAEAL 
Sbjct  75   EAEADRAISIDPKDAAYHILKALALELQGFKTSALDSLDIALSPLAAKSLSDGERAEALF  134

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL+LAV  G     AVEDL+ESV+LKGDN +   LLGECYEKK L EEARK+Y DAL
Sbjct  135  KRAELRLAVIDG---GGAVEDLVESVKLKGDNARAYGLLGECYEKKGLKEEARKAYGDAL  191

Query  219  KIQPDYSAAQDALARLTS  166
            ++QP+Y +A+DALARL +
Sbjct  192  RVQPEYDSARDALARLVA  209



>ref|XP_004238010.1| PREDICTED: uncharacterized protein LOC101259041 [Solanum lycopersicum]
Length=220

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +LFM+N+PQ  +SKL++R +A  +Q++RHFV GAQ L+QA++A     S   +LAKSA
Sbjct  25   FMFLFMYNVPQKYFSKLRLRNRA-DMQSKRHFVQGAQLLSQAKSAAAKDRSKSTSLAKSA  83

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E +A+ AI +D KDAA H+LKA+AL++QGFKTSALD+++VALSPLA KSLS PE+A+AL 
Sbjct  84   EAQADLAIALDPKDAAAHILKALALDLQGFKTSALDSIDVALSPLAVKSLSEPEKADALF  143

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRA+L+LA    EQ+DS +EDL +SVRLKGDNVK  CLLG+CYEKK L EEARK+Y++A 
Sbjct  144  KRAQLRLA---AEQVDSVIEDLSQSVRLKGDNVKAFCLLGDCYEKKGLKEEARKAYQEAQ  200

Query  219  KIQPDYSAAQDALARLTS  166
            K+QP+++ A++AL RL S
Sbjct  201  KVQPNFAPAREALDRLNS  218



>ref|XP_009773482.1| PREDICTED: uncharacterized protein LOC104223708 [Nicotiana sylvestris]
Length=222

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +LFM+NIPQ  +SKL++R +A  +QA+RHFV GAQ L+QA++      S   +LAKSA
Sbjct  24   FMFLFMYNIPQKFFSKLRLRNRA-DMQAKRHFVQGAQLLSQAKSTFAKDRSAAASLAKSA  82

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA+ AI +D +DAA H+LKA+AL +QGFKTSALD++++ALSPLA KSLS PE+A+AL 
Sbjct  83   EAEADLAIALDPRDAAAHILKALALVLQGFKTSALDSIDIALSPLAVKSLSEPEKADALF  142

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL+LAVS+  Q+DS VEDL ESVRLKGDNVK   LLG+CYEKK L EEA++ YE AL
Sbjct  143  KRAELRLAVSRRGQVDSVVEDLTESVRLKGDNVKAFYLLGDCYEKKGLKEEAQEVYEKAL  202

Query  219  KIQPDYSAAQDALARLTS  166
            KIQP+++ A++AL RL S
Sbjct  203  KIQPNFAPAREALDRLNS  220



>emb|CDP00933.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 156/198 (79%), Gaps = 3/198 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L+M NIPQ  +SKL++RRQA  +QA+RHF+ GAQ  +QA+ AKD SS+   +LAKSA
Sbjct  17   FMFLYMQNIPQKFFSKLRLRRQA-NVQAKRHFIKGAQLYSQAKLAKDRSSTS--SLAKSA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            EEEA+ AI +D+KDAA H+LKA+ LE++G K +A+D ++ ALSP  A+SLS  ER +AL 
Sbjct  74   EEEADVAIALDSKDAAAHILKALVLELRGLKAAAIDTLDTALSPGLARSLSGEERGDALF  133

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL+LAVS+  Q+DSAVEDL+ESV+L+ DN +  CLLG+ Y+KK + EEA+K+YEDAL
Sbjct  134  KRAELRLAVSRRGQVDSAVEDLVESVKLRHDNARAYCLLGDSYKKKGMVEEAKKAYEDAL  193

Query  219  KIQPDYSAAQDALARLTS  166
            K+QP  S A++ LARL S
Sbjct  194  KVQPTNSEAREELARLAS  211



>ref|XP_003526555.1| PREDICTED: anaphase-promoting complex subunit 7-like [Glycine 
max]
Length=222

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
            F++L+MH IPQNLY+KL+ R    R +QA+RHFV GAQ LAQAR +K  SS+   +LAK 
Sbjct  25   FSFLWMHGIPQNLYAKLRHRPPNPRAVQAKRHFVKGAQLLAQARRSKSASSAT--SLAKQ  82

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
            A  EAEKAI +D KDAA HLLK+MAL++QGF+T+ALDA++ ALSPLAA SL+  ER +AL
Sbjct  83   ALAEAEKAIALDPKDAASHLLKSMALDLQGFRTNALDALDAALSPLAAGSLAEDERGDAL  142

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
             KRAELK+A+S+   +DS + DL ESV+L   N K  C+LGE YE  ++ EEA+K+Y++A
Sbjct  143  LKRAELKIAMSERRGVDSVLADLTESVKLSPRNAKAWCMLGETYEGNKMGEEAKKAYKEA  202

Query  222  LKIQPDYSAAQDALARLTS  166
            L+++P  + AQ+AL+RL S
Sbjct  203  LELEPQLNVAQEALSRLGS  221



>ref|XP_008338964.1| PREDICTED: uncharacterized protein LOC103402004 [Malus domestica]
Length=239

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
              +L +HNIPQ L + L+ R R     QA+RHFVLGAQ L Q+R+A   SS+   +L++ 
Sbjct  42   VAFLSIHNIPQKLIANLRYRFRNKPAAQAKRHFVLGAQLLGQSRSANSRSSTA--SLSQQ  99

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
            A +EAEKAI +D KDAA H+LKA+AL+ QG+KTSALDA++VALSPL  KSL+  +R +AL
Sbjct  100  ALDEAEKAIALDPKDAAAHILKALALDAQGYKTSALDAIDVALSPLCRKSLTEEDRGDAL  159

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
             KRAE+KL++++  ++DS +EDL  +V L  +NVK  C LGECYE K+++EEARK+YE A
Sbjct  160  VKRAEIKLSMNRKARVDSVIEDLTRAVELSPENVKAFCTLGECYEGKKMAEEARKAYEAA  219

Query  222  LKIQPDYSAAQDALARLTS  166
            LK+QP   AA DAL RL S
Sbjct  220  LKVQPRLKAAMDALERLGS  238



>ref|XP_003522769.1| PREDICTED: uncharacterized protein LOC100799725 [Glycine max]
Length=221

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
            F++L+MH +PQNLY+KL+ R   +R +QA+RHFV GAQ LAQAR +K  S+S   +LAK 
Sbjct  25   FSFLWMHGLPQNLYAKLRHRPPNSRAVQAKRHFVQGAQLLAQARRSK--SASAATSLAKQ  82

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
            A  EAEKA+ +D KDAA HLLK+MAL++QGF+T+ALDA++ ALSPLAA SL+  ER +AL
Sbjct  83   ALAEAEKALALDPKDAASHLLKSMALDLQGFRTNALDALDAALSPLAAGSLAEEERGDAL  142

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
             KRAELK+A+S+  ++DS + DL ESV+L   N K  C+LGECYE  ++ EEA+K+Y++A
Sbjct  143  LKRAELKIAMSE-RRVDSVLADLTESVKLSPRNAKAWCMLGECYEGNKMGEEAKKAYKEA  201

Query  222  LKIQPDYSAAQDALARLTS  166
            L+++P  + AQ+AL+RL S
Sbjct  202  LELEPQSNVAQEALSRLGS  220



>ref|XP_010254565.1| PREDICTED: uncharacterized protein LOC104595511 [Nelumbo nucifera]
Length=214

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            YL M N P+   +K ++R +A  +QA+RHFV GAQ LA+ARTA+  SS +  +LAK A +
Sbjct  21   YLVMQNFPKQALAKFRLRGRA-NVQAKRHFVHGAQLLARARTARSRSSCI--SLAKEATD  77

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ +D KDAA H+LKA+AL++QG KTSAL +++ ALSP A KSL+  ER +AL KR
Sbjct  78   EADKALSLDPKDAAAHILKALALDLQGHKTSALKSLDAALSPPAVKSLTDRERGDALFKR  137

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AEL++ +++  ++DSAV DL+ESV L  +N K  CLLG+CYE KE+ EEARK+YEDA+++
Sbjct  138  AELQVELNRRRRVDSAVSDLVESVNLSPENSKAFCLLGQCYEHKEMREEARKAYEDAIRV  197

Query  213  QPDYSAAQDALARLTS  166
             P+ +AA++ L RL S
Sbjct  198  DPNSAAAREGLDRLAS  213



>ref|XP_002285656.1| PREDICTED: uncharacterized protein LOC100248933 [Vitis vinifera]
Length=216

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +L+M++IP    +KL +      ++A+RHFVLGAQRLAQAR+     S + ++LAK+A E
Sbjct  21   FLYMNDIPGKALAKLSLWYNQTNLEAKRHFVLGAQRLAQARSPNTPHSDV-ISLAKTAAE  79

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ ++ KDAA H+LKA+AL++QGF+ SALD+++ ALSPLA KSL+  ER +AL KR
Sbjct  80   EADKALSLNPKDAAAHILKALALDLQGFRLSALDSLDAALSPLAVKSLTDEERGDALIKR  139

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            A+LK+ + K  ++DSAV DL+E+VR+  +  K  CLLGECYE KE+ EEA K+Y++A+ I
Sbjct  140  AQLKIGLDKVGRVDSAVADLVEAVRVGSEKDKAYCLLGECYEMKEMKEEATKAYQEAITI  199

Query  213  QPDYSAAQDALARLTS  166
            QP+ + A+DAL RLTS
Sbjct  200  QPNSALARDALDRLTS  215



>gb|KDP41492.1| hypothetical protein JCGZ_15899 [Jatropha curcas]
Length=218

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F YL++H IPQ   +K +  R    ++A+RHFVLGA+ L+ AR+  D S S  ++LAK A
Sbjct  20   FGYLYVHEIPQKALAKFREYRSRPGVEAKRHFVLGARTLSLARSP-DNSHSTTISLAKKA  78

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E+EA+KAI +D KDAA+H+LKA++L++QGFK+SALD+++VALSPLA KSL+  E+ +AL 
Sbjct  79   EDEADKAISLDPKDAAVHILKALSLDLQGFKSSALDSLDVALSPLAVKSLTESEKGDALF  138

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL +  ++ E++D+A++DL ++V+L  +N     LLGECYE K++ EEA+ +YE+AL
Sbjct  139  KRAELVVGTNRSERVDAAIQDLTQAVKLNKENANAFRLLGECYEAKKMEEEAKSAYEEAL  198

Query  219  KIQPDYSAAQDALARLTS  166
            K+QP+ ++A+ AL RLTS
Sbjct  199  KLQPEMASAKAALERLTS  216



>ref|XP_004288856.2| PREDICTED: uncharacterized protein LOC101291379 [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 150/196 (77%), Gaps = 3/196 (2%)
 Frame = -3

Query  744  MHNIPQNLYSKLQMRRQART-IQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeee-  571
            +HN+P+ + + L++R Q+++ IQ++RHFVLGAQ LAQAR+A   +SS     + S +   
Sbjct  26   IHNVPKRVLANLRLRLQSKSGIQSKRHFVLGAQLLAQARSATQSTSSSSSAASLSKQALE  85

Query  570  -aekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
             A+KAI +D KDAA H+LKA+AL+ QGFKTSALDA+ VALSPL  KSL+  ER +AL KR
Sbjct  86   HADKAIALDPKDAAAHILKALALDAQGFKTSALDAIEVALSPLCRKSLADDERGDALCKR  145

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AE+K+++++  ++DS +EDL  +V+L  +NVK  C LGECYE+K+++EEA+K+YE+ALKI
Sbjct  146  AEIKMSMNRPARVDSVIEDLTLAVKLSPENVKAFCTLGECYEEKKMTEEAKKAYEEALKI  205

Query  213  QPDYSAAQDALARLTS  166
            QP  + A++AL RL S
Sbjct  206  QPRLAVAKEALDRLGS  221



>gb|KJB58858.1| hypothetical protein B456_009G228900 [Gossypium raimondii]
Length=212

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L MH+IP+ +++K++ R +A   QA+RHFVLGAQ LAQAR++K  S S   +LAK A
Sbjct  17   FMFLAMHDIPKKIFTKIRYRNRA-DFQAKRHFVLGAQLLAQARSSK--SRSSTASLAKQA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA+KAI +D KDAA ++LKA+AL++QGFKTSALD+++VALSP+AAKSL+  ER +AL 
Sbjct  74   EAEADKAISLDRKDAAAYILKALALDLQGFKTSALDSLDVALSPIAAKSLTDKERGDALF  133

Query  399  KRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            KRAELK+++++ G ++DSA++DL +++ L GDN K  CLLGECYE K++  EA+ ++E A
Sbjct  134  KRAELKMSMNRRGGRVDSAIDDLTKALELSGDNAKAFCLLGECYEMKKMKSEAKSAFEKA  193

Query  222  LKIQPDYSAAQDALARLTS  166
            LK++P  + A+ A+ RL S
Sbjct  194  LKVEPTSNVARTAIDRLGS  212



>ref|XP_009376255.1| PREDICTED: uncharacterized protein LOC103964966 [Pyrus x bretschneideri]
Length=241

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTI-QARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
              +L ++NIPQ L++KL+ R + +T  +A+RHFVLGAQ LAQ+R+A  LSSS   +L++ 
Sbjct  42   IAFLTINNIPQKLFAKLRYRFRNKTAARAKRHFVLGAQLLAQSRSADSLSSSASASLSQQ  101

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
            A +EAEKAI +  KDAA H+LK++AL+ QG+KTSALDA++VALSPL  KSL+  ER +AL
Sbjct  102  ALDEAEKAIALVPKDAAAHILKSLALDAQGYKTSALDAIDVALSPLCRKSLTDEERGDAL  161

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
             KRAE+ L++++  Q+D  +EDL  +V L  +NVK  C LGECYE K+++EEARK+YE A
Sbjct  162  VKRAEIMLSMNRKAQVDPVIEDLNRAVELSPENVKAFCTLGECYEGKKMTEEARKAYEAA  221

Query  222  LKIQPDYSAAQDALARLTS  166
            L++QP   AA DAL RL S
Sbjct  222  LRVQPRLKAAMDALERLGS  240



>gb|EYU36449.1| hypothetical protein MIMGU_mgv11b018096mg [Erythranthe guttata]
Length=208

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 146/190 (77%), Gaps = 6/190 (3%)
 Frame = -3

Query  741  HNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaek  562
            H +PQ L SKL++  +   +QARRHFV+GAQ L+QAR+    SSS   +LA+ A  EA+K
Sbjct  23   HEVPQKLISKLRLLTRRSNLQARRHFVIGAQLLSQARS----SSSDFRSLAERAAAEADK  78

Query  561  AIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAELK  382
            AI +D K+AA H+LKA+ALE+ GFKTSALD+++ ALSPLAAKSLS  ER +AL KRAEL+
Sbjct  79   AIALDPKEAASHILKALALELLGFKTSALDSLDAALSPLAAKSLSDEERGDALFKRAELR  138

Query  381  LAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDY  202
             AV  G    +AVEDL+ESVRLKGDN K   LLGECYEKK L +EA+K+YE+AL++QPDY
Sbjct  139  AAVDGGGG--AAVEDLVESVRLKGDNAKAYGLLGECYEKKGLIDEAQKAYENALRVQPDY  196

Query  201  SAAQDALARL  172
              A+D+L RL
Sbjct  197  VLARDSLTRL  206



>ref|XP_008378598.1| PREDICTED: uncharacterized protein LOC103441677 [Malus domestica]
Length=275

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTI-QARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            +L +HNIPQ L++KL+ R + +T  +A+RHFVLGAQ LAQ+R+A   S +   +L++ A 
Sbjct  80   FLTIHNIPQKLFAKLRYRFRNKTAARAKRHFVLGAQLLAQSRSAD--SLASSASLSQQAL  137

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
            +EAEKAI +  KDAA H+LK++AL+ QGFKTSALDA+ VALSPL  KSL+  ER +A+ K
Sbjct  138  DEAEKAIALVPKDAAAHILKSLALDAQGFKTSALDAIEVALSPLCRKSLTDEERGDAVVK  197

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            RAE+ L++++  Q+D  +EDL  +V L  +NVK  C LGECYE K+++EEARK+YE AL+
Sbjct  198  RAEIMLSMNRKAQVDPVIEDLNRAVELSPENVKAFCTLGECYEGKKMTEEARKAYEAALR  257

Query  216  IQPDYSAAQDALARLTS  166
            +QP   AA DAL RL S
Sbjct  258  VQPRLKAAMDALERLGS  274



>ref|XP_003635542.1| PREDICTED: uncharacterized protein LOC100854495 [Vitis vinifera]
Length=213

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 145/196 (74%), Gaps = 3/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            ++ M+ +P+   +KL+++ +A T+QA RHFV GAQ LA+AR+A+  ++S+  TLA+ A  
Sbjct  19   FVAMYKLPKQALAKLRLKNRA-TVQANRHFVQGAQLLARARSAQKRATSL--TLAQGAVA  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA KA+ +D KDA   +LKA+AL++QG K+SAL +++ ALSP A KSLS  ER +AL KR
Sbjct  76   EANKALNLDPKDAGAQILKALALDLQGHKSSALRSLDAALSPPAVKSLSDRERGDALFKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AEL++A+++  ++DSAV DL+E+VRL  DN K  CLLGECYE K + +EARK++  AL+I
Sbjct  136  AELRVAINRRRRVDSAVADLVEAVRLSEDNCKAFCLLGECYEHKGMKDEARKAFLQALRI  195

Query  213  QPDYSAAQDALARLTS  166
            +P   AA+ AL RL S
Sbjct  196  EPTSDAARQALERLAS  211



>ref|XP_007136324.1| hypothetical protein PHAVU_009G035900g [Phaseolus vulgaris]
 gb|ESW08318.1| hypothetical protein PHAVU_009G035900g [Phaseolus vulgaris]
Length=226

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
            F++L+MH IPQ LY+KL+ R    R +QA+ HFV GAQ +AQAR +K  ++S+  +LAK 
Sbjct  25   FSFLWMHGIPQRLYAKLRYRPPNPRAVQAKGHFVKGAQLIAQARRSK--TASVTTSLAKQ  82

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
            A  EAEKAI +D KDAA H LK+MAL++QGF+++ALDA++ ALSPLAA SL+  ER +AL
Sbjct  83   ALAEAEKAIELDPKDAASHFLKSMALDLQGFRSNALDALDAALSPLAAASLAADERGDAL  142

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
             KRAELK+A+S+  + DS + DL ESV+L   N K  C+LGEC E  E+ EEA+K+Y++A
Sbjct  143  LKRAELKIALSE-RRADSVLADLNESVKLSPRNAKAWCMLGECCEGNEMGEEAKKAYKEA  201

Query  222  LKIQPDYSAAQDALARLTS  166
            L+++P  + AQ+AL RL S
Sbjct  202  LELEPQLNVAQEALKRLGS  220



>ref|XP_004501659.1| PREDICTED: uncharacterized protein LOC101488532 [Cicer arietinum]
Length=228

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = -3

Query  744  MHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeae  565
            MH IPQ L +KL++R +   ++A+RHFV GAQ LAQAR++K+ S S   +LA  A  EAE
Sbjct  30   MHGIPQKLLAKLRLRNRT-GVKAKRHFVRGAQLLAQARSSKNKSRSAINSLANEALAEAE  88

Query  564  kAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAEL  385
            +AI +D KDAA +LLKAM L++QGF+TSAL++++ ALSPLAA SL+  ER +AL+KRAEL
Sbjct  89   QAIALDPKDAASYLLKAMVLDLQGFRTSALESLDAALSPLAAGSLAEGERGDALYKRAEL  148

Query  384  KLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPD  205
            KLA S+  ++DSA++DL ESV L   N K    LGECYE K++ EEA+K+Y++AL+++P 
Sbjct  149  KLATSERGRVDSALKDLTESVILSPKNAKAWSALGECYEGKKMEEEAKKAYKEALELEPH  208

Query  204  YSAAQDAL  181
            +S   +AL
Sbjct  209  FSVPLEAL  216



>ref|XP_006433807.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
 ref|XP_006433808.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
 gb|ESR47047.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
 gb|ESR47048.1| hypothetical protein CICLE_v10002461mg [Citrus clementina]
Length=212

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F  L ++ IPQ   SKL+ R +  +IQA+RHFV+GAQ LAQAR++K  S S   +LAK A
Sbjct  17   FMLLALYEIPQKFISKLRFRNRG-SIQAKRHFVIGAQLLAQARSSK--SKSSASSLAKQA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA+KAI  D KDAA H+LKA+AL++QGFKTSAL++ ++ALS  A K+L+  E+ +AL 
Sbjct  74   EAEADKAISFDYKDAAAHILKALALDLQGFKTSALESFDLALSIPAVKTLTEKEKGDALF  133

Query  399  KRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            KRAE+K+++++   ++DSA++DL E+V+++ DNVK LCLLGECYE K++ +EA+ +YE A
Sbjct  134  KRAEVKMSMNRRAGRVDSAIDDLTEAVKIQDDNVKALCLLGECYEVKKMRDEAKTAYESA  193

Query  222  LKIQPDYSAAQDALARLTS  166
            LKI+P ++ AQ AL RL S
Sbjct  194  LKIEPSWTDAQAALDRLVS  212



>ref|XP_011017014.1| PREDICTED: uncharacterized protein LOC105120491 [Populus euphratica]
Length=212

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L MHNIPQ   SKL+ R +A  +QA+RHFVLGAQ +AQAR+  + S S   +LAK A
Sbjct  17   FMFLAMHNIPQKFLSKLRYRNRA-DLQAKRHFVLGAQLIAQARSPSN-SRSTATSLAKQA  74

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            EEEA KAI +D KDAA H+LKA++L++QGF+TSAL+++NVALSPLA KSLS  E+ +AL 
Sbjct  75   EEEANKAISLDPKDAASHILKALSLDLQGFRTSALESINVALSPLAVKSLSASEKGDALF  134

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL + +++  +++ A++DL E+V+L  DN K  CLLGECYE K++ EEA+++YE+AL
Sbjct  135  KRAELAMGMNRRGRVEPAIQDLTEAVKLNKDNAKAFCLLGECYEAKKMIEEAKEAYEEAL  194

Query  219  KIQPDYSAAQDALARLTS  166
            ++QP+ ++A++ L RL S
Sbjct  195  RLQPELASAKEKLDRLRS  212



>ref|XP_002514058.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48641.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
              YL MHNIPQ   +K +  R     +A+R FVLGAQ LAQAR+  + S S  ++LAK A
Sbjct  17   IMYLAMHNIPQKALAKFREYRGRAGAEAKRQFVLGAQILAQARSPSN-SRSRTISLAKQA  75

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            EE A KAI +D KDAA H+LKA++L++QGFK+SALD+++VALSPLA KSLS  E+ +AL 
Sbjct  76   EEAAIKAISLDPKDAAAHILKALSLDLQGFKSSALDSLDVALSPLAVKSLSEREKGDALF  135

Query  399  KRAELKLAVSKGEQ-IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            KRAEL + ++K E+ ++SA+EDL E+V L  +N     LLGECYE KE+SEEA+ +Y++A
Sbjct  136  KRAELVMGMNKKEKRVESAIEDLKEAVELSKENANAFRLLGECYEVKEMSEEAKFAYQEA  195

Query  222  LKIQPDYSAAQDALARL  172
            L++ PD   A+DAL RL
Sbjct  196  LRLNPDLGLAKDALQRL  212



>ref|XP_006472445.1| PREDICTED: uncharacterized protein LOC102615118 isoform X1 [Citrus 
sinensis]
 ref|XP_006472446.1| PREDICTED: uncharacterized protein LOC102615118 isoform X2 [Citrus 
sinensis]
Length=212

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F  L ++ IPQ   SKL+ R +  +IQA+RHFV+GAQ LAQAR++K  S S   +LAK A
Sbjct  17   FMLLALYEIPQKFISKLRFRNRG-SIQAKRHFVIGAQLLAQARSSK--SKSSASSLAKQA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA+KAI  D KDAA H+LKA+AL++QGFKTSAL++ ++ALS  A K+L+  E+ +AL 
Sbjct  74   EAEADKAISFDYKDAAAHILKALALDLQGFKTSALESFDLALSIPAVKTLTEKEKGDALF  133

Query  399  KRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            KRAE+K+++++   ++DSA++DL E+V+++ DNVK LCLLGECYE K++ +EA+ +YE A
Sbjct  134  KRAEVKMSMNRRAGRVDSAIDDLTEAVKIQDDNVKALCLLGECYEVKKMRDEAKTAYESA  193

Query  222  LKIQPDYSAAQDALARLTS  166
            LKI+P ++ AQ AL RL S
Sbjct  194  LKIEPSWTDAQAALDRLGS  212



>emb|CAN68131.1| hypothetical protein VITISV_043709 [Vitis vinifera]
Length=1169

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = -3

Query  753   YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
             +L+M++IP    +KL +      ++A+RHFVLGAQRLAQAR+     S + ++LAK+A E
Sbjct  974   FLYMNDIPGKALAKLSLWYNQTNLEAKRHFVLGAQRLAQARSPNTPHSDV-ISLAKTAAE  1032

Query  573   eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
             EA+KA+ ++ KDAA H+LKA+AL++QGF+ SALD+++ ALSPLA KSL+  ER +AL KR
Sbjct  1033  EADKALSLNPKDAAAHILKALALDLQGFRLSALDSLDAALSPLAVKSLTDEERGDALIKR  1092

Query  393   AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
             A+LK+ + K  ++DSAV DL+E+VR+  +  K  CLLGECYE KE+ EEA K+Y++A+ I
Sbjct  1093  AQLKIGLDKVGRVDSAVADLVEAVRVGSEKDKAYCLLGECYEMKEMKEEATKAYQEAITI  1152

Query  213   QPDYSAAQDALARLTS  166
             QP+ + A+DAL RLTS
Sbjct  1153  QPNSALARDALDRLTS  1168



>ref|XP_008444918.1| PREDICTED: uncharacterized protein LOC103488119 [Cucumis melo]
Length=211

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +L MHNIPQ  ++KL++R ++  ++++RHFV GAQ LA+AR+A   SS+   +LA+    
Sbjct  19   FLAMHNIPQRYFAKLRLRFRS-NVESKRHFVRGAQLLARARSAPSRSSAT--SLAEEVVA  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA KAI +D KDAA H+LKA+AL+VQGFKTSAL++++ ALSPL AKSLS  ER +AL KR
Sbjct  76   EANKAIALDPKDAAAHILKALALDVQGFKTSALESLDTALSPLVAKSLSDEERGDALFKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AELK++ ++   +DSA+ DL ESV L   N      LG+CYE K+L EEA+K+YE+AL I
Sbjct  136  AELKMSTNRRALVDSALADLTESVTL-SQNANSYYWLGKCYEMKKLREEAKKAYEEALNI  194

Query  213  QPDYSAAQDALARLTS  166
            +P  S A++AL RL+S
Sbjct  195  EPRLSNAREALERLSS  210



>ref|XP_003602892.1| hypothetical protein MTR_3g100100 [Medicago truncatula]
 gb|AES73143.1| TPR domain protein [Medicago truncatula]
Length=223

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
              +L MH IPQ   +KL+ + + + I+A+RHFV GAQ L QAR++K+ S S    LA  A
Sbjct  25   LIFLSMHGIPQKFLAKLRFQNR-KAIKAKRHFVRGAQLLTQARSSKNKSRSAINNLANEA  83

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EAEKAI +D KDAA +LLKAM L++QGF+TSAL++++ ALSPLAA SL   ER +AL 
Sbjct  84   LGEAEKAIELDPKDAASYLLKAMILDLQGFRTSALESLDAALSPLAAGSLEQGERGDALF  143

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAELKLA S+  ++DSA+ DL ESV L   N K  C LGECYE K++ EEA+K+Y++A 
Sbjct  144  KRAELKLATSERGRVDSALADLTESVILSPKNAKAWCALGECYEGKKMDEEAKKAYKEAH  203

Query  219  KIQPDYSAAQDAL  181
            ++ P YS   +AL
Sbjct  204  ELAPQYSVPVEAL  216



>gb|KHN08280.1| hypothetical protein glysoja_017758 [Glycine soja]
Length=208

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 127/199 (64%), Gaps = 17/199 (9%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
            F++L+MH +PQNLY+KL+ R   +R +QA+RHFV GAQ LAQAR +K  S++  +     
Sbjct  25   FSFLWMHGLPQNLYAKLRHRPPNSRAVQAKRHFVQGAQLLAQARRSKSASAATSLA----  80

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
                           A      A+  +       ALDA++ ALSPLAA SL+  ER +AL
Sbjct  81   -----------KQALAEAEKALALDPKDAASHLHALDALDAALSPLAAGSLAEEERGDAL  129

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
             KRAELK+A+S+  ++DS + DL ESV+L   N K  C+LGECYE  ++ EEA+K+Y++A
Sbjct  130  LKRAELKIAMSE-RRVDSVLADLTESVKLSPRNAKAWCMLGECYEGNKMGEEAKKAYKEA  188

Query  222  LKIQPDYSAAQDALARLTS  166
            L+++P  + AQ+AL+RL S
Sbjct  189  LELEPQSNVAQEALSRLGS  207



>ref|XP_004152601.1| PREDICTED: uncharacterized protein LOC101214199 isoform 1 [Cucumis 
sativus]
 ref|XP_004152602.1| PREDICTED: uncharacterized protein LOC101214199 isoform 2 [Cucumis 
sativus]
 ref|XP_004163954.1| PREDICTED: uncharacterized LOC101214199 isoform 1 [Cucumis sativus]
 ref|XP_004163955.1| PREDICTED: uncharacterized LOC101214199 isoform 2 [Cucumis sativus]
 gb|KGN62747.1| hypothetical protein Csa_2G370460 [Cucumis sativus]
Length=214

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 144/196 (73%), Gaps = 4/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +L MHNIPQ  ++KL++R ++  ++++RHFV GAQ LA+AR+A   SS+   +LA+    
Sbjct  19   FLAMHNIPQRYFAKLRLRFRS-NVESKRHFVRGAQLLARARSAPSRSSAT--SLAEEVVA  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA KAI +D KDAA H+LKA+AL+ QGFKTSAL++++ ALSPL AKSLS  ER +AL KR
Sbjct  76   EANKAIALDPKDAAAHILKALALDTQGFKTSALESLDTALSPLVAKSLSDEERGDALFKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AELK++ ++   +DSA+ DL ESV L   N      LG+CYE K+L EEA+K+YE+AL I
Sbjct  136  AELKMSTNRRALVDSALADLTESVTL-SQNANSYYWLGKCYETKKLREEAKKAYEEALNI  194

Query  213  QPDYSAAQDALARLTS  166
            +P  S A++AL RL+S
Sbjct  195  EPRLSNAREALERLSS  210



>gb|AFK38269.1| unknown [Medicago truncatula]
Length=223

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
              +L MH IPQ   +KL+ + + + I+A+RHFV GAQ L QAR++K+ S S    LA  A
Sbjct  25   LIFLSMHGIPQKFLAKLRFQNR-KAIKAKRHFVRGAQLLTQARSSKNKSRSAINNLANEA  83

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EAEKAI +D KDAA +LLKAM L++QGF+TSAL++++ ALSPLAA SL   ER +AL 
Sbjct  84   LGEAEKAIELDPKDAASYLLKAMILDLQGFRTSALESLDAALSPLAAGSLEQGERGDALF  143

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAELKLA S+  ++DSA+ DL ESV L   N K  C LG+CYE K++ EEA+K+Y++A 
Sbjct  144  KRAELKLATSERGRVDSALADLTESVILSPKNAKAWCALGDCYEGKKMDEEAKKAYKEAH  203

Query  219  KIQPDYSAAQDAL  181
            ++ P YS   +AL
Sbjct  204  ELAPQYSVPVEAL  216



>ref|XP_008219242.1| PREDICTED: uncharacterized protein LOC103319477 [Prunus mume]
Length=218

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            +L +HNIPQ L + L+ R R     QA+RHFV+GAQ LAQAR+A   S S   +L++ A 
Sbjct  23   FLAIHNIPQKLLANLRFRFRNKPKAQAKRHFVVGAQLLAQARSAA--SPSSASSLSQQAL  80

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
            +EAEKAI +D KDAA H+LKA+AL+ QG+KTSALDA++VALSP AAKSL+  ER +AL K
Sbjct  81   DEAEKAISLDPKDAAAHILKALALDSQGYKTSALDAIDVALSPFAAKSLTEEERGDALVK  140

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            RAE++L++++  Q+D  + DL  +V L  +NVK  C LGECYE K+++EEARK+YE ALK
Sbjct  141  RAEIRLSMNRRGQVDLVIADLTRAVELSPENVKAFCTLGECYEGKKMTEEARKAYEAALK  200

Query  216  IQPDYSAAQDALARLTS  166
            +QP    A+DAL RL S
Sbjct  201  VQPRLKVARDALDRLGS  217



>ref|XP_002301124.2| hypothetical protein POPTR_0002s11190g [Populus trichocarpa]
 gb|EEE80397.2| hypothetical protein POPTR_0002s11190g [Populus trichocarpa]
Length=212

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 151/198 (76%), Gaps = 2/198 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L MHNIPQ   SKL+ R +   +QA+RHFVLGAQ +AQAR+  + S S   +LAK A
Sbjct  17   FMFLAMHNIPQKFLSKLRYRNRT-DLQAKRHFVLGAQLIAQARSPSN-SRSTATSLAKQA  74

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E+EA KAI +D KDAA H+LKA++L++QGF+TSAL+++NVALSPLA KSLS  E+ +AL 
Sbjct  75   EDEANKAISLDPKDAASHILKALSLDLQGFRTSALESINVALSPLAVKSLSASEKGDALF  134

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL + +++  +++ A++DL E+V+L  DN K  CLLGECYE  ++ EEA+++YE+AL
Sbjct  135  KRAELAMGMNRRGRVEPAIQDLTEAVKLNKDNAKAFCLLGECYEANKMIEEAKEAYEEAL  194

Query  219  KIQPDYSAAQDALARLTS  166
            ++QP+ ++A++ L  L S
Sbjct  195  RLQPELASAKEKLDLLRS  212



>ref|XP_010086878.1| hypothetical protein L484_001326 [Morus notabilis]
 gb|EXB24430.1| hypothetical protein L484_001326 [Morus notabilis]
Length=276

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 147/196 (75%), Gaps = 1/196 (1%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L +H+IP+ LY+K ++R +++  QA+RHFV+GAQ LA+AR+  D S S    LA+ A
Sbjct  20   FMFLALHDIPKKLYAKFRLRNRSQA-QAKRHFVVGAQLLARARSRSDSSRSAVAPLAEQA  78

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EA+KA+ +D  DAA H+L+++ L++QGFK+SALDA++ ALSPLAAKSLS  E  +A  
Sbjct  79   LAEADKAVALDPTDAAAHILRSLVLDLQGFKSSALDAIDAALSPLAAKSLSERELGDAFF  138

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAELK+A+ +  +++SA+ DL  +V L  +N +  CLLGECYE K++  EARK+YEDA+
Sbjct  139  KRAELKMAMGRRGKVESAIGDLDRAVELSPENARAFCLLGECYEAKKMEAEARKAYEDAV  198

Query  219  KIQPDYSAAQDALARL  172
            +I+P+ + A++AL RL
Sbjct  199  RIEPELALAREALDRL  214



>ref|XP_011097467.1| PREDICTED: uncharacterized protein LOC105176382 [Sesamum indicum]
Length=211

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 138/195 (71%), Gaps = 5/195 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQAR-TIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            +  +H++P+  +SKL  R QAR + QA RHF+ GAQ L++AR+ K  + S    LAKSA 
Sbjct  19   FYVLHSLPKRAFSKL--RSQARPSNQAHRHFIQGAQFLSRARSMK--TKSTVFNLAKSAV  74

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
             EA+KA+ ++ +D A H+LKAMA  + G+KTSAL +++ ALSP A K LS  E+ +AL K
Sbjct  75   NEADKALALEPRDPAAHILKAMAQSLMGYKTSALKSLDTALSPPAVKMLSGREKGDALFK  134

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            RAEL+  +++  +++SA+ DLIE+V L  DN +  CLLG+CYE K L EEA+K++EDAL+
Sbjct  135  RAELQFGLNRKRRVESAIGDLIEAVGLSSDNSRAFCLLGQCYEIKGLREEAKKAFEDALR  194

Query  216  IQPDYSAAQDALARL  172
            I+P+   AQD L RL
Sbjct  195  IEPELKEAQDGLGRL  209



>ref|XP_007018249.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY15474.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=296

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 154/199 (77%), Gaps = 4/199 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L MH+IP+ +++K++ R +A   QA+RHFVLGAQ LAQAR++K  S S   +LAK A
Sbjct  17   FMFLAMHDIPKKIFTKIRYRNRA-DFQAKRHFVLGAQLLAQARSSK--SRSSTTSLAKQA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
            E EA KAI +D KDAA ++LKA+AL++QG+KTSALD++++ALSPLAAKSL+  ER +AL 
Sbjct  74   ESEANKAISLDPKDAAAYILKALALDLQGYKTSALDSLDIALSPLAAKSLTDKERGDALF  133

Query  399  KRAELKLAVSK-GEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            KRAELK+A+++ G  +DSA+EDL ++V L  DN K  CLLGECYE K++  +A+ ++E+A
Sbjct  134  KRAELKMAMNRRGSGVDSAIEDLTKAVELGADNGKAFCLLGECYEIKKMKADAKAAFEEA  193

Query  222  LKIQPDYSAAQDALARLTS  166
            LK++P  + A+ A+ RL S
Sbjct  194  LKVEPSSNVARAAVDRLGS  212



>ref|XP_007141279.1| hypothetical protein PHAVU_008G182700g [Phaseolus vulgaris]
 gb|ESW13273.1| hypothetical protein PHAVU_008G182700g [Phaseolus vulgaris]
Length=220

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 143/196 (73%), Gaps = 7/196 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            YLFMHN+P+ L+S+L++R +A  IQA+RHFV GAQ LA+AR +K  + +           
Sbjct  27   YLFMHNVPKKLWSELRLRNRA-DIQAKRHFVQGAQLLARARASKSKALAKEAQ------A  79

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            +A++AI +D +DAA HLLKA+AL+  GF+++ALD+++ ALSPLAA SLS  ERA+AL KR
Sbjct  80   QAQRAIALDPRDAAPHLLKALALDFLGFRSAALDSLDDALSPLAATSLSNSERADALLKR  139

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AEL+LA ++  ++DSA+ DL ESV+L  +N K    LGEC+E+K++++ A ++Y+ AL++
Sbjct  140  AELRLASTQRARVDSALADLSESVKLSPNNSKAFFALGECFERKKMNDAAVEAYQQALEL  199

Query  213  QPDYSAAQDALARLTS  166
            +P    AQ AL RL S
Sbjct  200  EPQSQVAQQALRRLDS  215



>ref|XP_003544833.1| PREDICTED: uncharacterized protein LOC100809739 [Glycine max]
Length=221

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 140/198 (71%), Gaps = 7/198 (4%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
             +Y FMH++P+ L++KL++  +A  IQA+RHFV GAQ LA+AR +K  + +         
Sbjct  26   LSYFFMHDVPKKLWAKLRLSNRA-DIQAKRHFVQGAQLLARARASKSKALAKEAQ-----  79

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              +A++AI +D  DAA HLLKA+AL+  G +++ALD+++ ALSP AAKSLS  ER +AL 
Sbjct  80   -AQAQRAIALDPSDAAPHLLKALALDFLGLRSAALDSLDEALSPAAAKSLSDSERGDALL  138

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL+L  S+  ++DSA+ DL ESVRL  +N K    LG+CYE+K+++++A ++Y  AL
Sbjct  139  KRAELRLGTSQRGRVDSALADLTESVRLSPNNAKAFFALGDCYERKKMNDDAIRAYGTAL  198

Query  219  KIQPDYSAAQDALARLTS  166
            +++P + AA+ AL RL S
Sbjct  199  ELEPQFHAAEQALNRLDS  216



>gb|KDO81212.1| hypothetical protein CISIN_1g039398mg, partial [Citrus sinensis]
Length=172

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = -3

Query  684  IQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaekAIGIdakdaalhllkamaL  505
            IQA+RHFV+GAQ LAQAR++K  S S   +LAK AE EA+KAI  D KDAA H+LKA+AL
Sbjct  1    IQAKRHFVIGAQLLAQARSSK--SKSSASSLAKQAEAEADKAISFDYKDAAAHILKALAL  58

Query  504  EVQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSK-GEQIDSAVEDLIE  328
            ++QGFKTSAL++ ++ALS  A K+L+  E+ +AL KRAE+K+++++   ++DSA++DL E
Sbjct  59   DLQGFKTSALESFDLALSIPAVKTLTEKEKGDALFKRAEVKMSMNRRAGRVDSAIDDLTE  118

Query  327  SVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALARLTS  166
            +V+++ DNVK LCLLGECYE K++ +EA+ +YE ALKI+P ++ AQ AL RL S
Sbjct  119  AVKIQDDNVKALCLLGECYEVKKMRDEAKTAYESALKIEPSWTDAQAALDRLVS  172



>gb|EYU39292.1| hypothetical protein MIMGU_mgv1a013758mg [Erythranthe guttata]
Length=211

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 134/194 (69%), Gaps = 3/194 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +H++P+ +++KL+ + +    QA RHF+LGAQ L++AR+ K  S++    LAKSA +
Sbjct  19   FYVLHSLPKRVFTKLRSKTRPNN-QAHRHFILGAQLLSRARSTKTKSTAF--NLAKSAAD  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ ++ +D A H+LKAMA  + G KT+A+ +++ ALSP A K LS  E+ +AL KR
Sbjct  76   EADKALALEPRDPAAHILKAMAQGLMGHKTAAVKSLDTALSPPAVKMLSGTEKGDALFKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AEL+  +++  ++DSA+ DL+E+V L  DN K  CLLG CYE K L E+A  ++  ALKI
Sbjct  136  AELQFEMNRKRRVDSAISDLVEAVGLNPDNCKAFCLLGRCYEIKGLKEDAMNAFAAALKI  195

Query  213  QPDYSAAQDALARL  172
            +P +  A+D L R+
Sbjct  196  EPGFVEARDGLGRV  209



>ref|XP_010060105.1| PREDICTED: uncharacterized protein LOC104448032 [Eucalyptus grandis]
Length=210

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L MH+IPQ   SKL+ R + + ++A++HFV GAQ L QAR+A   S S   +LAK A
Sbjct  17   FMFLAMHDIPQRFLSKLRFRGR-KGLRAKQHFVRGAQLLGQARSAP--SRSAASSLAKDA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EA++AI +D +DAA H+LKA+AL++QGF+TSALD+++VALSPLA++SLS  ER +AL 
Sbjct  74   AAEADRAILLDPRDAASHILKALALDLQGFRTSALDSLDVALSPLASRSLSDRERGDALF  133

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            +RAELK A+S+  ++DSA++DL  +V+L     K L LLG+C+E K+  EEA K+Y++AL
Sbjct  134  RRAELKFALSRRGRVDSAIDDLTVAVKLSC-GAKALLLLGQCHEAKKSKEEAVKAYQEAL  192

Query  219  KIQPDYSAAQDALARLTS  166
            +++P  +AA++AL RL S
Sbjct  193  EMEPTLAAAREALDRLGS  210



>gb|KCW66647.1| hypothetical protein EUGRSUZ_F00428 [Eucalyptus grandis]
Length=217

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 147/195 (75%), Gaps = 4/195 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
            F +L MH+IPQ   SKL+ R + + ++A++HFV GAQ L QAR+A   S S   +LAK A
Sbjct  17   FMFLAMHDIPQRFLSKLRFRGR-KGLRAKQHFVRGAQLLGQARSAP--SRSAASSLAKDA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EA++AI +D +DAA H+LKA+AL++QGF+TSALD+++VALSPLA++SLS  ER +AL 
Sbjct  74   AAEADRAILLDPRDAASHILKALALDLQGFRTSALDSLDVALSPLASRSLSDRERGDALF  133

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            +RAELK A+S+  ++DSA++DL  +V+L     K L LLG+C+E K+  EEA K+Y++AL
Sbjct  134  RRAELKFALSRRGRVDSAIDDLTVAVKLSC-GAKALLLLGQCHEAKKSKEEAVKAYQEAL  192

Query  219  KIQPDYSAAQDALAR  175
            +++P  +AA++AL R
Sbjct  193  EMEPTLAAAREALDR  207



>ref|XP_010680361.1| PREDICTED: uncharacterized protein LOC104895521 [Beta vulgaris 
subsp. vulgaris]
Length=214

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 141/196 (72%), Gaps = 3/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +L ++N+P+  +SKL+   +A + Q+ RHF+ GAQ L++AR+  + +++   +LAK A  
Sbjct  22   FLIIYNLPKKAFSKLRSNTRANS-QSSRHFLNGAQLLSRARSTNNRATAE--SLAKDAVT  78

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            +A+ A+ +  +D A  +L+A+AL+V G ++SAL +++ AL+P AA++LS  ER +AL KR
Sbjct  79   QADMALSLLPRDGAALILRALALDVLGRRSSALRSLDAALAPPAARTLSGRERGDALVKR  138

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AEL+L+V++  ++DSA+ DL+E+V L  DN KG CLLG+CYE K + +EA +++ +ALKI
Sbjct  139  AELQLSVNRRRRVDSALLDLVEAVSLTRDNFKGFCLLGQCYEIKGMKDEACEAFTEALKI  198

Query  213  QPDYSAAQDALARLTS  166
            +P  + A++ L RL S
Sbjct  199  EPGSTLAREGLDRLKS  214



>emb|CDP01574.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 130/196 (66%), Gaps = 4/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQAR-TIQARRHFVLGAQRLAQARTAK-DLSSSMRMTLaksa  580
            +  +H++P+   SKL  R +AR  +QA RHF+ GAQ LA+AR+ +   + S    LAKSA
Sbjct  19   FYLLHHLPKQALSKL--RSKARPNVQAHRHFISGAQFLARARSVQFKNNKSTAFNLAKSA  76

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EA+KA+ I  KD A H+LKA+AL++ G K  AL +++VALSP   K LS  +R +AL 
Sbjct  77   ATEADKALAIQPKDPAAHILKAVALDIMGHKGPALKSLDVALSPAVVKGLSEKDRGDALF  136

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            KRAEL++A+++  ++DSAV DL+E+V+L  DN     LLG CYE K L EEA+ ++ +AL
Sbjct  137  KRAELQIAINRRRRVDSAVSDLVEAVKLSCDNADAFGLLGRCYEMKGLMEEAKNAFLEAL  196

Query  219  KIQPDYSAAQDALARL  172
            KI      A++ L RL
Sbjct  197  KIDRGLDEAREGLGRL  212



>ref|XP_008236271.1| PREDICTED: uncharacterized protein LOC103335053 [Prunus mume]
Length=214

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 132/199 (66%), Gaps = 6/199 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +H I +   +KL+   +A  +Q+ RHFV G+  L +AR+    + S     AK+A  
Sbjct  19   FFAIHKISRKALTKLRTNNRA-NLQSTRHFVQGSHLLTRARSNPHKAQSQ--AHAKNALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAEKA+ +  +D   H+LKA+AL++ G KTSAL + +VALSP   KSLS  ER EAL KR
Sbjct  76   EAEKALALSPRDPGPHILKALALDLLGHKTSALKSFDVALSPPCVKSLSERERGEALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            AELK+ +++  ++DSAVEDL+++VRL   +GD+V   CLLG+CYE KE+ EEAR+++E A
Sbjct  136  AELKIGLNRRRRVDSAVEDLVQAVRLSRGEGDDVTSFCLLGQCYEWKEMKEEAREAFERA  195

Query  222  LKIQPDYSAAQDALARLTS  166
            L+ +P    A+  L RL S
Sbjct  196  LRAEPGSVLARQGLDRLGS  214



>gb|KDP29775.1| hypothetical protein JCGZ_18710 [Jatropha curcas]
Length=212

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 130/196 (66%), Gaps = 3/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            ++ +   P+   +KL+ + +  +IQ+ RHF+ G   LA+A++  + S S   TLAK+A  
Sbjct  20   FIAIQYFPKQALNKLRAKNRT-SIQSNRHFIQGTHFLARAKSTPNKSQSQ--TLAKNALI  76

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAE AI +  +DAA  +LKA+AL++ G K SAL A++ ALS    KSL   +R +AL KR
Sbjct  77   EAETAISLSPRDAAPLILKALALDLLGHKASALKALDSALSSPREKSLERRDRGDALVKR  136

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AELK+AV++  ++DSA+EDL  +V L  +  K  CLLG+CYE K + +EA+ ++E+AL++
Sbjct  137  AELKMAVNRRRRVDSAIEDLKCAVELSREGEKAFCLLGQCYEWKGMGDEAKWAFEEALRV  196

Query  213  QPDYSAAQDALARLTS  166
            QP  + A+D L RL S
Sbjct  197  QPGSAGARDGLVRLGS  212



>ref|XP_009768508.1| PREDICTED: uncharacterized protein LOC104219512 [Nicotiana sylvestris]
Length=211

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  M+N P+   ++L+ + ++ T QA  HF+ GAQ L++A++ ++ S+S    LAKSA  
Sbjct  19   FYAMYNFPKQALTRLRSKNRS-TDQAHIHFIKGAQLLSRAKSNRNKSTSF--NLAKSAAG  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ ++ KD A H+LKA++L++ G K +AL  +++ALSP A K+LS  ER +AL KR
Sbjct  76   EADKALALEPKDPAAHILKALSLDLMGHKIAALRYLDLALSPPAVKALSDGERGDALLKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            AEL++A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CYE K L  EA+ ++E+ALK
Sbjct  136  AELQVALNRKRRVDSALLDLLEAVKLGCSDQAKAFCLLGQCYEMKGLKIEAQNAFEEALK  195

Query  216  IQPDYSAAQDALARLT  169
            I+P++ AA + L RL+
Sbjct  196  IEPNFVAAHEGLGRLS  211



>ref|XP_009615438.1| PREDICTED: uncharacterized protein LOC104108159 [Nicotiana tomentosiformis]
Length=211

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  M+N P+   + L+ + ++ T QA  HF+ GAQ L++A++ ++ S+S    LAKSA  
Sbjct  19   FYAMYNFPKQALTPLRSKNRS-TNQAHIHFIKGAQLLSRAKSNRNKSTSF--NLAKSAAG  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ ++ KD A H+LKA++L++ G K +AL  +++ALSP A K+LS  ER +AL KR
Sbjct  76   EADKALALEPKDPAAHILKALSLDLMGRKIAALKYLDLALSPPAVKALSDGERGDALLKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            AEL++A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CYE K L  EA+ ++E+ALK
Sbjct  136  AELQVALNRKRRVDSAMLDLLETVKLGCSDQAKAFCLLGQCYEMKGLKIEAQNAFEEALK  195

Query  216  IQPDYSAAQDALARLT  169
            I+PD  AA++ L RL+
Sbjct  196  IEPDLVAAREGLGRLS  211



>ref|XP_009399759.1| PREDICTED: uncharacterized protein LOC103984069 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 135/200 (68%), Gaps = 5/200 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQART----AKDLSSSMRMTLak  586
            +L + + P++  S+L+   Q+ ++QARRHFV GAQ LA+AR                LA+
Sbjct  25   FLGLRSFPKHALSRLRRPSQS-SLQARRHFVNGAQLLARARARPSGDSSSGGGSTTALAR  83

Query  585  saeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEA  406
            SA +EA++AI +D +DAA H+LKA+AL++ G +  AL +++ ALSP A+KSL+  ER +A
Sbjct  84   SACDEADRAIALDPRDAAPHILKALALDLLGRRLPALRSLDAALSPPASKSLAPRERGDA  143

Query  405  LHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYED  226
            L KRAEL LAV++  ++D A+ DL+++VRL  +N K  CLLGECYE+K L +EA K+YE 
Sbjct  144  LFKRAELHLAVNRRRRLDQALSDLLQAVRLSPENAKAFCLLGECYEEKGLLDEATKAYET  203

Query  225  ALKIQPDYSAAQDALARLTS  166
            A+ I     AA + L RL++
Sbjct  204  AIDIDASLVAADEGLRRLSA  223



>ref|XP_008792076.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103708778 
[Phoenix dactylifera]
Length=227

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 125/202 (62%), Gaps = 8/202 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +L +H IP+   S L+ RR   +  ARRHF  G Q LA+AR+A   + +           
Sbjct  20   FLGLHAIPRRALSGLR-RRSHSSAAARRHFFQGGQLLARARSAPSGAXAPPXXXXXXXAA  78

Query  573  eaek-------AIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPER  415
             A         AI ++ +DAA H+LKA+AL++QG    AL A++ ALSP AAKSL+  ER
Sbjct  79   LARSAADEADCAIALEPRDAAHHILKALALDLQGRPLPALRALDAALSPPAAKSLAPRER  138

Query  414  AEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKS  235
             +AL KRAEL LAV++  ++D A+ DL+E+VRL  DN +   LLGECYE K  +EEAR +
Sbjct  139  GDALAKRAELHLAVNRRRRLDQALADLLEAVRLSPDNARAFSLLGECYEHKAAAEEARTA  198

Query  234  YEDALKIQPDYSAAQDALARLT  169
            Y++A++I    ++A+  L RL+
Sbjct  199  YQNAIRIDASLASARQGLRRLS  220



>ref|XP_004250524.1| PREDICTED: uncharacterized protein LOC101263566 [Solanum lycopersicum]
Length=212

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  ++N P+   ++L+ + ++ T QA  HF+ GAQ L++A++ +    S+   LAK A  
Sbjct  19   FYTIYNFPKQALTRLRSKTRS-TNQANSHFIKGAQFLSRAKSNRS-KKSISFNLAKLAAG  76

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ ID KD A H+LKA++L++ G K SAL +++ ALSP A K LS  ERA+AL KR
Sbjct  77   EADKALSIDPKDPAAHILKALSLDLIGHKLSALRSLDSALSPPAVKLLSGGERADALLKR  136

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            AEL +A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CYE K L  EA  ++E+ALK
Sbjct  137  AELLVALNRKRRVDSALMDLLEAVKLNCSDRAKAFCLLGQCYEIKGLKIEAHNAFEEALK  196

Query  216  IQPDYSAAQDALARL  172
            ++PD  +A++ L RL
Sbjct  197  VEPDLVSAREGLGRL  211



>ref|XP_006353161.1| PREDICTED: uncharacterized protein LOC102601514 [Solanum tuberosum]
Length=212

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  ++N P+   ++L+ + ++ T QA  HF+ GAQ L++A++ +    S    LAK A  
Sbjct  19   FYTIYNFPKQALTRLRSKTRS-TNQANSHFIKGAQFLSRAKSNRS-KKSTSFNLAKLAAG  76

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+KA+ ID KD A H+LKA++L++ G K +AL +++ ALSP A KSLS  ERA+AL KR
Sbjct  77   EADKALSIDPKDPAAHILKALSLDLIGHKLAALKSLDSALSPPAVKSLSGGERADALLKR  136

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLK-GDNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            AEL +A+++  ++DSA+ DL+E+V+L   D  K  CLLG+CYE K L  EA  ++E+ALK
Sbjct  137  AELLVALNRKRRVDSALMDLLEAVKLNCSDRAKAFCLLGQCYEIKGLKIEAHNAFEEALK  196

Query  216  IQPDYSAAQDALARL  172
            ++PD   A   L RL
Sbjct  197  VEPDLVMAHKGLGRL  211



>ref|XP_010914908.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914909.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914911.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914912.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
 ref|XP_010914913.1| PREDICTED: uncharacterized protein LOC105040190 [Elaeis guineensis]
Length=220

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 133/197 (68%), Gaps = 5/197 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +L + +IP+   S L  RR   +  ARRHF  G Q LA+AR+A     +   +LA+SA +
Sbjct  20   FLGLRSIPRRALSGLH-RRSHSSAAARRHFFQGGQLLARARSAP--PGARATSLARSAAD  76

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA++AI ++ +DAA H+LKA+AL++QG    AL A++ ALSP AAKSLS  ER +AL KR
Sbjct  77   EADRAIALEPRDAAHHILKALALDLQGRLLPALRALDTALSPPAAKSLSHRERGDALAKR  136

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKK--ELSEEARKSYEDAL  220
            AE+ LAV++  ++D A+ DL+E+V L  DN +   LLGECYE K   + EEAR +Y++A+
Sbjct  137  AEIHLAVNRRRRLDQALADLLEAVHLSPDNARAFSLLGECYELKGAGMEEEARTAYQNAI  196

Query  219  KIQPDYSAAQDALARLT  169
            +I    ++A++ L RL+
Sbjct  197  RIDASLASAREGLRRLS  213



>ref|XP_011468687.1| PREDICTED: uncharacterized protein LOC101313748 [Fragaria vesca 
subsp. vesca]
Length=255

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 129/197 (65%), Gaps = 7/197 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +H + +   +KL+   +A T+QA RHFVLG+Q L +AR+A   + S   + AK+A  
Sbjct  50   FYTIHKLSKKALTKLRTNNRA-TLQATRHFVLGSQLLTRARSAPHKTQSH--SHAKTALT  106

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAE A+ +  +D   H+LKA+AL++ G + +AL +++ ALSP   K L+  ER EAL KR
Sbjct  107  EAEIALSLSPRDPGPHILKALALDLLGHRAAALRSLDAALSPPCVKLLAERERGEALVKR  166

Query  393  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            AELKLAV++  ++DSAVEDL+E+V L   +GD     CLLG+CYE K + EEAR+++E A
Sbjct  167  AELKLAVNRRRRVDSAVEDLVEAVGLSEGEGDTT-AFCLLGQCYEWKNMREEAREAFERA  225

Query  222  LKIQPDYSAAQDALARL  172
            L++      A+  L RL
Sbjct  226  LRMDSGSVLARQGLDRL  242



>ref|XP_010671644.1| PREDICTED: uncharacterized protein LOC104888384 [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 126/205 (61%), Gaps = 22/205 (11%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
             +YL+ +NIPQ L++K    R     Q+RRHFV  A+ LA +    DLSS++        
Sbjct  19   LSYLWTNNIPQKLFTKYHTYRNRHKHQSRRHFVKAAEHLANS----DLSSAVSQA-----  69

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
                + AI +D  DAA H++K++ALE+QG+ TSALDA++VALSPLA  SL + ERA+A+ 
Sbjct  70   ----DAAILLDPTDAANHIIKSLALELQGYTTSALDALDVALSPLAIASLGVDERADAIA  125

Query  399  KRAELKLAVSKGEQIDSAVE---------DLIESVRLKGDNVKGLCLLGECYEKKELSEE  247
            KRA L++ VS+  +++S V+         +L E+V+++ ++ +  CLL EC       +E
Sbjct  126  KRAGLRMEVSRLGRVESGVDVEVWSAAERELREAVKVRRESGRAWCLLAECCLGLGKIDE  185

Query  246  ARKSYEDALKIQPDYSAAQDALARL  172
            AR ++E+A+++ PD   A   L RL
Sbjct  186  ARDAFEEAVRVAPDSVVASQGLDRL  210



>ref|XP_009364809.1| PREDICTED: uncharacterized protein LOC103954711 [Pyrus x bretschneideri]
Length=213

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 128/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +HN+ +N+ +KL+   +A  +Q+ RHFV G+  L +AR+    + S      K+A  
Sbjct  19   FFAIHNLSRNVLTKLRTNNRA-NLQSTRHFVHGSHLLTRARSTPHKAQSQAHA--KNALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAEKA+ +  +D   H+LKA++L++ G KTSAL +++VALSP   KSLS  ER +AL KR
Sbjct  76   EAEKALSLSPRDPGPHILKALSLDLLGHKTSALKSLDVALSPPCVKSLSEKERGDALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            AELKL +++  ++DSAVEDL+++V+L   +GD     CLLG+CYE K + +EA  ++E A
Sbjct  136  AELKLGLNRRRRVDSAVEDLVDAVKLGRAEGD-ATAFCLLGQCYEWKGMRDEAIDAFERA  194

Query  222  LKIQPDYSAAQDALARLTS  166
            L +      A+  L RL S
Sbjct  195  LTVDSGSDLARQGLDRLGS  213



>ref|XP_010523303.1| PREDICTED: uncharacterized protein LOC104801678 [Tarenaya hassleriana]
Length=225

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 128/197 (65%), Gaps = 13/197 (7%)
 Frame = -3

Query  735  IPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaekAI  556
            +P+   +  + + +A T+Q +R  +  ++ LA+ART  + S S+  +LAKSA  EA+ AI
Sbjct  29   LPKRTLANFRTKHRA-TVQTQRQLIQASRLLARARTTTNRSHSL--SLAKSALAEADDAI  85

Query  555  GIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLA  376
             +   DAA H+++A+AL++ G +TSAL + + AL+    KSLS  ERA+AL KRAE+KLA
Sbjct  86   SLSPDDAAAHIVRALALDLLGHRTSALKSFDSALTYPRVKSLSDGERADALVKRAEMKLA  145

Query  375  VSKGEQIDSAVEDLIESVRL---------KGDNVKGL-CLLGECYEKKELSEEARKSYED  226
            V++  +I SA+EDL E+V+L         +GDN   + C+LGECYE   L E+A  +Y+ 
Sbjct  146  VNRRRRIGSAIEDLEEAVKLADAAAGDGGRGDNTARMHCVLGECYEFMGLKEKAHWAYDK  205

Query  225  ALKIQPDYSAAQDALAR  175
            ALK QP  +AA+D L R
Sbjct  206  ALKAQPSSAAARDGLNR  222



>ref|XP_008338466.1| PREDICTED: uncharacterized protein LOC103401529 [Malus domestica]
Length=213

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +HN+ +N+ +KL+   +A  +Q+ RHFV G+  L +AR+    + S      K+A  
Sbjct  19   FFAIHNLSRNVLTKLRTNNRA-NLQSTRHFVHGSHLLTRARSTPHKAQSQAHA--KNALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAEKA+ +  +D   H+LKA++L++ G KTSAL +++ ALSP   KSLS  ER +AL KR
Sbjct  76   EAEKALSLSPRDPGPHILKALSLDLLGHKTSALKSLDAALSPPCVKSLSEKERGDALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEKKELSEEARKSYEDA  223
            AELKL +++  ++DSAVEDL+++V+L   +GD     CLLG+CYE K + +EA  ++E A
Sbjct  136  AELKLGLNRRRRVDSAVEDLVDAVKLGRAEGD-ATAFCLLGQCYEXKGMRDEAIDAFERA  194

Query  222  LKIQPDYSAAQDALARLTS  166
            L +      A   L RL S
Sbjct  195  LTVDSGSDLASQGLDRLGS  213



>ref|XP_010444514.1| PREDICTED: uncharacterized protein LOC104727183 [Camelina sativa]
Length=208

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 126/193 (65%), Gaps = 5/193 (3%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
             T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART    S S   +LAK+A
Sbjct  17   ITFWAIKYLSQRGLTKFRNKHRA-TLQTQRQLIQASRLLARARTTPKKSQSQ--SLAKTA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EA+  I I  +DAA H+++A+AL++ G  TSAL + + AL+    KSLS+ ERA+AL 
Sbjct  74   LSEADDVISISPEDAAGHIVRALALDLLGHHTSALKSFDTALTYPRLKSLSMGERADALV  133

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYED  226
            KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGECYE K L+E+A  ++ +
Sbjct  134  KRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGECYEFKGLNEKAHWAFNE  193

Query  225  ALKIQPDYSAAQD  187
            ALK+QP  + A+D
Sbjct  194  ALKVQPSSATARD  206



>ref|XP_010484348.1| PREDICTED: uncharacterized protein LOC104762704 [Camelina sativa]
Length=207

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 125/193 (65%), Gaps = 5/193 (3%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
             T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART    S S   +LAK+A
Sbjct  17   ITFWAIKYLSQRGLTKFRNKHRA-TLQTQRQLIQASRLLARARTTPKKSQSQ--SLAKTA  73

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
              EA+  I I   DAA H+++A+AL++ G  TSAL + + AL+    KSLS+ ERA+AL 
Sbjct  74   LSEADDVISISPDDAAGHIVRALALDLLGHHTSALKSFDTALTYPRLKSLSVGERADALV  133

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYED  226
            KRAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGECYE K L+E+A  ++ +
Sbjct  134  KRAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGECYEFKGLNEKAHWAFNE  193

Query  225  ALKIQPDYSAAQD  187
            ALK+QP  + A+D
Sbjct  194  ALKVQPSSATARD  206



>ref|XP_002533521.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28865.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 120/194 (62%), Gaps = 1/194 (1%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            ++ +   P+   +KL+ + +  ++QA RH +     L++A++    + S   TLA++A  
Sbjct  20   FIAIQYFPKQALTKLRAKNRT-SLQANRHLIQATHFLSKAKSIPHNNKSQSQTLARNALL  78

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAE AI +  +D A  +LKA+ L++ G K SAL ++++ALS    KSL   ER +AL KR
Sbjct  79   EAESAISLSPRDPAPLILKALVLDLLGHKGSALKSLDLALSSPRVKSLEGRERGDALVKR  138

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI  214
            AELK +V++  ++DSA+EDL E+V+L G++ +  CLLG+CYE K   +EAR +Y   LK 
Sbjct  139  AELKTSVNRRRRVDSAIEDLREAVKLSGESERVYCLLGQCYEWKGKKDEARWAYGQVLKA  198

Query  213  QPDYSAAQDALARL  172
             P    A + L RL
Sbjct  199  HPGSVLALEGLDRL  212



>ref|XP_007047767.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOX91924.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=216

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  + + P+   +K ++  +A T Q +RH       L++A++      S   TLAKSA  
Sbjct  19   FFAIRHFPKQALTKHRIDHRA-TTQTQRHLTRATHLLSRAKSNPHKDQSQ--TLAKSAIS  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            E EKA+ +  KD   H+LK++AL++ G K SAL ++++AL+   +KSL+  ER EA+ +R
Sbjct  76   EIEKALSLSPKDPTPHVLKSLALDLLGHKGSALRSLDLALTSPRSKSLAQRERVEAMVRR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLK----GDNVKGLCLLGECYEKKELSEEARKSYED  226
            AELKLAV+K  ++DSAV DL E++R+     G   +  CLLGECYE K + EEA+K++E+
Sbjct  136  AELKLAVNKRRRVDSAVTDLEEAIRVSEEEGGVKTRAFCLLGECYELKGMREEAKKAFEE  195

Query  225  ALKIQPDYSAAQDALARLT  169
            AL ++   S A+ +L RL+
Sbjct  196  ALNMERGSSVARQSLERLS  214



>ref|NP_001147153.1| TPR domain containing protein [Zea mays]
 gb|ACG25713.1| TPR domain containing protein [Zea mays]
 gb|AFW70649.1| TPR domain containing protein [Zea mays]
Length=232

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 111/170 (65%), Gaps = 3/170 (2%)
 Frame = -3

Query  681  QARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaekAIGIdakdaalhllkamaLE  502
            Q+RRHF  GAQ LA+AR     +      LA++A  EA++AI +D +DAA  +LKA+AL+
Sbjct  56   QSRRHFAQGAQLLARARA---TAPKPPGPLARAAVAEADRAIALDPRDAAPLILKALALD  112

Query  501  VQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSKGEQIDSAVEDLIESV  322
            +QG +  AL A++ AL+P  A+SL   ER +AL KRAE+ LA+ +  ++D A  DL E+V
Sbjct  113  LQGHRLPALRALDGALAPPLARSLEPRERGDALAKRAEIALALHRRRRLDQAAVDLAEAV  172

Query  321  RLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALARL  172
            RL  +N +   LLGECYEKK L+ EAR++++ A  I P    A D L RL
Sbjct  173  RLSPENARAHALLGECYEKKGLAAEAREAFKTAASIDPKLGVALDGLRRL  222



>ref|XP_002866676.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42935.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART    S S   +LAK+A  
Sbjct  20   FWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARTTPKKSQSQ--SLAKTALT  76

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+  I I   DAA H+++A+AL++ G  TSAL + ++AL+    KSLS+ ERA+AL KR
Sbjct  77   EADNVISISPDDAAGHIVRALALDLLGHHTSALKSFDMALTYPRLKSLSVGERADALVKR  136

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            AE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGECYE K LSE+A  ++ +AL
Sbjct  137  AEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGECYEFKGLSEKAHWAFNEAL  196

Query  219  KIQP  208
            K QP
Sbjct  197  KAQP  200



>ref|NP_201355.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAA98171.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43609.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64052.1| unknown protein [Arabidopsis thaliana]
 gb|AED98066.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=206

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART    S S   +LAK+A  
Sbjct  20   FWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARTTPKKSQSQ--SLAKTALT  76

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+  I I   DAA H+++A+AL++ G  TSAL + ++AL+    KSLS+ ERA+AL KR
Sbjct  77   EADNVIAISPDDAAGHIVRALALDLLGHHTSALKSFDMALTYPRLKSLSVGERADALVKR  136

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            AE+KLAV++  +IDSAVEDL E+VRL    D  +   LLGECYE K L E+A+ ++ +AL
Sbjct  137  AEMKLAVNRRRRIDSAVEDLEEAVRLAAGTDTARLFRLLGECYEFKGLKEKAQWAFNEAL  196

Query  219  KIQP  208
            K QP
Sbjct  197  KAQP  200



>ref|XP_007156466.1| hypothetical protein PHAVU_003G288400g [Phaseolus vulgaris]
 gb|ESW28460.1| hypothetical protein PHAVU_003G288400g [Phaseolus vulgaris]
Length=219

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 124/201 (62%), Gaps = 11/201 (5%)
 Frame = -3

Query  753  YLFMHNI---PQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaks  583
            +  MH I        ++   R + R  +  RH    ++ LA+AR     S+S R   AKS
Sbjct  19   FFIMHTIRTQTAQARTRNPARNKNRQSEPNRHLTQASRHLARAR-----STSHRALHAKS  73

Query  582  aeeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEAL  403
            A  E +KA+ I  +D   H+L+A +L++ G +T+A+ +++ ALS  AA+SLS  ERA+AL
Sbjct  74   ALTETDKALSIWPRDPWAHILRAQSLDLMGHRTAAIKSLDTALSSPAARSLSAVERADAL  133

Query  402  HKRAELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEKKELSEEARKSY  232
             +RAE+K+ V++  +++SA+EDL+ +V L   KGD  + +CLLG+CYE K + EEA+ ++
Sbjct  134  VRRAEMKVGVNRRRRVESAMEDLVAAVELDGRKGDEWEVMCLLGKCYEWKGMKEEAKDTF  193

Query  231  EDALKIQPDYSAAQDALARLT  169
            +  L++ P    A++ L RL+
Sbjct  194  QKVLQLHPRSEEARNGLHRLS  214



>ref|XP_007205948.1| hypothetical protein PRUPE_ppa011845mg [Prunus persica]
 gb|EMJ07147.1| hypothetical protein PRUPE_ppa011845mg [Prunus persica]
Length=193

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 110/166 (66%), Gaps = 6/166 (4%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +H I +   +KL+   +A  +Q+ RHFV G+  L +AR+    + S      K+A  
Sbjct  19   FFAIHKISRKALTKLRTNNRA-NLQSTRHFVQGSHLLTRARSNPHKAQSQAHA--KNALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EAEKA+ +  +D   H+LKA+AL++ G KTSAL + +VALSP   KSLS  ER EAL KR
Sbjct  76   EAEKALALSPRDPGPHILKALALDLLGHKTSALKSFDVALSPPCVKSLSERERGEALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRL---KGDNVKGLCLLGECYEK  265
            AELK+ +++  ++DSAVEDL+++VRL   +GD+V   CLLG+CYEK
Sbjct  136  AELKIGLNRRRRVDSAVEDLVQAVRLSRGEGDDVTSFCLLGQCYEK  181



>ref|XP_006279866.1| hypothetical protein CARUB_v10028558mg [Capsella rubella]
 gb|EOA12764.1| hypothetical protein CARUB_v10028558mg [Capsella rubella]
Length=699

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 125/193 (65%), Gaps = 5/193 (3%)
 Frame = -3

Query  756  TYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR+    S S   +LAK+A 
Sbjct  510  TFWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARSTPKKSQSQ--SLAKTAL  566

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
             EA+  I +   DAA H+++A+AL++ G  TSAL + + AL+    KSLS+ ERA+AL K
Sbjct  567  TEADDVISLSPDDAAGHIVRALALDLLGHHTSALKSFDTALTYPRLKSLSVGERADALVK  626

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDA  223
            RAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGECYE K L+E+A  ++ +A
Sbjct  627  RAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGECYEFKGLNEKAHWAFNEA  686

Query  222  LKIQPDYSAAQDA  184
            LK+QP  + A++ 
Sbjct  687  LKVQPSSTTAREG  699



>gb|KJB40331.1| hypothetical protein B456_007G058400 [Gossypium raimondii]
Length=286

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 123/195 (63%), Gaps = 7/195 (4%)
 Frame = -3

Query  744  MHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeae  565
            +  +P+   +K +   +A T Q +RH     Q L +A++      S   TLAK+A  E E
Sbjct  22   IQYVPKQTLTKHRTDHRA-TTQTQRHLSRATQLLCRAKSNPQKDQSQ--TLAKTAITEIE  78

Query  564  kAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAEL  385
            KA+ +  KD   H+LK++AL++ G K SAL ++++AL+    KSLS  ER EAL +RAEL
Sbjct  79   KALSLFPKDPTPHILKSLALDLLGHKGSALRSLDLALAFPRVKSLSEKERVEALVRRAEL  138

Query  384  KLAVSKGEQIDSAVEDLIESVRL---KGDN-VKGLCLLGECYEKKELSEEARKSYEDALK  217
            KLAV+K  ++DSAV DL E+V++   +G+   K  CLLG CYE K + EE+RK++ +ALK
Sbjct  139  KLAVNKRRRVDSAVSDLEEAVKVSDKEGETKTKAFCLLGVCYELKGMREESRKAFVEALK  198

Query  216  IQPDYSAAQDALARL  172
            ++P  + A+  L RL
Sbjct  199  LEPASTLARQGLERL  213



>ref|XP_010462984.1| PREDICTED: uncharacterized protein LOC104743621 [Camelina sativa]
Length=205

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 121/188 (64%), Gaps = 5/188 (3%)
 Frame = -3

Query  756  TYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART    S S   +LAK+A 
Sbjct  18   TFWAIKYLSQRGLTKFRNKHRA-TLQTQRQLIQASRLLARARTTPKKSQSQ--SLAKTAL  74

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
             EA+  I I   DAA H+++A+AL++ G  TSAL + + AL+    KSLS+ ERA+AL K
Sbjct  75   SEADDVISISPDDAAGHIVRALALDLLGHHTSALKSFDTALTYPRLKSLSVGERADALVK  134

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDA  223
            RAE+KLAV++  +IDSA+EDL E+VRL    D  +   LLGECYE K L+E+A  ++ ++
Sbjct  135  RAEMKLAVNRRRRIDSAIEDLEEAVRLAAGTDTARLFRLLGECYEFKGLNEKAHWAFNES  194

Query  222  LKIQPDYS  199
            LK+   +S
Sbjct  195  LKVATKFS  202



>dbj|BAK01291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = -3

Query  504  EVQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSKGEQIDSAVEDLIES  325
            ++QG +  AL  ++VAL P  A+SL   ER +AL KRAE+ LA+++  ++D A  DL E+
Sbjct  110  DLQGHRLPALRTLDVALGPPLARSLEPRERGDALAKRAEIALALNRRRRLDQAAADLTEA  169

Query  324  VRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALAR  175
            VRL  +N +   LLGECYE+K L+ EAR S++ A  I P  + A+D L R
Sbjct  170  VRLSPENPRAHALLGECYERKGLTAEARNSFKTAASIDPSLATARDGLRR  219



>ref|XP_007227059.1| hypothetical protein PRUPE_ppa020513mg, partial [Prunus persica]
 gb|EMJ28258.1| hypothetical protein PRUPE_ppa020513mg, partial [Prunus persica]
Length=174

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -3

Query  756  TYLFMHNIPQNLYSKLQMR-RQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksa  580
             +L +HNIPQ L + L+ R R     QA+RHFVLGAQ LAQAR+A   S S   +L+K A
Sbjct  21   AFLTIHNIPQKLLANLRFRFRNKPKAQAKRHFVLGAQLLAQARSAA--SPSSASSLSKQA  78

Query  579  eeeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALH  400
             +EAEKAI +D KDAA H+LKA+AL+ QG+KTSALDA++VALSP AAKSL+  ER +AL 
Sbjct  79   LDEAEKAISLDPKDAAAHILKALALDSQGYKTSALDAIDVALSPFAAKSLTEEERGDALV  138

Query  399  KRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGL  292
            KRAE++L++++  Q+DS + DLI +V L  +NVK  
Sbjct  139  KRAEIRLSMNRRGQVDSVIADLIRAVELSPENVKAF  174



>gb|ABK23813.1| unknown [Picea sitchensis]
Length=220

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 129/194 (66%), Gaps = 5/194 (3%)
 Frame = -3

Query  744  MHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeae  565
            +  +P++L SKL+ R ++R  Q+RRHFV GAQ L ++R A   +S    +LA+ A  EA+
Sbjct  30   LQGLPRSLISKLRRRSRSRE-QSRRHFVRGAQLLGRSRAASAQNSGR--SLAREAAAEAD  86

Query  564  kAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAEL  385
            KAI +D  DAA H+LKA+ALE QG  T+A+  ++ AL+P  +KSLS PE+++ L KRAEL
Sbjct  87   KAIALDPMDAASHILKALALERQGHATAAIGCLDAALAPPVSKSLSAPEKSDGLLKRAEL  146

Query  384  KLAVSKGEQ--IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQ  211
            +L  S  ++  +++AV+DL  SV     N K LCLLG CYEKK +  EARK ++DAL+  
Sbjct  147  ELETSNSKRRGLEAAVDDLKASVGFNARNFKALCLLGTCYEKKGMLVEARKVFQDALEAN  206

Query  210  PDYSAAQDALARLT  169
            P    A+  L RL+
Sbjct  207  PSSQEAKAGLDRLS  220



>gb|ABK26430.1| unknown [Picea sitchensis]
Length=220

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 129/194 (66%), Gaps = 5/194 (3%)
 Frame = -3

Query  744  MHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeae  565
            +  +P++L SKL+ R ++R  Q+RRHFV GAQ L ++R A   +S    +LA+ A  EA+
Sbjct  30   LQGLPRSLISKLRRRSRSRE-QSRRHFVRGAQLLGRSRAATAQNSGR--SLAREAAAEAD  86

Query  564  kAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAEL  385
            KAI +D  DAA H+LKA+ALE QG  T+A+  ++ AL+P  +KSLS PE+++ L KRAEL
Sbjct  87   KAIALDPMDAASHILKALALERQGHATAAIGCLDAALAPPVSKSLSAPEKSDGLLKRAEL  146

Query  384  KLAVSKGEQ--IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQ  211
            +L  S  ++  +++AV+DL  SV     N K LCLLG CYEKK +  EARK ++DAL+  
Sbjct  147  ELETSNSKRRGLEAAVDDLKASVGFNARNFKALCLLGTCYEKKGMLVEARKVFQDALEAN  206

Query  210  PDYSAAQDALARLT  169
            P    A+  L RL+
Sbjct  207  PSSQEAKAGLDRLS  220



>gb|KEH20108.1| TPR domain protein [Medicago truncatula]
Length=216

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 111/190 (58%), Gaps = 9/190 (5%)
 Frame = -3

Query  729  QNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaekAIGI  550
            Q  ++K + R +    +  RH       L +AR+  + S   + +L ++ +      + I
Sbjct  30   QKTHNKTRTRNKTHQPEPTRHLNQALHHLNRARSTTNRSQHAKNSLFEANQA-----LSI  84

Query  549  dakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVS  370
              +D ++H+L+A AL +   +T+A+ +++ A S  +AK LS  ERA+AL  RAE+KL V+
Sbjct  85   SPRDPSIHILRAKALHLMNHRTAAIKSLDTAFSLPSAKMLSSEERADALVFRAEMKLEVN  144

Query  369  KGEQIDSAVEDLIESVRLKG----DNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDY  202
            +  +++SA+ED++E++ L G    +N++ LCLLG+CYE K + EEA+  ++  L  +PD 
Sbjct  145  RRRRVESAMEDIVEAIGLSGGEECENLEALCLLGKCYEWKGMREEAKNVFQKVLDFEPDS  204

Query  201  SAAQDALARL  172
              A   L RL
Sbjct  205  VEALGGLKRL  214



>ref|XP_004509789.1| PREDICTED: uncharacterized protein LOC101502186 [Cicer arietinum]
Length=215

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 117/199 (59%), Gaps = 10/199 (5%)
 Frame = -3

Query  753  YLFMHNI-PQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            +  MH    Q + SK + R + R  +  RH    ++ L +AR+    +   +  L+++ +
Sbjct  20   FFLMHTFRNQTIQSKTRTRNKTRQPEQNRHLNQASRHLNRARSTAHKAQHTKNALSEANQ  79

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
                  + I  KD ++H+L+A AL + G + +A+ +++ ALS  AAK L+  ERA+AL  
Sbjct  80   A-----LSITPKDPSVHILRARALYIAGHRATAIRSLDSALSLPAAKFLNPTERADALVF  134

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKGDN----VKGLCLLGECYEKKELSEEARKSYE  229
            RAE+KLAV++  ++DSA+EDL+E++ + G+      + +CLL +CYE K + EEA+ ++ 
Sbjct  135  RAEMKLAVNRRRRVDSAIEDLVEAIGVSGEGSESKSEAMCLLAKCYEWKGMIEEAKNAFL  194

Query  228  DALKIQPDYSAAQDALARL  172
              + + PD   A++ L RL
Sbjct  195  KVVDVDPDSIEARNGLNRL  213



>ref|XP_003530607.1| PREDICTED: uncharacterized protein LOC100813867 [Glycine max]
Length=213

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (71%), Gaps = 2/85 (2%)
 Frame = -3

Query  420  ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEE  247
            ER  AL +RAELK+A+++  ++DSAV+DL+E+V L G  D    LCLLG+CYE K + EE
Sbjct  126  ERVRALVERAELKVAMNQRRRVDSAVKDLVEAVGLSGGSDLEDALCLLGKCYEWKGMKEE  185

Query  246  ARKSYEDALKIQPDYSAAQDALARL  172
            A+ +++  L++QPD   A+  L RL
Sbjct  186  AKDAFQKVLEVQPDSEEARSGLERL  210



>ref|XP_003571513.1| PREDICTED: uncharacterized protein LOC100820913 [Brachypodium 
distachyon]
Length=230

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = -3

Query  504  EVQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSKGEQIDSAVEDLIES  325
            ++QG +  AL  +++AL+PL A+SL   ER +AL KRAE+ LA+++  ++D A  DL E+
Sbjct  110  DLQGHRLPALRTLDLALAPLLARSLEPRERGDALAKRAEIALALNRRRRVDQAAADLAEA  169

Query  324  VRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALAR  175
            VRL  +N +   LLGECYE+K L+ EARKS++ A  I P     +D L R
Sbjct  170  VRLSPENPRAHALLGECYERKGLAAEARKSFKTAASIDPTLPIVRDGLRR  219



>ref|XP_002453513.1| hypothetical protein SORBIDRAFT_04g007120 [Sorghum bicolor]
 gb|EES06489.1| hypothetical protein SORBIDRAFT_04g007120 [Sorghum bicolor]
Length=233

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  420  ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR  241
            ER +AL KRAE+ LA+ +  ++D A  DL E+VRL  +N +   LLGECYEKK L+ EAR
Sbjct  141  ERGDALAKRAEIALALHRRRRLDQAAADLAETVRLSPENARAHALLGECYEKKGLAAEAR  200

Query  240  KSYEDALKIQPDYSAAQDALARL  172
            ++++ A  I P   AA D L RL
Sbjct  201  EAFKTAASIDPKLGAALDGLRRL  223



>gb|ACN40942.1| unknown [Picea sitchensis]
Length=198

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = -3

Query  504  EVQGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSKG--EQIDSAVEDLI  331
            E QG   SAL ++N ALS    KSLSL E+AEAL KRA++ LA S G   +++ A+ DL 
Sbjct  86   ERQGHVGSALRSLNTALSLPVVKSLSLSEKAEALVKRADVVLAGSPGGKRRLEVALGDLH  145

Query  330  ESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALARL  172
             S+ +  DN K   LLG CYE+K L  EAR+++E AL+I P Y  A  A +RL
Sbjct  146  ASLAINPDNAKAYYLLGRCYERKGLKAEARQAFEAALQIDPSYRDANQAFSRL  198



>gb|KFK28222.1| hypothetical protein AALP_AA8G488400 [Arabis alpina]
Length=207

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 117/190 (62%), Gaps = 5/190 (3%)
 Frame = -3

Query  750  LFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeee  571
            L +  I Q   +K + + +A T+Q +R  +   + +A+AR     S S   +LAKSA  E
Sbjct  20   LAVKKIAQKRLTKYRTKHRA-TLQTQRQLIQATRLIARARATPKKSQSQ--SLAKSALLE  76

Query  570  aekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRA  391
            A+  I I   DAA H+++A+AL++ G +T+AL A + AL+    KSL + ERA+AL KRA
Sbjct  77   ADDVIAISPDDAAGHIVRALALDLLGHQTAALKAFDTALTYPRLKSLEVGERADALVKRA  136

Query  390  ELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDALK  217
            E+KLAV++  +IDSA+EDL E+ RL    D  +   LLGECYE K L E+A+ ++ + +K
Sbjct  137  EMKLAVNRRRRIDSAIEDLEEAARLAAGTDTARIFRLLGECYEFKGLEEKAQWAFNEGVK  196

Query  216  IQPDYSAAQD  187
             Q   +  +D
Sbjct  197  AQRSSAMPRD  206



>ref|XP_006394020.1| hypothetical protein EUTSA_v10005489mg, partial [Eutrema salsugineum]
 gb|ESQ31306.1| hypothetical protein EUTSA_v10005489mg, partial [Eutrema salsugineum]
Length=199

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 116/184 (63%), Gaps = 5/184 (3%)
 Frame = -3

Query  756  TYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
            T+  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART    S S   +LAK+A 
Sbjct  18   TFWAIKYLSQQGITKFRTKHRA-TLQTQRQLIQASRLLARARTTNKKSQSQ--SLAKTAL  74

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
             EA+  I +   DAA ++++A+AL++ G   +AL + + AL+    KSLS+ ERA+AL K
Sbjct  75   TEADDVISLSPYDAAGYIVRALALDLLGHHAAALKSFDTALTYPQLKSLSVGERADALVK  134

Query  396  RAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDA  223
            RAE+KLAV++  + DSA+EDL E++RL    D  +   LLGECYE K   E+A+ ++ +A
Sbjct  135  RAEMKLAVNRRRRNDSAIEDLEEAIRLAAGTDTARIFRLLGECYEYKGFKEKAQWAFNEA  194

Query  222  LKIQ  211
            LK Q
Sbjct  195  LKAQ  198



>ref|XP_006852913.1| hypothetical protein AMTR_s00033p00228810 [Amborella trichopoda]
 gb|ERN14380.1| hypothetical protein AMTR_s00033p00228810 [Amborella trichopoda]
Length=215

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 131/194 (68%), Gaps = 6/194 (3%)
 Frame = -3

Query  741  HNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaeeeaek  562
            +N P  + + L+ R ++ + QA+RHF+ GAQ LAQAR+A     S+  +LA+S+  +A++
Sbjct  25   YNFPARVLAPLRARGRS-SAQAKRHFIQGAQLLAQARSAPSKKDSL--SLARSSLNQADQ  81

Query  561  AIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKRAELK  382
            A+ +D KDAA H+LKA+ L++ G    AL +++ ALSP A KSL+  ERA+AL KRAE++
Sbjct  82   ALTLDPKDAAAHILKALGLQLLGQLPQALASLDNALSPPALKSLAKSERADALFKRAEIR  141

Query  381  LAVSKGEQ--IDSAVEDLIESVRLKG-DNVKGLCLLGECYEKKELSEEARKSYEDALKIQ  211
            L +    +   + A+ DL+  + +K  +N +  C+LG+CY +KE+ +EA+K++E+AL+++
Sbjct  142  LKMEPKSRHRAELAMADLLAGITMKELENSRVFCMLGDCYLRKEMVDEAKKAFENALRLE  201

Query  210  PDYSAAQDALARLT  169
            P    A+  LA ++
Sbjct  202  PSSEEAKAGLASIS  215



>ref|XP_006648441.1| PREDICTED: uncharacterized protein LOC102700687 [Oryza brachyantha]
Length=124

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  405  LHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYED  226
            L KRAE+ LA+++  ++D A  DL E+VRL   N +   LLGECYE+K L+ EAR +++ 
Sbjct  37   LAKRAEIALALNRRRRLDQAAADLAEAVRLSPQNARAHSLLGECYERKGLAAEARDAFKT  96

Query  225  ALKIQPDYSAAQDALAR  175
            A  I P  + A+DAL R
Sbjct  97   AASIDPSLATARDALHR  113



>emb|CDY54712.1| BnaA09g52440D [Brassica napus]
Length=197

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR     S S   +LAK+A  
Sbjct  19   FWALKYLSQQGLTKFRSKHRA-TLQTQRQLIQASRLLARARATTKKSQSQ--SLAKTALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+  I +   DAA H+++A++L++ G  T+AL + + AL+    KSLS  ERA+AL KR
Sbjct  76   EADDVIALSPDDAAGHIVRALSLDLLGHHTAALKSFDTALTYPRLKSLSAGERADALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            AE+K+AV++  + DSA+EDL E+VRL    D  +   LLGECYE K L E+A+ ++ +AL
Sbjct  136  AEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGECYEYKGLGEKAQWAFSEAL  195

Query  219  K  217
            K
Sbjct  196  K  196



>ref|XP_009112189.1| PREDICTED: uncharacterized protein LOC103837585 [Brassica rapa]
Length=197

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR     S S   +LAK+A  
Sbjct  19   FWALKYLSQQGLTKFRSKHRA-TLQTQRQLIQASRLLARARATTKKSQSQ--SLAKTALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+  I +   DAA H+++A++L++ G  T+AL + + AL+    KSLS  ERA+AL KR
Sbjct  76   EADDVIALSPDDAAGHIVRALSLDLLGHHTAALKSFDTALTYPRLKSLSAGERADALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            AE+K+AV++  + DSA+EDL E+VRL    D  +   LLGECYE K L E+A+ ++ +AL
Sbjct  136  AEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGECYEYKGLGEKAQWAFSEAL  195

Query  219  K  217
            K
Sbjct  196  K  196



>gb|KHN08984.1| hypothetical protein glysoja_021806 [Glycine soja]
Length=171

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -3

Query  360  QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL  181
            ++DS + DL ESV+L   N K  C+LGE YE  ++ EEA+K+Y++AL+++P  + AQ+AL
Sbjct  106  RVDSVLADLTESVKLSPRNAKAWCMLGETYEGNKMGEEAKKAYKEALELEPQLNVAQEAL  165

Query  180  ARLTS  166
            +RL S
Sbjct  166  SRLGS  170


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRR-QARTIQARRHFVLGAQRLAQARTAKDLSSSMRM  598
            F++L+MH IPQNLY+KL+ R    R +QA+RHFV GAQ LAQAR +K  SS+  +
Sbjct  25   FSFLWMHGIPQNLYAKLRHRPPNPRAVQAKRHFVKGAQLLAQARRSKSASSATSL  79



>ref|XP_004951519.1| PREDICTED: uncharacterized protein LOC101758681 [Setaria italica]
Length=233

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  420  ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR  241
            ER +AL KRAE+ LA+ +  ++D A  DL E+VRL  +N +   +LGECYE+K  + +AR
Sbjct  141  ERGDALAKRAEIALALHRRRRLDQAAADLAEAVRLSPENARAHAMLGECYERKGQAAQAR  200

Query  240  KSYEDALKIQPDYSAAQDALARL  172
             +++ A  I P  +AA D L R+
Sbjct  201  DAFKTAASIDPKLTAALDGLRRV  223



>gb|EPS67993.1| hypothetical protein M569_06781, partial [Genlisea aurea]
Length=193

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 121/181 (67%), Gaps = 4/181 (2%)
 Frame = -3

Query  756  TYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksae  577
             + F+H++P+   S L+ + +   + A RHFV GA  L++AR++   S++ +  LAKSA 
Sbjct  16   VFYFLHSVPRRTLSSLRSKSRPSNL-ADRHFVQGAALLSRARSSGSRSAANK--LAKSAA  72

Query  576  eeaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHK  397
             EA+KA+ ++ +D A H+LKAMAL + G K+SAL +++ ALS  A K LS  E+ +AL K
Sbjct  73   GEADKALALEPRDPAAHILKAMALSLMGHKSSALKSLDSALSLPAVKRLSEQEKGDALVK  132

Query  396  RAELKLAVSKGEQI-DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
            RAE++L V++  ++ D A++DL E+ RL  DN +   LLG+C+E K+   EA +++E AL
Sbjct  133  RAEIQLEVNRRRRVVDGAIDDLREATRLNPDNARAFFLLGQCHEIKDSKAEAVQAFEKAL  192

Query  219  K  217
            +
Sbjct  193  E  193



>ref|XP_010089040.1| Oligopeptidase A [Morus notabilis]
 gb|EXB37276.1| Oligopeptidase A [Morus notabilis]
Length=253

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -3

Query  381  LAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDY  202
            +A+ +  +++SA+ DL  +V L  +N +  CLL ECYE K++  E RK+YEDAL+I+P+ 
Sbjct  1    MAMGRRGKVESAIGDLDRAVELSPENARAFCLLEECYEAKKMEAEVRKAYEDALRIEPEL  60

Query  201  SAAQDALARLTS  166
            + A++AL RL S
Sbjct  61   ALAREALDRLVS  72



>emb|CDX81290.1| BnaC09g07010D [Brassica napus]
Length=194

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = -3

Query  753  YLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKDLSSSMRMTLaksaee  574
            +  +  + Q   +K + + +A T+Q +R  +  ++ LA+AR     S S   +LAK+A  
Sbjct  19   FWALKYLSQQGLTKFRSKHRA-TLQTQRQLIQASRLLARARATTKKSQSQ--SLAKTALT  75

Query  573  eaekAIGIdakdaalhllkamaLEVQGFKTSALDAMNValsplaakslslPERAEALHKR  394
            EA+  I I   DAA H+++A+AL++ G  T+AL + + AL+    KSLS+ ERA+AL KR
Sbjct  76   EADDVIAISPDDAAGHIVRALALDLLGHHTAALKSFDTALTYPRLKSLSVGERADALVKR  135

Query  393  AELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYEKKELSEEAR  241
            AE+K+AV++  + DSA+EDL E+VRL    D  +   LLGECYE K L+E+A+
Sbjct  136  AEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGECYEYKGLNEKAQ  188



>gb|EEC72705.1| hypothetical protein OsI_06297 [Oryza sativa Indica Group]
Length=215

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -3

Query  420  ERAEALHKRAELKLAVSKGEQI--DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE  247
            ER +AL KRAE+ LA+ +  +   D A +DL E+VRL   N +   LLGECYE+K ++ E
Sbjct  119  ERGDALAKRAEIALALHRRHRRRLDQAADDLAEAVRLSPQNARAHALLGECYERKGMAAE  178

Query  246  ARKSYEDALKIQPDYSAAQDALAR  175
            A  +++ A  I P  +AA+DAL R
Sbjct  179  ALDAFKTAASIDPSLAAARDALRR  202



>ref|NP_001046241.1| Os02g0204000 [Oryza sativa Japonica Group]
 dbj|BAD16003.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08155.1| Os02g0204000 [Oryza sativa Japonica Group]
Length=242

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = -3

Query  420  ERAEALHKRAELKLAVSKGEQI--DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE  247
            ER +AL KRAE+ LA+ +  +   D A +DL E+VRL   N +   LLGECYE+K ++ E
Sbjct  146  ERGDALAKRAEIALALHRRHRRRLDQAADDLAEAVRLSPQNARAHALLGECYERKGMAAE  205

Query  246  ARKSYEDALKIQPDYSAAQDALAR  175
            A  +++ A  I P  +AA+DAL R
Sbjct  206  ALDAFKTAASIDPSLAAARDALRR  229



>gb|ABK93348.1| unknown [Populus trichocarpa]
Length=93

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -3

Query  759  FTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAKD  619
            F +L MHNIPQ   SKL+ R +   +QA+RHFVLGAQ +AQAR+  +
Sbjct  17   FMFLAMHNIPQKFLSKLRYRNRT-DLQAKRHFVLGAQLIAQARSPSN  62



>gb|KIJ83146.1| hypothetical protein SD80_16210 [Scytonema tolypothrichoides 
VB-61278]
Length=180

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E++++K D V  L  LG  YE+K+L+ +A ++YEDALKIQP+ + A+  
Sbjct  111  EQYDIAIRQYKEALKIKPDYVVALNNLGHAYERKKLNAQALQAYEDALKIQPNNATAKRR  170

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  171  LESLRRLVS  179



>ref|WP_012411236.1| hypothetical protein [Nostoc punctiforme]
 gb|ACC83280.1| TPR repeat-containing protein [Nostoc punctiforme PCC 73102]
Length=174

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++ K D V GL  LG  YEKK+L+ +A +SYE+ALK  P+ S A+  
Sbjct  105  EQYDLAIRQYKEALKSKPDYVTGLNNLGHAYEKKKLTTQALQSYEEALKFDPNNSIAKRR  164

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  165  AESLRRLVS  173



>gb|KIE08373.1| TPR repeat-containing photosystem I assembly protein Ycf37 [Tolypothrix 
bouteillei VB521301]
Length=174

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E++R+K D V     LG  YE+K+L+ +A ++YE+ALKI P+ + A+  
Sbjct  105  EQYDLAIRQYKEALRVKPDYVTAFNNLGHSYERKKLNSQALEAYENALKINPNNATAKRR  164

Query  189  -DALARLTS  166
             D+L RL +
Sbjct  165  ADSLRRLVA  173



>ref|WP_041034696.1| hypothetical protein [Tolypothrix campylonemoides]
 gb|KIJ77239.1| hypothetical protein SD81_10845 [Tolypothrix campylonemoides 
VB511288]
Length=174

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++ K D V  L  LG  YE+K+L+ +A ++YE+ALK+QP  + A+  
Sbjct  105  EQYDLAIRHYKEALKSKPDYVTALNNLGHAYERKKLNAQALEAYEEALKVQPTNTTAKRR  164

Query  189  -DALARLTS  166
             D+L RL S
Sbjct  165  SDSLRRLVS  173



>ref|WP_015130795.1| hypothetical protein [Calothrix sp. PCC 7507]
 gb|AFY34998.1| Tetratricopeptide TPR_1 repeat-containing protein [Calothrix 
sp. PCC 7507]
Length=174

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++ K D V  L  LG  YE+K+L+ +A +SYE+ LK QP+ + A+  
Sbjct  105  EQYDLAIRQYKEAIKYKPDYVTALNNLGHAYERKKLTVQALQSYEEVLKFQPNNTTAKRR  164

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  165  AESLRRLVS  173



>ref|WP_025270070.1| hypothetical protein [Hippea sp. KM1]
Length=206

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -3

Query  381  LAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDY  202
            +A  + ++   A++   ++V+L    ++G   LGE YE   L E ARK Y++ALKI P  
Sbjct  120  IAFLRKKRFHQAIKYFQKAVKLNPWKLEGYLYLGEVYEAISLKESARKFYQEALKIDPSS  179

Query  201  SAAQDALARLTS*SL  157
              AQ+AL RL+S S+
Sbjct  180  KKAQEALDRLSSNSV  194



>ref|XP_010030464.1| PREDICTED: uncharacterized protein LOC104420296 [Eucalyptus grandis]
Length=227

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 8/118 (7%)
 Frame = -3

Query  495  GFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSKGEQID--------SAVE  340
            G ++SAL +++ ALS   A+SLS  ERAEAL +RAELK+ ++ G +          SAVE
Sbjct  108  GRRSSALRSLDAALSAPRARSLSGSERAEALARRAELKMGMAGGGERRRGRRRRAESAVE  167

Query  339  DLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALARLTS  166
            D  E+VR+         +LGEC E++ L+ EA  ++E+AL+I+P    A+  L RL S
Sbjct  168  DAREAVRVGPGEAAAWRVLGECCEREGLAAEAAAAFEEALRIEPGCDPARRGLDRLGS  225



>ref|WP_017651780.1| photosystem I assembly protein [Microchaete sp. PCC 7126]
Length=174

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++ + D V  L  LG  YE+K+L+ +A ++YE+ALK QP+ + A+  
Sbjct  105  EQYDLAIRQYKEAIKNQPDYVTALNNLGHAYERKKLTTQALQTYEEALKYQPNNATAKRR  164

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  165  AESLRRLVS  173



>ref|XP_008382429.1| PREDICTED: uncharacterized protein LOC103445188 [Malus domestica]
Length=132

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -3

Query  498  QGFKTSALDAMNValsplaakslslPERAEALHKRAELKLAVSKGEQIDSAVEDLIESVR  319
            +GFKTS LDA+++   P   KSL+  +R +AL KR  +KL++++  ++DS +EDL     
Sbjct  25   KGFKTSTLDAIDITXXPXYRKSLTKEDRGDALVKRXXMKLSMNRKARVDSVIEDLNSGC-  83

Query  318  LKGDNVKGLCLLGECYEKKELSEEARKSYEDAL  220
              G   +  C +   YE K+++++ARK+ E  L
Sbjct  84   --GAESREWCFVR--YESKKMTKKARKTPECGL  112



>ref|WP_015140712.1| hypothetical protein [Nostoc sp. PCC 7524]
 gb|AFY50302.1| tetratricopeptide repeat protein [Nostoc sp. PCC 7524]
Length=174

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++LK D V  L  LG  YE+K+L+ +A + YE+ALK QP+ + A+  
Sbjct  105  EQYDLAIRQYKEALKLKPDYVVALNNLGHAYERKKLNAQALQMYEEALKFQPNNTTAKRR  164

Query  189  -DALARLTS  166
             ++L RL +
Sbjct  165  AESLRRLVT  173



>ref|WP_017316228.1| photosystem I assembly protein [Mastigocladopsis repens]
Length=174

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++ K D V     LG  YE+K+L+ +A ++YE+ALK+QP+ + A+  
Sbjct  105  EQFDLAIRQYKEALKNKPDYVTAFNNLGHAYERKKLNAQALEAYEEALKLQPNNTTAKRR  164

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  165  SESLRRLVS  173



>ref|WP_017741839.1| photosystem I assembly protein [Scytonema hofmanni]
Length=174

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E++R+K D V     LG  YE+K+L+ +A ++YE+A+KI P+   A+  
Sbjct  105  EQYDLAIRQYKEALRIKPDYVTAFNNLGHSYERKKLNAQALEAYENAIKINPNNPTAKRR  164

Query  189  -DALARLTS  166
             ++L RL +
Sbjct  165  AESLRRLVN  173



>ref|WP_013192674.1| hypothetical protein [Trichormus azollae]
 gb|ADI65663.1| TPR repeat-containing protein ['Nostoc azollae' 0708]
Length=174

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (61%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++LK D V  L  LG  YEKK+LS +A + YE+ LK  P+ + A+  
Sbjct  105  EQYDLAIRQYKEALKLKPDYVVALNNLGHAYEKKKLSAQALQMYEEVLKFAPNNATAKRR  164

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  165  AESLRRLVS  173



>ref|WP_006197429.1| hypothetical protein [Nodularia spumigena]
 gb|EAW44383.1| hypothetical protein N9414_02029 [Nodularia spumigena CCY9414]
 gb|AHJ30875.1| photosystem I assembly like protein Ycf37 [Nodularia spumigena 
CCY9414]
Length=175

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D A+    E+++ K D V  L  LG  YEKK+L+ +A + YE+ALK  P+ + A+  
Sbjct  106  EQYDLAIRQYKEAIKRKPDYVTALNNLGHAYEKKKLTTQALQMYEEALKFAPNNTIAKRR  165

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  166  AESLRRLVS  174



>ref|WP_017320436.1| photosystem I assembly protein [cyanobacterium PCC 7702]
Length=174

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            +Q D A+ +  E+++ K D V  L  LG  YEKK+L+ +A +SYE+ALK  P  S A+  
Sbjct  105  QQYDLAIRNYKEALKNKPDYVTALNNLGHAYEKKKLNAQALQSYEEALKYDPKNSTAKRR  164

Query  189  -DALARLTS  166
             ++L RL S
Sbjct  165  AESLRRLVS  173



>ref|WP_027844742.1| TPR repeat-containing photosystem I assembly protein Ycf37 [Mastigocoleus 
testarum]
Length=179

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ--  190
            EQ D ++ +  E+V+LK D V     LG  YEKK+L+  A ++YE+ALK+ P  S A+  
Sbjct  110  EQYDLSIRNYKEAVKLKPDYVTAYNNLGHAYEKKKLNAPALEAYEEALKLDPKNSTAKRR  169

Query  189  -DALARLTS  166
             ++L RL +
Sbjct  170  CESLRRLVA  178



>ref|WP_015193116.1| Tetratricopeptide TPR_1 repeat-containing protein [Stanieria 
cyanosphaera]
 gb|AFZ35445.1| Tetratricopeptide TPR_1 repeat-containing protein [Stanieria 
cyanosphaera PCC 7437]
Length=178

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  363  EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ  190
            EQ D+A+    E+++L  D V  L  LG  YEKK++  +A +SYE+ALK +P+ S A+
Sbjct  105  EQYDTAIRQYKEALKLYPDYVTALNNLGNVYEKKQMIVKALESYEEALKYEPNNSVAK  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470