BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025P17

Length=752
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802392.1|  PREDICTED: probable galacturonosyltransferas...    317   1e-99   Nicotiana sylvestris
ref|XP_009802396.1|  PREDICTED: probable galacturonosyltransferas...    317   1e-99   Nicotiana sylvestris
ref|XP_006350232.1|  PREDICTED: probable galacturonosyltransferas...    311   9e-98   Solanum tuberosum [potatoes]
ref|XP_006350235.1|  PREDICTED: probable galacturonosyltransferas...    311   1e-97   Solanum tuberosum [potatoes]
ref|XP_010319211.1|  PREDICTED: probable galacturonosyltransferas...    311   1e-97   Solanum lycopersicum
ref|XP_004236640.1|  PREDICTED: probable galacturonosyltransferas...    311   1e-97   Solanum lycopersicum
ref|XP_009610681.1|  PREDICTED: probable galacturonosyltransferase 4    311   2e-97   
ref|XP_011086294.1|  PREDICTED: probable galacturonosyltransferase 4    303   1e-94   Sesamum indicum [beniseed]
emb|CDP04556.1|  unnamed protein product                                301   9e-94   Coffea canephora [robusta coffee]
gb|EYU27625.1|  hypothetical protein MIMGU_mgv1a004359mg                294   1e-92   Erythranthe guttata [common monkey flower]
gb|EYU33824.1|  hypothetical protein MIMGU_mgv1a002625mg                296   6e-92   Erythranthe guttata [common monkey flower]
ref|XP_010096508.1|  putative galacturonosyltransferase 4               295   1e-91   
ref|XP_011095865.1|  PREDICTED: probable galacturonosyltransferase 4    295   3e-91   
ref|XP_010052508.1|  PREDICTED: probable galacturonosyltransferas...    292   2e-90   
ref|XP_010052503.1|  PREDICTED: probable galacturonosyltransferas...    292   2e-90   Eucalyptus grandis [rose gum]
ref|XP_010052506.1|  PREDICTED: probable galacturonosyltransferas...    292   2e-90   Eucalyptus grandis [rose gum]
gb|KDO78639.1|  hypothetical protein CISIN_1g005035mg                   290   2e-90   Citrus sinensis [apfelsine]
ref|XP_006467237.1|  PREDICTED: probable galacturonosyltransferas...    291   3e-90   Citrus sinensis [apfelsine]
ref|XP_006449976.1|  hypothetical protein CICLE_v10014426mg             291   3e-90   Citrus clementina [clementine]
gb|KDO78642.1|  hypothetical protein CISIN_1g005035mg                   291   3e-90   Citrus sinensis [apfelsine]
ref|XP_008794742.1|  PREDICTED: probable galacturonosyltransferas...    291   4e-90   Phoenix dactylifera
ref|XP_008794741.1|  PREDICTED: probable galacturonosyltransferas...    291   4e-90   Phoenix dactylifera
ref|XP_008794739.1|  PREDICTED: probable galacturonosyltransferas...    291   4e-90   Phoenix dactylifera
ref|XP_008794740.1|  PREDICTED: probable galacturonosyltransferas...    291   4e-90   Phoenix dactylifera
ref|XP_008794737.1|  PREDICTED: probable galacturonosyltransferas...    291   5e-90   Phoenix dactylifera
ref|XP_008794738.1|  PREDICTED: probable galacturonosyltransferas...    291   5e-90   Phoenix dactylifera
gb|EEC83383.1|  hypothetical protein OsI_28798                          289   9e-90   Oryza sativa Indica Group [Indian rice]
ref|NP_001061555.1|  Os08g0327100                                       289   2e-89   
gb|KDO78641.1|  hypothetical protein CISIN_1g005035mg                   291   2e-89   Citrus sinensis [apfelsine]
ref|XP_006449975.1|  hypothetical protein CICLE_v10014426mg             291   2e-89   
ref|XP_007026430.1|  Galacturonosyltransferase 4 isoform 1              287   6e-89   Theobroma cacao [chocolate]
ref|XP_007026431.1|  Galacturonosyltransferase 4 isoform 2              287   6e-89   Theobroma cacao [chocolate]
ref|XP_004486385.1|  PREDICTED: probable galacturonosyltransferas...    288   1e-88   Cicer arietinum [garbanzo]
gb|ACF83776.1|  unknown                                                 272   1e-88   Zea mays [maize]
ref|XP_006660049.1|  PREDICTED: probable galacturonosyltransferas...    286   2e-88   
ref|XP_010252974.1|  PREDICTED: probable galacturonosyltransferase 4    287   3e-88   Nelumbo nucifera [Indian lotus]
ref|XP_009374812.1|  PREDICTED: probable galacturonosyltransferase 4    286   4e-88   Pyrus x bretschneideri [bai li]
ref|XP_002444200.1|  hypothetical protein SORBIDRAFT_07g014890          286   4e-88   Sorghum bicolor [broomcorn]
ref|XP_004134994.1|  PREDICTED: probable galacturonosyltransferas...    285   5e-88   
ref|XP_011460082.1|  PREDICTED: probable galacturonosyltransferas...    285   5e-88   Fragaria vesca subsp. vesca
ref|XP_011460081.1|  PREDICTED: probable galacturonosyltransferas...    285   6e-88   Fragaria vesca subsp. vesca
ref|XP_010272524.1|  PREDICTED: probable galacturonosyltransferase 4    286   6e-88   Nelumbo nucifera [Indian lotus]
ref|XP_011460080.1|  PREDICTED: probable galacturonosyltransferas...    285   7e-88   Fragaria vesca subsp. vesca
ref|XP_002882844.1|  hypothetical protein ARALYDRAFT_478777             284   7e-88   
gb|KJB67441.1|  hypothetical protein B456_010G190800                    278   8e-88   Gossypium raimondii
ref|XP_003535002.1|  PREDICTED: probable galacturonosyltransferas...    285   8e-88   Glycine max [soybeans]
ref|XP_008440950.1|  PREDICTED: probable galacturonosyltransferas...    284   8e-88   
ref|XP_004158838.1|  PREDICTED: probable galacturonosyltransferas...    285   9e-88   
ref|XP_010910637.1|  PREDICTED: probable galacturonosyltransferas...    282   1e-87   Elaeis guineensis
gb|KHN40761.1|  Putative galacturonosyltransferase 4                    285   1e-87   Glycine soja [wild soybean]
ref|XP_008440947.1|  PREDICTED: probable galacturonosyltransferas...    284   1e-87   Cucumis melo [Oriental melon]
ref|XP_006597630.1|  PREDICTED: probable galacturonosyltransferas...    284   2e-87   Glycine max [soybeans]
ref|XP_008384215.1|  PREDICTED: probable galacturonosyltransferas...    285   2e-87   
ref|XP_008384214.1|  PREDICTED: probable galacturonosyltransferas...    285   2e-87   
gb|EPS65589.1|  hypothetical protein M569_09187                         283   2e-87   Genlisea aurea
gb|KHF97487.1|  putative galacturonosyltransferase 4 -like protein      282   2e-87   Gossypium arboreum [tree cotton]
ref|XP_010234583.1|  PREDICTED: probable galacturonosyltransferas...    284   2e-87   Brachypodium distachyon [annual false brome]
ref|XP_003573698.1|  PREDICTED: probable galacturonosyltransferas...    284   3e-87   Brachypodium distachyon [annual false brome]
gb|KDP29029.1|  hypothetical protein JCGZ_16418                         283   3e-87   Jatropha curcas
ref|XP_008349398.1|  PREDICTED: probable galacturonosyltransferase 4    281   3e-87   
ref|XP_004973216.1|  PREDICTED: probable galacturonosyltransferas...    283   3e-87   Setaria italica
ref|XP_010910636.1|  PREDICTED: probable galacturonosyltransferas...    283   4e-87   
ref|XP_007213869.1|  hypothetical protein PRUPE_ppa018681mg             283   5e-87   
ref|XP_010910633.1|  PREDICTED: probable galacturonosyltransferas...    283   5e-87   Elaeis guineensis
gb|KJB67439.1|  hypothetical protein B456_010G190800                    281   6e-87   Gossypium raimondii
ref|NP_568688.1|  probable galacturonosyltransferase 4                  281   7e-87   Arabidopsis thaliana [mouse-ear cress]
gb|KJB67440.1|  hypothetical protein B456_010G190800                    281   7e-87   Gossypium raimondii
dbj|BAB11325.1|  unnamed protein product                                281   7e-87   Arabidopsis thaliana [mouse-ear cress]
gb|KJB67437.1|  hypothetical protein B456_010G190800                    281   9e-87   Gossypium raimondii
ref|XP_008677252.1|  PREDICTED: transferase, transferring glycosy...    282   1e-86   Zea mays [maize]
ref|XP_004499343.1|  PREDICTED: probable galacturonosyltransferas...    282   1e-86   Cicer arietinum [garbanzo]
gb|AFW60920.1|  transferase                                             281   1e-86   
ref|XP_010686598.1|  PREDICTED: probable galacturonosyltransferase 4    281   1e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009107093.1|  PREDICTED: probable galacturonosyltransferase 4    281   1e-86   Brassica rapa
ref|NP_001148932.1|  transferase, transferring glycosyl groups          281   1e-86   Zea mays [maize]
ref|XP_008358828.1|  PREDICTED: probable galacturonosyltransferase 4    282   2e-86   Malus domestica [apple tree]
ref|XP_006279595.1|  hypothetical protein CARUB_v10026096mg             280   2e-86   Capsella rubella
ref|XP_010481273.1|  PREDICTED: probable galacturonosyltransferas...    280   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010481270.1|  PREDICTED: probable galacturonosyltransferas...    280   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010481267.1|  PREDICTED: probable galacturonosyltransferas...    280   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010481265.1|  PREDICTED: probable galacturonosyltransferas...    280   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_008384326.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    278   3e-86   
gb|KHN40223.1|  Putative galacturonosyltransferase 4                    281   4e-86   Glycine soja [wild soybean]
ref|XP_006584115.1|  PREDICTED: probable galacturonosyltransferas...    281   4e-86   Glycine max [soybeans]
ref|XP_010942526.1|  PREDICTED: probable galacturonosyltransferas...    281   4e-86   Elaeis guineensis
ref|XP_010942525.1|  PREDICTED: probable galacturonosyltransferas...    281   5e-86   Elaeis guineensis
ref|XP_010942524.1|  PREDICTED: probable galacturonosyltransferas...    281   5e-86   Elaeis guineensis
ref|XP_006600275.1|  PREDICTED: probable galacturonosyltransferas...    280   5e-86   Glycine max [soybeans]
ref|XP_010495019.1|  PREDICTED: probable galacturonosyltransferas...    279   6e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010495018.1|  PREDICTED: probable galacturonosyltransferas...    279   7e-86   Camelina sativa [gold-of-pleasure]
ref|XP_002525229.1|  Glycosyltransferase QUASIMODO1, putative           280   7e-86   Ricinus communis
ref|XP_010441404.1|  PREDICTED: probable galacturonosyltransferas...    279   7e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010441403.1|  PREDICTED: probable galacturonosyltransferas...    279   8e-86   Camelina sativa [gold-of-pleasure]
ref|XP_009101378.1|  PREDICTED: probable galacturonosyltransferase 4    279   1e-85   Brassica rapa
ref|XP_010942295.1|  PREDICTED: probable galacturonosyltransferase 4    280   1e-85   Elaeis guineensis
ref|XP_006373556.1|  hypothetical protein POPTR_0016s00360g             280   1e-85   
ref|XP_003594361.1|  Galacturonosyltransferase                          280   1e-85   Medicago truncatula
gb|ABN08854.1|  Glycosyl transferase, family 8                          280   1e-85   Medicago truncatula
ref|XP_004168876.1|  PREDICTED: probable galacturonosyltransferas...    278   2e-85   
ref|XP_008775901.1|  PREDICTED: probable galacturonosyltransferase 4    279   2e-85   Phoenix dactylifera
ref|XP_011016525.1|  PREDICTED: probable galacturonosyltransferase 4    279   2e-85   Populus euphratica
ref|XP_011040102.1|  PREDICTED: probable galacturonosyltransferase 4    278   3e-85   Populus euphratica
ref|XP_008464310.1|  PREDICTED: probable galacturonosyltransferase 4    278   3e-85   Cucumis melo [Oriental melon]
ref|XP_007147564.1|  hypothetical protein PHAVU_006G135100g             278   3e-85   Phaseolus vulgaris [French bean]
ref|XP_006398488.1|  hypothetical protein EUTSA_v10000819mg             278   4e-85   Eutrema salsugineum [saltwater cress]
gb|KHG17315.1|  putative galacturonosyltransferase 4 -like protein      277   4e-85   Gossypium arboreum [tree cotton]
gb|KGN65009.1|  hypothetical protein Csa_1G179740                       278   4e-85   Cucumis sativus [cucumbers]
ref|XP_009395236.1|  PREDICTED: probable galacturonosyltransferase 4    278   4e-85   
gb|KHN03562.1|  Putative galacturonosyltransferase 4                    278   5e-85   Glycine soja [wild soybean]
ref|XP_009363241.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    278   6e-85   Pyrus x bretschneideri [bai li]
gb|AET04592.2|  CAZy family GT8 glycosyltransferase                     276   7e-85   Medicago truncatula
ref|XP_008224656.1|  PREDICTED: probable galacturonosyltransferase 4    277   7e-85   Prunus mume [ume]
gb|KFK31342.1|  hypothetical protein AALP_AA6G099900                    276   1e-84   Arabis alpina [alpine rockcress]
ref|XP_004959557.1|  PREDICTED: probable galacturonosyltransferas...    278   2e-84   
emb|CAJ19325.1|  glycosyl transferase-like protein                      277   3e-84   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007154076.1|  hypothetical protein PHAVU_003G088900g             274   1e-83   Phaseolus vulgaris [French bean]
ref|XP_007154077.1|  hypothetical protein PHAVU_003G088900g             275   1e-83   Phaseolus vulgaris [French bean]
ref|XP_010647025.1|  PREDICTED: probable galacturonosyltransferas...    273   2e-83   Vitis vinifera
ref|XP_010647027.1|  PREDICTED: probable galacturonosyltransferas...    273   2e-83   Vitis vinifera
ref|XP_002308736.1|  hypothetical protein POPTR_0006s00320g             272   5e-83   Populus trichocarpa [western balsam poplar]
ref|XP_010647084.1|  PREDICTED: probable galacturonosyltransferase 4    272   5e-83   Vitis vinifera
ref|XP_009390606.1|  PREDICTED: probable galacturonosyltransferas...    271   5e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390607.1|  PREDICTED: probable galacturonosyltransferas...    271   6e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390604.1|  PREDICTED: probable galacturonosyltransferas...    271   6e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390605.1|  PREDICTED: probable galacturonosyltransferas...    271   6e-83   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAJ26362.1|  glycosyl transferase-like protein                      273   8e-83   Brachypodium sylvaticum
ref|XP_003630117.1|  Nudix hydrolase                                    276   1e-82   
ref|XP_003630116.1|  Nudix hydrolase                                    276   1e-82   
ref|XP_008782990.1|  PREDICTED: probable galacturonosyltransferase 4    271   1e-82   Phoenix dactylifera
ref|XP_006661357.1|  PREDICTED: probable galacturonosyltransferas...    272   2e-82   Oryza brachyantha
gb|EMS45059.1|  putative galacturonosyltransferase 4                    271   2e-82   Triticum urartu
gb|EMT04178.1|  Glycosyltransferase QUASIMODO1                          271   3e-82   
ref|XP_011005780.1|  PREDICTED: probable galacturonosyltransferas...    270   3e-82   Populus euphratica
ref|XP_011005782.1|  PREDICTED: probable galacturonosyltransferas...    270   3e-82   Populus euphratica
ref|XP_002460421.1|  hypothetical protein SORBIDRAFT_02g027840          271   4e-82   
gb|EPS62143.1|  hypothetical protein M569_12650                         265   5e-82   Genlisea aurea
emb|CAN70213.1|  hypothetical protein VITISV_038741                     272   6e-82   Vitis vinifera
dbj|BAK01477.1|  predicted protein                                      270   1e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008670271.1|  PREDICTED: probable galacturonosyltransferase 4    269   3e-81   Zea mays [maize]
ref|XP_004974813.1|  PREDICTED: probable galacturonosyltransferas...    269   3e-81   
ref|XP_006857626.1|  hypothetical protein AMTR_s00061p00126570          268   4e-81   Amborella trichopoda
ref|XP_003578298.1|  PREDICTED: probable galacturonosyltransferase 4    268   5e-81   Brachypodium distachyon [annual false brome]
ref|XP_010538434.1|  PREDICTED: probable galacturonosyltransferase 4    265   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_009398761.1|  PREDICTED: probable galacturonosyltransferas...    265   4e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398763.1|  PREDICTED: probable galacturonosyltransferas...    265   4e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398760.1|  PREDICTED: probable galacturonosyltransferas...    265   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS56269.1|  putative galacturonosyltransferase 4                    265   5e-80   Triticum urartu
gb|EAZ09508.1|  hypothetical protein OsI_31783                          264   1e-79   Oryza sativa Indica Group [Indian rice]
ref|NP_001063487.1|  Os09g0480400                                       265   2e-79   
gb|EMT08109.1|  Glycosyltransferase QUASIMODO1                          262   5e-79   
ref|XP_009407928.1|  PREDICTED: probable galacturonosyltransferase 4    262   6e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002969595.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    255   1e-77   
gb|EMS57452.1|  putative galacturonosyltransferase 4                    258   1e-77   Triticum urartu
emb|CAJ75629.1|  glycosyl transferase-like protein                      252   9e-77   Brachypodium sylvaticum
dbj|BAD10126.1|  glycosyltransferase family-like                        257   1e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002970865.1|  Glycosyltransferase, CAZy family GT8               253   1e-76   
gb|EEE68930.1|  hypothetical protein OsJ_27797                          257   1e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235254.1|  PREDICTED: probable galacturonosyltransferase 4    252   9e-76   
gb|KJB24654.1|  hypothetical protein B456_004G155600                    253   2e-75   Gossypium raimondii
gb|KJB24655.1|  hypothetical protein B456_004G155600                    253   2e-75   Gossypium raimondii
gb|EEC83380.1|  hypothetical protein OsI_28795                          252   3e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_002963967.1|  Glycosyltransferase, CAZy family GT8               246   4e-75   
gb|EMT19760.1|  Glycosyltransferase QUASIMODO1                          252   5e-75   
gb|KHG14424.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     252   6e-75   Gossypium arboreum [tree cotton]
ref|XP_010450980.1|  PREDICTED: probable galacturonosyltransferase 3    240   7e-75   
ref|NP_001131608.1|  uncharacterized protein LOC100192958               238   9e-75   
ref|XP_006445203.1|  hypothetical protein CICLE_v10019146mg             251   9e-75   Citrus clementina [clementine]
gb|KDO85920.1|  hypothetical protein CISIN_1g005683mg                   251   9e-75   Citrus sinensis [apfelsine]
ref|XP_007051985.1|  Galacturonosyltransferase 1                        251   1e-74   
ref|XP_001785716.1|  predicted protein                                  238   1e-74   
ref|XP_010661600.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    251   1e-74   Vitis vinifera
ref|XP_002967953.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    249   3e-74   
gb|KJB09887.1|  hypothetical protein B456_001G172800                    249   5e-74   Gossypium raimondii
ref|XP_010056256.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    249   7e-74   Eucalyptus grandis [rose gum]
gb|KHG01394.1|  Alpha-1,4-galacturonosyltransferase 1                   249   8e-74   Gossypium arboreum [tree cotton]
ref|XP_002962728.1|  GAUT1, alpha-1,4-galaturonosyltransferase-li...    245   1e-73   
ref|XP_002980359.1|  Glycosyltransferase, CAZy family GT8               245   1e-73   
ref|XP_010255603.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    248   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010667722.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    248   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006375320.1|  hypothetical protein POPTR_0014s06970g             243   2e-73   
ref|XP_001756118.1|  predicted protein                                  243   3e-73   
ref|XP_011040799.1|  PREDICTED: probable galacturonosyltransferas...    246   3e-73   Populus euphratica
ref|XP_010436923.1|  PREDICTED: probable galacturonosyltransferas...    244   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008460145.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    247   3e-73   
ref|XP_010918998.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    248   4e-73   Elaeis guineensis
ref|XP_010255599.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    247   4e-73   Nelumbo nucifera [Indian lotus]
gb|KHG01393.1|  Alpha-1,4-galacturonosyltransferase 1                   248   4e-73   Gossypium arboreum [tree cotton]
ref|XP_010255602.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    247   4e-73   Nelumbo nucifera [Indian lotus]
ref|NP_001063757.1|  Os09g0531900                                       247   4e-73   
gb|EEC84934.1|  hypothetical protein OsI_32147                          247   4e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_003603462.1|  Alpha-1,4-galacturonosyltransferase                241   5e-73   
emb|CAB37483.1|  putative protein                                       246   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195540.2|  galacturonosyltransferase 3                           247   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011458093.1|  PREDICTED: probable galacturonosyltransferas...    245   5e-73   Fragaria vesca subsp. vesca
dbj|BAF00667.1|  hypothetical protein                                   246   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320745.2|  glycosyl transferase family 8 family protein       243   6e-73   
emb|CDX71763.1|  BnaC08g31110D                                          246   6e-73   
ref|XP_010431762.1|  PREDICTED: probable galacturonosyltransferase 3    244   6e-73   
ref|NP_001190952.1|  galacturonosyltransferase 3                        246   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116771.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    246   7e-73   Brassica rapa
emb|CDY52336.1|  BnaA09g38850D                                          246   7e-73   Brassica napus [oilseed rape]
ref|XP_011088710.1|  PREDICTED: probable galacturonosyltransferase 3    246   7e-73   Sesamum indicum [beniseed]
ref|XP_004172284.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    246   8e-73   
gb|KJB12347.1|  hypothetical protein B456_002G013600                    244   9e-73   Gossypium raimondii
ref|XP_011040798.1|  PREDICTED: probable galacturonosyltransferas...    246   9e-73   Populus euphratica
ref|XP_004229870.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    246   9e-73   Solanum lycopersicum
ref|XP_004144992.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    246   1e-72   
ref|XP_004501287.1|  PREDICTED: probable galacturonosyltransferas...    244   1e-72   Cicer arietinum [garbanzo]
ref|XP_002462717.1|  hypothetical protein SORBIDRAFT_02g030820          246   1e-72   Sorghum bicolor [broomcorn]
ref|XP_008650863.1|  PREDICTED: uncharacterized protein LOC100192...    244   1e-72   Zea mays [maize]
ref|XP_010266351.1|  PREDICTED: probable galacturonosyltransferase 3    242   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_008670350.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   1e-72   
ref|XP_006660882.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    246   1e-72   Oryza brachyantha
ref|XP_006384847.1|  hypothetical protein POPTR_0004s21600g             245   1e-72   
dbj|BAJ53137.1|  JHL05D22.8                                             246   1e-72   Jatropha curcas
ref|XP_006339506.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    246   1e-72   Solanum tuberosum [potatoes]
ref|XP_010272612.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   1e-72   Nelumbo nucifera [Indian lotus]
emb|CDP08918.1|  unnamed protein product                                245   1e-72   Coffea canephora [robusta coffee]
ref|XP_009382742.1|  PREDICTED: probable galacturonosyltransferase 3    244   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY42486.1|  BnaC04g21950D                                          245   2e-72   Brassica napus [oilseed rape]
ref|XP_011458092.1|  PREDICTED: probable galacturonosyltransferas...    245   2e-72   Fragaria vesca subsp. vesca
gb|KDP28715.1|  hypothetical protein JCGZ_14486                         245   2e-72   Jatropha curcas
ref|XP_010512445.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010469034.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010512446.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_011002080.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Populus euphratica
ref|XP_010523706.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_010413456.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_002302550.1|  hypothetical protein POPTR_0002s15270g             244   2e-72   
ref|XP_010512443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_007043045.1|  Galacturonosyltransferase 3 isoform 2              241   2e-72   
ref|XP_011002081.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Populus euphratica
ref|XP_010512444.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    245   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008650862.1|  PREDICTED: uncharacterized protein LOC100192...    245   2e-72   
dbj|BAK02036.1|  predicted protein                                      238   3e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008670348.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   3e-72   
emb|CDX89098.1|  BnaA04g00880D                                          244   3e-72   
ref|XP_006843539.1|  hypothetical protein AMTR_s00007p00049440          238   3e-72   
ref|XP_006411618.1|  hypothetical protein EUTSA_v10024734mg             243   3e-72   
ref|XP_008670347.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   3e-72   
ref|XP_010436922.1|  PREDICTED: probable galacturonosyltransferas...    243   4e-72   Camelina sativa [gold-of-pleasure]
gb|EYU32902.1|  hypothetical protein MIMGU_mgv1a002354mg                244   4e-72   Erythranthe guttata [common monkey flower]
ref|XP_009138790.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    244   4e-72   
ref|XP_010106747.1|  Alpha-1,4-galacturonosyltransferase 1              244   4e-72   Morus notabilis
gb|EYU38036.1|  hypothetical protein MIMGU_mgv1a002760mg                243   5e-72   Erythranthe guttata [common monkey flower]
ref|XP_004957448.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    244   5e-72   Setaria italica
ref|XP_009589124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    244   5e-72   Nicotiana tomentosiformis
ref|XP_004248575.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   5e-72   Solanum lycopersicum
gb|KHG03188.1|  putative galacturonosyltransferase 3 -like protein      237   5e-72   Gossypium arboreum [tree cotton]
ref|XP_004501286.1|  PREDICTED: probable galacturonosyltransferas...    244   6e-72   Cicer arietinum [garbanzo]
ref|XP_008342952.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    244   6e-72   Malus domestica [apple tree]
gb|KEH35941.1|  polygalacturonate 4-alpha-galacturonosyltransferase     242   6e-72   Medicago truncatula
ref|XP_006402518.1|  hypothetical protein EUTSA_v10005820mg             244   6e-72   Eutrema salsugineum [saltwater cress]
ref|XP_011083645.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    244   6e-72   Sesamum indicum [beniseed]
gb|EMS50352.1|  Alpha-1,4-galacturonosyltransferase 1                   240   6e-72   Triticum urartu
tpg|DAA40341.1|  TPA: hypothetical protein ZEAMMB73_504957              244   7e-72   
ref|NP_191672.1|  alpha-1,4-galacturonosyltransferase 1                 243   7e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690224.1|  PREDICTED: probable galacturonosyltransferas...    243   7e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009623515.1|  PREDICTED: probable galacturonosyltransferas...    243   8e-72   Nicotiana tomentosiformis
ref|XP_009375839.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    244   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_006290325.1|  hypothetical protein CARUB_v10016785mg             243   8e-72   
ref|XP_009623514.1|  PREDICTED: probable galacturonosyltransferas...    243   8e-72   Nicotiana tomentosiformis
ref|XP_009418721.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   8e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011034886.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   9e-72   Populus euphratica
ref|XP_009375840.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   9e-72   
ref|XP_008670346.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   9e-72   Zea mays [maize]
ref|XP_011469111.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   9e-72   Fragaria vesca subsp. vesca
ref|XP_008650861.1|  PREDICTED: uncharacterized protein LOC100192...    244   9e-72   Zea mays [maize]
ref|XP_008776919.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    244   9e-72   Phoenix dactylifera
ref|XP_002876594.1|  GAUT1/LGT1                                         243   9e-72   
ref|XP_006285045.1|  hypothetical protein CARUB_v10006353mg             243   1e-71   
gb|AFW67949.1|  hypothetical protein ZEAMMB73_846223                    232   1e-71   
ref|XP_002866790.1|  hypothetical protein ARALYDRAFT_912279             243   1e-71   Arabidopsis lyrata subsp. lyrata
emb|CDP14496.1|  unnamed protein product                                243   1e-71   Coffea canephora [robusta coffee]
ref|XP_009766434.1|  PREDICTED: probable galacturonosyltransferas...    243   1e-71   Nicotiana sylvestris
ref|XP_009766433.1|  PREDICTED: probable galacturonosyltransferas...    243   1e-71   Nicotiana sylvestris
ref|XP_003578496.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   1e-71   
ref|XP_011014842.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   1e-71   Populus euphratica
ref|XP_011014841.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   1e-71   Populus euphratica
ref|XP_002511763.1|  transferase, transferring glycosyl groups, p...    243   1e-71   
ref|XP_009418719.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   2e-71   
ref|XP_006341726.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    242   2e-71   
ref|XP_010934420.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   2e-71   
ref|XP_008232828.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   2e-71   
ref|XP_008232829.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   2e-71   
gb|KFK30437.1|  hypothetical protein AALP_AA7G260900                    243   2e-71   
ref|XP_008364418.1|  PREDICTED: probable galacturonosyltransferase 3    242   2e-71   
ref|XP_008670345.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   2e-71   
ref|XP_010935289.1|  PREDICTED: probable galacturonosyltransferas...    242   2e-71   
ref|XP_009785495.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    243   2e-71   
gb|AES73713.2|  polygalacturonate 4-alpha-galacturonosyltransferase     242   2e-71   
ref|XP_009101952.1|  PREDICTED: probable galacturonosyltransferas...    243   2e-71   
ref|XP_010690223.1|  PREDICTED: probable galacturonosyltransferas...    243   2e-71   
ref|XP_008781317.1|  PREDICTED: probable galacturonosyltransferase 3    243   2e-71   
ref|XP_002454735.1|  hypothetical protein SORBIDRAFT_04g036420          234   2e-71   
ref|XP_009373401.1|  PREDICTED: probable galacturonosyltransferas...    241   2e-71   
ref|XP_008356326.1|  PREDICTED: probable galacturonosyltransferase 3    242   2e-71   
ref|XP_009101951.1|  PREDICTED: probable galacturonosyltransferas...    242   2e-71   
ref|XP_010239537.1|  PREDICTED: probable galacturonosyltransferas...    240   3e-71   
ref|XP_007043044.1|  Galacturonosyltransferase 3 isoform 1              241   3e-71   
ref|XP_010111700.1|  putative galacturonosyltransferase 3               243   3e-71   
ref|XP_007220901.1|  hypothetical protein PRUPE_ppa002418mg             242   3e-71   
emb|CDY59095.1|  BnaCnng34200D                                          242   3e-71   
ref|XP_010935288.1|  PREDICTED: probable galacturonosyltransferas...    242   3e-71   
ref|XP_008447845.1|  PREDICTED: probable galacturonosyltransferas...    239   3e-71   
ref|XP_003525683.1|  PREDICTED: probable galacturonosyltransferas...    241   4e-71   
ref|XP_007200300.1|  hypothetical protein PRUPE_ppa003250mg             240   4e-71   
gb|EMS52040.1|  putative galacturonosyltransferase 3                    239   4e-71   
gb|AFW67950.1|  hypothetical protein ZEAMMB73_846223                    234   4e-71   
ref|XP_009345925.1|  PREDICTED: probable galacturonosyltransferas...    240   4e-71   
gb|EEC81302.1|  hypothetical protein OsI_24438                          239   4e-71   
ref|XP_010239532.1|  PREDICTED: probable galacturonosyltransferas...    240   4e-71   
gb|KJB41168.1|  hypothetical protein B456_007G093500                    241   5e-71   
ref|XP_009616855.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    241   5e-71   
ref|XP_009373400.1|  PREDICTED: probable galacturonosyltransferas...    241   5e-71   
gb|KHN27481.1|  Putative galacturonosyltransferase 3                    241   6e-71   
ref|XP_010231443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    239   6e-71   
ref|XP_006657336.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    239   6e-71   
ref|XP_009777396.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    241   6e-71   
emb|CAB81547.1|  68 kDa protein                                         239   6e-71   
gb|ACF78990.1|  unknown                                                 231   6e-71   
ref|XP_006579796.1|  PREDICTED: probable galacturonosyltransferas...    241   6e-71   
gb|AIL52750.1|  polygalacturonate 4-alpha-galacturonosyltransfera...    241   6e-71   
gb|EMT14751.1|  Glycosyltransferase QUASIMODO1                          239   7e-71   
ref|XP_007043046.1|  Galacturonosyltransferase 3 isoform 3              241   7e-71   
ref|XP_006656516.1|  PREDICTED: probable galacturonosyltransferas...    237   7e-71   
ref|XP_008235962.1|  PREDICTED: probable galacturonosyltransferas...    240   7e-71   
dbj|BAJ99110.1|  predicted protein                                      239   9e-71   
ref|XP_008438124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    240   1e-70   
ref|XP_008438127.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    240   1e-70   
gb|EPS66373.1|  hypothetical protein M569_08404                         239   1e-70   
ref|XP_008438125.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    240   1e-70   
ref|XP_004144949.1|  PREDICTED: probable galacturonosyltransferas...    240   1e-70   
ref|XP_008382476.1|  PREDICTED: probable galacturonosyltransferase 3    241   1e-70   
emb|CAN79512.1|  hypothetical protein VITISV_014158                     239   1e-70   
gb|KGN56570.1|  hypothetical protein Csa_3G124890                       240   1e-70   
ref|XP_004492659.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    240   1e-70   
ref|XP_004154763.1|  PREDICTED: probable galacturonosyltransferas...    240   1e-70   
ref|XP_008235961.1|  PREDICTED: probable galacturonosyltransferas...    240   2e-70   
gb|KGN43338.1|  hypothetical protein Csa_7G024120                       240   2e-70   
ref|XP_008447844.1|  PREDICTED: probable galacturonosyltransferas...    240   2e-70   
gb|AFW67951.1|  hypothetical protein ZEAMMB73_846223                    236   2e-70   
ref|XP_004966516.1|  PREDICTED: probable galacturonosyltransferas...    240   2e-70   
ref|XP_009345924.1|  PREDICTED: probable galacturonosyltransferas...    240   2e-70   
ref|XP_004134339.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    240   2e-70   
ref|XP_004155869.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    240   2e-70   
gb|KHG15715.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     240   2e-70   
ref|XP_006583368.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    239   2e-70   
gb|KHN04587.1|  Alpha-1,4-galacturonosyltransferase 1                   239   2e-70   
ref|NP_001064438.1|  Os10g0363100                                       236   2e-70   
ref|XP_007134929.1|  hypothetical protein PHAVU_010G087600g             239   3e-70   
ref|XP_004982129.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    237   3e-70   
ref|XP_010645848.1|  PREDICTED: probable galacturonosyltransferase 3    239   3e-70   
ref|XP_004510897.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    239   3e-70   
gb|KHN04100.1|  Alpha-1,4-galacturonosyltransferase 1                   239   3e-70   
ref|XP_006576391.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    239   3e-70   
ref|XP_008809114.1|  PREDICTED: probable galacturonosyltransferase 3    235   3e-70   
ref|XP_006656515.1|  PREDICTED: probable galacturonosyltransferas...    238   4e-70   
ref|XP_007139968.1|  hypothetical protein PHAVU_008G074000g             239   4e-70   
gb|EPS65305.1|  hypothetical protein M569_09471                         238   4e-70   
ref|XP_009386175.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    238   4e-70   
ref|XP_010028843.1|  PREDICTED: probable galacturonosyltransferase 3    238   5e-70   
ref|XP_006486598.1|  PREDICTED: probable galacturonosyltransferas...    237   5e-70   
ref|XP_001779123.1|  predicted protein                                  235   5e-70   
ref|XP_006828896.1|  hypothetical protein AMTR_s00001p00190810          238   6e-70   
gb|KHN03164.1|  Alpha-1,4-galacturonosyltransferase 1                   236   8e-70   
gb|AES80022.2|  CAZy family GT8 glycosyltransferase                     238   9e-70   
ref|XP_001770653.1|  predicted protein                                  234   9e-70   
ref|NP_001169332.1|  hypothetical protein precursor                     236   1e-69   
gb|KHG09589.1|  putative galacturonosyltransferase 3 -like protein      237   1e-69   
gb|KDP42036.1|  hypothetical protein JCGZ_03099                         238   1e-69   
ref|XP_003623804.1|  Alpha-1,4-galacturonosyltransferase                238   1e-69   
ref|XP_011074569.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    237   1e-69   
ref|XP_004231097.1|  PREDICTED: probable galacturonosyltransferase 3    238   1e-69   
ref|XP_006364356.1|  PREDICTED: probable galacturonosyltransferas...    237   2e-69   
gb|KJB79717.1|  hypothetical protein B456_013G063700                    234   2e-69   
ref|XP_008671920.1|  PREDICTED: uncharacterized protein LOC100191...    234   2e-69   
ref|XP_006486597.1|  PREDICTED: probable galacturonosyltransferas...    237   2e-69   
ref|XP_006422429.1|  hypothetical protein CICLE_v10027946mg             237   2e-69   
ref|XP_002466644.1|  hypothetical protein SORBIDRAFT_01g011560          235   3e-69   
gb|AAM18739.1|AC092548_17  hypothetical protein                         235   3e-69   
ref|XP_010555175.1|  PREDICTED: probable galacturonosyltransferas...    236   3e-69   
ref|XP_007137299.1|  hypothetical protein PHAVU_009G115700g             236   3e-69   
tpg|DAA50750.1|  TPA: hypothetical protein ZEAMMB73_194342              234   4e-69   
ref|XP_003551642.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    236   4e-69   
ref|XP_010555174.1|  PREDICTED: probable galacturonosyltransferas...    236   4e-69   
ref|NP_001130678.1|  uncharacterized protein LOC100191781 precursor     234   5e-69   
gb|KHN29422.1|  Alpha-1,4-galacturonosyltransferase 1                   235   5e-69   
ref|XP_010918253.1|  PREDICTED: probable galacturonosyltransferase 3    233   5e-69   
ref|XP_003533632.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    236   6e-69   
ref|XP_002439065.1|  hypothetical protein SORBIDRAFT_10g030870          236   6e-69   
gb|EAY78177.1|  hypothetical protein OsI_33224                          235   8e-69   
ref|XP_002963966.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    235   8e-69   
gb|EAZ15816.1|  hypothetical protein OsJ_31235                          236   9e-69   
gb|ABB47337.1|  Glycosyltransferase QUASIMODO1, putative, expressed     235   1e-68   
ref|XP_008645104.1|  PREDICTED: probable galacturonosyltransferas...    235   1e-68   
gb|AFW69586.1|  hypothetical protein ZEAMMB73_786543                    235   1e-68   
ref|XP_008645106.1|  PREDICTED: probable galacturonosyltransferas...    235   1e-68   
ref|XP_008645105.1|  PREDICTED: probable galacturonosyltransferas...    235   1e-68   
ref|XP_002533896.1|  Glycosyltransferase QUASIMODO1, putative           234   1e-68   
gb|KJB79715.1|  hypothetical protein B456_013G063700                    234   2e-68   
gb|KJB79716.1|  hypothetical protein B456_013G063700                    234   2e-68   
dbj|BAJ86220.1|  predicted protein                                      234   4e-68   
gb|EMT00930.1|  Glycosyltransferase QUASIMODO1                          234   3e-67   
ref|NP_001058636.2|  Os06g0727300                                       229   3e-67   
ref|XP_007032944.1|  Glycosyltransferase isoform 2                      224   5e-66   
ref|XP_007032943.1|  Glycosyltransferase isoform 1                      224   1e-65   
ref|XP_010523196.1|  PREDICTED: putative galacturonosyltransferase 2    224   1e-65   
ref|XP_006373520.1|  hypothetical protein POPTR_0017s144802g            223   2e-65   
ref|XP_011021133.1|  PREDICTED: probable galacturonosyltransferase 9    224   2e-65   
ref|XP_008457595.1|  PREDICTED: galacturonosyltransferase 8-like        224   3e-65   
ref|XP_010918254.1|  PREDICTED: probable galacturonosyltransferase 3    223   3e-65   
gb|EMS51766.1|  Galacturonosyltransferase 8                             215   4e-65   
gb|EEC84933.1|  hypothetical protein OsI_32146                          223   5e-65   
ref|XP_008803497.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    223   8e-65   
ref|XP_006384242.1|  hypothetical protein POPTR_0004s10980g             222   1e-64   
gb|EMS57388.1|  Alpha-1,4-galacturonosyltransferase 1                   224   1e-64   
gb|KJB48245.1|  hypothetical protein B456_008G059800                    220   2e-64   
dbj|BAD94466.1|  hypothetical protein                                   212   2e-64   
ref|XP_009404224.1|  PREDICTED: galacturonosyltransferase 8-like        221   3e-64   
ref|XP_006841268.1|  hypothetical protein AMTR_s00135p00111710          221   3e-64   
gb|KJB48243.1|  hypothetical protein B456_008G059800                    221   3e-64   
ref|XP_010908797.1|  PREDICTED: galacturonosyltransferase 8-like        221   4e-64   
ref|NP_001168623.1|  uncharacterized protein LOC100382408               213   5e-64   
ref|XP_008778166.1|  PREDICTED: galacturonosyltransferase 8-like        220   5e-64   
ref|XP_009379995.1|  PREDICTED: galacturonosyltransferase 8-like        220   5e-64   
ref|XP_011033002.1|  PREDICTED: galacturonosyltransferase 8-like        220   6e-64   
ref|XP_002310951.2|  hypothetical protein POPTR_0008s01050g             220   6e-64   
ref|XP_011012259.1|  PREDICTED: probable galacturonosyltransferase 9    220   8e-64   
ref|XP_006430887.1|  hypothetical protein CICLE_v10011396mg             220   8e-64   
ref|XP_006482345.1|  PREDICTED: probable galacturonosyltransferas...    220   8e-64   
gb|KDO68337.1|  hypothetical protein CISIN_1g0404351mg                  227   8e-64   
ref|XP_002530802.1|  Glycosyltransferase QUASIMODO1, putative           220   8e-64   
gb|KFK37701.1|  hypothetical protein AALP_AA3G017600                    220   8e-64   
ref|XP_010913084.1|  PREDICTED: galacturonosyltransferase 8             219   1e-63   
ref|XP_009134662.1|  PREDICTED: probable galacturonosyltransferas...    219   1e-63   
gb|ABD65461.1|  transferring glycosyl protein                           209   1e-63   
ref|XP_004149774.1|  PREDICTED: galacturonosyltransferase 8-like        219   1e-63   
ref|XP_008458050.1|  PREDICTED: galacturonosyltransferase 8             219   1e-63   
ref|XP_009134660.1|  PREDICTED: probable galacturonosyltransferas...    219   1e-63   
emb|CDX74263.1|  BnaA03g27840D                                          219   2e-63   
emb|CDX91987.1|  BnaC03g32890D                                          218   2e-63   
ref|XP_002987448.1|  Quasimodo1-like protein                            217   2e-63   
ref|XP_010476066.1|  PREDICTED: probable galacturonosyltransferase 9    218   3e-63   
ref|XP_010463640.1|  PREDICTED: probable galacturonosyltransferase 9    218   3e-63   
emb|CDY34723.1|  BnaA01g33020D                                          217   3e-63   
ref|XP_010257858.1|  PREDICTED: probable galacturonosyltransferase 9    218   3e-63   
ref|XP_010246719.1|  PREDICTED: galacturonosyltransferase 8             218   4e-63   
ref|XP_006297346.1|  hypothetical protein CARUB_v10013365mg             218   4e-63   
gb|KJB10196.1|  hypothetical protein B456_001G188500                    214   4e-63   
gb|KDP24309.1|  hypothetical protein JCGZ_25605                         218   4e-63   
ref|XP_002980055.1|  Quasimodo1-like protein                            218   5e-63   
ref|NP_001174992.1|  Os06g0712500                                       206   5e-63   
ref|XP_006841805.1|  hypothetical protein AMTR_s00003p00268960          216   6e-63   
ref|XP_002882224.1|  hypothetical protein ARALYDRAFT_477468             218   6e-63   
ref|XP_006408424.1|  hypothetical protein EUTSA_v10020416mg             218   6e-63   
emb|CBI25666.3|  unnamed protein product                                216   7e-63   
ref|NP_001063756.1|  Os09g0531800                                       215   9e-63   
ref|XP_004242412.1|  PREDICTED: galacturonosyltransferase 8-like        217   9e-63   
gb|KJB08801.1|  hypothetical protein B456_001G104800                    213   1e-62   
ref|XP_006648647.1|  PREDICTED: galacturonosyltransferase 8-like        213   1e-62   
ref|XP_010100891.1|  putative galacturonosyltransferase 9               218   1e-62   
emb|CDP02368.1|  unnamed protein product                                217   1e-62   
ref|XP_002273962.2|  PREDICTED: galacturonosyltransferase 8             216   1e-62   
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                   216   2e-62   
dbj|BAK03588.1|  predicted protein                                      216   2e-62   
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like        216   2e-62   
gb|EPS68195.1|  hypothetical protein M569_06576                         214   2e-62   
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8             216   2e-62   
gb|KHG03994.1|  putative galacturonosyltransferase 9 -like protein      216   2e-62   
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg             216   2e-62   
gb|AID66003.1|  glycosyltransferase                                     216   2e-62   
gb|AHL38785.1|  glycosyltransferase                                     216   2e-62   
ref|XP_009373741.1|  PREDICTED: probable galacturonosyltransferase 9    216   2e-62   
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8             216   2e-62   
ref|NP_566170.1|  putative galacturonosyltransferase 9                  216   2e-62   
ref|XP_008379476.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    216   3e-62   
ref|XP_009792003.1|  PREDICTED: probable galacturonosyltransferase 9    215   3e-62   
ref|XP_009603685.1|  PREDICTED: probable galacturonosyltransferase 9    215   3e-62   
ref|XP_008230332.1|  PREDICTED: probable galacturonosyltransferase 9    216   3e-62   
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8             216   3e-62   
ref|XP_008341825.1|  PREDICTED: probable galacturonosyltransferase 9    216   3e-62   
emb|CAJ34814.1|  glycosyltransferase                                    209   3e-62   
gb|AFW71494.1|  hypothetical protein ZEAMMB73_252708                    214   4e-62   
ref|XP_006296343.1|  hypothetical protein CARUB_v10025515mg             217   4e-62   
gb|KHG16505.1|  Galacturonosyltransferase 8 -like protein               216   4e-62   
ref|XP_004232120.1|  PREDICTED: probable galacturonosyltransferase 9    215   4e-62   
emb|CDP12269.1|  unnamed protein product                                215   4e-62   
ref|XP_006338312.1|  PREDICTED: probable galacturonosyltransferas...    215   5e-62   
ref|XP_008380657.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    212   5e-62   
gb|KJB10199.1|  hypothetical protein B456_001G188500                    215   6e-62   
ref|XP_010498259.1|  PREDICTED: probable galacturonosyltransferas...    207   6e-62   
gb|KJB10198.1|  hypothetical protein B456_001G188500                    215   6e-62   
gb|KHG26626.1|  putative galacturonosyltransferase 9 -like protein      215   6e-62   
emb|CDY61593.1|  BnaC03g74220D                                          214   7e-62   
ref|XP_002453869.1|  hypothetical protein SORBIDRAFT_04g020140          214   8e-62   
gb|KHG21596.1|  Galacturonosyltransferase 8 -like protein               214   8e-62   
ref|XP_009136103.1|  PREDICTED: galacturonosyltransferase 8             214   8e-62   
gb|EEC73220.1|  hypothetical protein OsI_07307                          214   8e-62   
dbj|BAD23465.1|  putative glycosyl transferase                          214   8e-62   



>ref|XP_009802392.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802394.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009802395.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Nicotiana 
sylvestris]
Length=681

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLISK FDPRACGWAFGMNI DL+EWRR+NITE
Sbjct  519  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKHFDPRACGWAFGMNIFDLNEWRRQNITE  578

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  579  VYHSWQNLNHDRQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  638

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQVFLREC
Sbjct  639  HYNGNLKPWLEISIPKFRDYWSKFVDYDQVFLREC  673



>ref|XP_009802396.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Nicotiana 
sylvestris]
Length=680

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLISK FDPRACGWAFGMNI DL+EWRR+NITE
Sbjct  518  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKHFDPRACGWAFGMNIFDLNEWRRQNITE  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  578  VYHSWQNLNHDRQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQVFLREC
Sbjct  638  HYNGNLKPWLEISIPKFRDYWSKFVDYDQVFLREC  672



>ref|XP_006350232.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350233.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350234.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X3 [Solanum tuberosum]
Length=680

 Score =   311 bits (798),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLISK+FDPRACGWAFGMNI+DL++WRR+NITE
Sbjct  518  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAFGMNIIDLNQWRRQNITE  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  578  VYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  638  HYNGNLKPWLEISIPKFRDYWSKFVDYDQAFLREC  672



>ref|XP_006350235.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X4 [Solanum tuberosum]
Length=679

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLISK+FDPRACGWAFGMNI+DL++WRR+NITE
Sbjct  517  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAFGMNIIDLNQWRRQNITE  576

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  577  VYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  636

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  637  HYNGNLKPWLEISIPKFRDYWSKFVDYDQAFLREC  671



>ref|XP_010319211.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010319212.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Solanum 
lycopersicum]
Length=679

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLIS++FDPRACGWAFGMNI+DL+EWRR+NITE
Sbjct  517  LKGKVIGVVETCGESFHRFDRYLNFSNPLISENFDPRACGWAFGMNIIDLNEWRRQNITE  576

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  577  VYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  636

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  637  HYNGNLKPWLEISIPKFRDYWSKFVDYDQTFLREC  671



>ref|XP_004236640.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319210.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Solanum 
lycopersicum]
Length=680

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLIS++FDPRACGWAFGMNI+DL+EWRR+NITE
Sbjct  518  LKGKVIGVVETCGESFHRFDRYLNFSNPLISENFDPRACGWAFGMNIIDLNEWRRQNITE  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ  N++RQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  578  VYHSWQNRNHERQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQ FLREC
Sbjct  638  HYNGNLKPWLEISIPKFRDYWSKFVDYDQTFLREC  672



>ref|XP_009610681.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
 ref|XP_009610682.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
 ref|XP_009610684.1| PREDICTED: probable galacturonosyltransferase 4 [Nicotiana tomentosiformis]
Length=681

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLI K FD RACGWAFGMNI DL+EWRR+NITE
Sbjct  519  LKGKVIGVVETCGESFHRFDRYLNFSNPLIFKHFDSRACGWAFGMNIFDLNEWRRQNITE  578

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLITFW  TYALDRSWHVLGLGYNPNV QKDI+RAAVI
Sbjct  579  VYHSWQNLNHDRQLWKLGTLPPGLITFWKRTYALDRSWHVLGLGYNPNVSQKDIQRAAVI  638

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKFR+YWS+F++YDQVFLREC
Sbjct  639  HYNGNLKPWLEISIPKFRDYWSKFVDYDQVFLREC  673



>ref|XP_011086294.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
Length=676

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LK KVIGVVETCGESFHRFDRYLNFSNPLIS++FDPRACGWAFGMNI DL EWR++NIT+
Sbjct  518  LKEKVIGVVETCGESFHRFDRYLNFSNPLISRNFDPRACGWAFGMNIFDLDEWRKQNITD  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ+LN DR LWKLGTLPPGLITFWN TYALD+SWHVLGLGYNPNV QKDIERAAVI
Sbjct  578  VYHKWQSLNQDRLLWKLGTLPPGLITFWNRTYALDKSWHVLGLGYNPNVSQKDIERAAVI  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI+IPKFRNYW+RF++YD  +LREC
Sbjct  638  HYNGNLKPWLEIAIPKFRNYWARFVDYDHQYLREC  672



>emb|CDP04556.1| unnamed protein product [Coffea canephora]
Length=684

 Score =   301 bits (771),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGESFHRFDRYLNFSNPLISK FDPRACGWAFGMNI+DL EW+R+NITE
Sbjct  526  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKKFDPRACGWAFGMNIVDLDEWKRQNITE  585

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLITFWN TYALDR WHVLGLGYNPN+  K+I+RAAV+
Sbjct  586  VYHSWQNLNHDRQLWKLGTLPPGLITFWNRTYALDRYWHVLGLGYNPNISPKEIDRAAVV  645

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK+R+YW+++++YDQ++LREC
Sbjct  646  HYNGNLKPWLEIGIPKYRSYWAKYVDYDQMYLREC  680



>gb|EYU27625.1| hypothetical protein MIMGU_mgv1a004359mg [Erythranthe guttata]
Length=531

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKVIGVVETCGESFHRFDRYLNFSNPLIS+SF PRACGWAFGMNI DL +WR++NIT+
Sbjct  373  LNGKVIGVVETCGESFHRFDRYLNFSNPLISRSFSPRACGWAFGMNIFDLDQWRKQNITQ  432

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DR LWKLGTLPPGLITFWNHTYALD++WHVLGLGYNP V Q+DI+RAAVI
Sbjct  433  VYHKWQNLNHDRLLWKLGTLPPGLITFWNHTYALDKAWHVLGLGYNPGVAQRDIDRAAVI  492

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPKFR+YW++F++YD V+LREC
Sbjct  493  HYNGNLKPWLEIGIPKFRSYWAKFVDYDHVYLREC  527



>gb|EYU33824.1| hypothetical protein MIMGU_mgv1a002625mg [Erythranthe guttata]
Length=653

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKVIGVVETCGE+FHRFDRYLNFSNP+ISK+FDPRACGWAFGMNI DL EWR++NITE
Sbjct  495  LKGKVIGVVETCGETFHRFDRYLNFSNPIISKNFDPRACGWAFGMNIFDLDEWRKQNITE  554

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR LWKLGTLPPGLITF N TYALD+SWHVLGLGYNPNV  KDIERAAVI
Sbjct  555  VYHKWQNLNEDRLLWKLGTLPPGLITFSNRTYALDKSWHVLGLGYNPNVPLKDIERAAVI  614

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PKFRNYW++F++YD  +LREC
Sbjct  615  HYNGNLKPWLEIGLPKFRNYWAKFVDYDHQYLREC  649



>ref|XP_010096508.1| putative galacturonosyltransferase 4 [Morus notabilis]
 gb|EXB64628.1| putative galacturonosyltransferase 4 [Morus notabilis]
Length=657

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EW+R+ IT+
Sbjct  499  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLKEWKRQQITD  558

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNPNV QKDIERAAVI
Sbjct  559  VYHSWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPNVGQKDIERAAVI  618

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW+++++YDQ++LREC
Sbjct  619  HYNGNMKPWLEIGIPKYRNYWAKYVDYDQLYLREC  653



>ref|XP_011095865.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095866.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095867.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
 ref|XP_011095868.1| PREDICTED: probable galacturonosyltransferase 4 [Sesamum indicum]
Length=682

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV+GVVETC ESFHRFDRYLNFSNPLIS++F+PRACGWAFGMNI DL EWR++NITE
Sbjct  524  LKGKVVGVVETCRESFHRFDRYLNFSNPLISENFNPRACGWAFGMNIFDLDEWRKQNITE  583

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DR LWKLGTLPPGLITFWN TY LD+SWHVLGLGY+PNV QKDIERAAVI
Sbjct  584  VYHKWQNLNHDRLLWKLGTLPPGLITFWNRTYTLDKSWHVLGLGYDPNVPQKDIERAAVI  643

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPKFRNYW++F++Y+ ++LREC
Sbjct  644  HYNGNLKPWLEIGIPKFRNYWAKFVDYEHIYLREC  678



>ref|XP_010052508.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Eucalyptus 
grandis]
 ref|XP_010052509.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Eucalyptus 
grandis]
 gb|KCW76574.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=653

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+++NITE
Sbjct  495  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLKEWKKQNITE  554

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFWN T+ LDR WHVLGLGYNPNV Q+DIERAAVI
Sbjct  555  VYHNWQKLNHDRQLWKLGTLPPGLITFWNRTHPLDRLWHVLGLGYNPNVNQRDIERAAVI  614

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+RNYW ++++YD V+LREC
Sbjct  615  HYNGNLKPWLEIGMPKYRNYWVKYVDYDHVYLREC  649



>ref|XP_010052503.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052504.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052505.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76571.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
 gb|KCW76572.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=659

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+++NITE
Sbjct  501  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLKEWKKQNITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFWN T+ LDR WHVLGLGYNPNV Q+DIERAAVI
Sbjct  561  VYHNWQKLNHDRQLWKLGTLPPGLITFWNRTHPLDRLWHVLGLGYNPNVNQRDIERAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+RNYW ++++YD V+LREC
Sbjct  621  HYNGNLKPWLEIGMPKYRNYWVKYVDYDHVYLREC  655



>ref|XP_010052506.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010052507.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Eucalyptus 
grandis]
 gb|KCW76573.1| hypothetical protein EUGRSUZ_D00963 [Eucalyptus grandis]
Length=654

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+++NITE
Sbjct  496  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLKEWKKQNITE  555

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFWN T+ LDR WHVLGLGYNPNV Q+DIERAAVI
Sbjct  556  VYHNWQKLNHDRQLWKLGTLPPGLITFWNRTHPLDRLWHVLGLGYNPNVNQRDIERAAVI  615

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+RNYW ++++YD V+LREC
Sbjct  616  HYNGNLKPWLEIGMPKYRNYWVKYVDYDHVYLREC  650



>gb|KDO78639.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=588

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  430  LKGKVNGAVETCGETFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWRRQNITD  489

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAVI
Sbjct  490  VYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDRFWHVLGLGYNPSVNQRDIERAAVI  549

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  550  HYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  584



>ref|XP_006467237.1| PREDICTED: probable galacturonosyltransferase 4-like [Citrus 
sinensis]
 gb|KDO78640.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=646

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  488  LKGKVNGAVETCGETFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWRRQNITD  547

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAVI
Sbjct  548  VYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDRFWHVLGLGYNPSVNQRDIERAAVI  607

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  608  HYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  642



>ref|XP_006449976.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
 gb|ESR63216.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
Length=646

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  488  LKGKVNGAVETCGETFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWRRQNITD  547

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAVI
Sbjct  548  VYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDRFWHVLGLGYNPSVNQRDIERAAVI  607

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  608  HYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  642



>gb|KDO78642.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=656

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  498  LKGKVNGAVETCGETFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWRRQNITD  557

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAVI
Sbjct  558  VYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDRFWHVLGLGYNPSVNQRDIERAAVI  617

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  618  HYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  652



>ref|XP_008794742.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Phoenix 
dactylifera]
Length=641

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL EWR++NITE
Sbjct  483  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLVEWRKQNITE  542

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+WH+LGLGYNP+V QK+IERAAVI
Sbjct  543  VYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRAWHILGLGYNPHVAQKEIERAAVI  602

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  603  HYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  637



>ref|XP_008794741.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Phoenix 
dactylifera]
Length=642

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL EWR++NITE
Sbjct  484  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLVEWRKQNITE  543

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+WH+LGLGYNP+V QK+IERAAVI
Sbjct  544  VYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRAWHILGLGYNPHVAQKEIERAAVI  603

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  604  HYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  638



>ref|XP_008794739.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Phoenix 
dactylifera]
Length=660

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL EWR++NITE
Sbjct  502  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLVEWRKQNITE  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+WH+LGLGYNP+V QK+IERAAVI
Sbjct  562  VYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRAWHILGLGYNPHVAQKEIERAAVI  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  622  HYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  656



>ref|XP_008794740.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Phoenix 
dactylifera]
Length=659

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL EWR++NITE
Sbjct  501  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLVEWRKQNITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+WH+LGLGYNP+V QK+IERAAVI
Sbjct  561  VYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRAWHILGLGYNPHVAQKEIERAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  621  HYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  655



>ref|XP_008794737.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Phoenix 
dactylifera]
Length=665

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL EWR++NITE
Sbjct  507  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLVEWRKQNITE  566

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+WH+LGLGYNP+V QK+IERAAVI
Sbjct  567  VYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRAWHILGLGYNPHVAQKEIERAAVI  626

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  627  HYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  661



>ref|XP_008794738.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Phoenix 
dactylifera]
Length=664

 Score =   291 bits (745),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL EWR++NITE
Sbjct  506  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLVEWRKQNITE  565

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLG+LPPGLITFWN T+ LDR+WH+LGLGYNP+V QK+IERAAVI
Sbjct  566  VYHSWQRLNHDRLLWKLGSLPPGLITFWNRTFPLDRAWHILGLGYNPHVAQKEIERAAVI  625

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS++++YDQVFLREC
Sbjct  626  HYNGNMKPWLEIGVPKYRNYWSKYVDYDQVFLREC  660



>gb|EEC83383.1| hypothetical protein OsI_28798 [Oryza sativa Indica Group]
Length=621

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKVIGVVETCGESFHRFDRYLNFSNP+I K+FDP ACGWAFGMN+ DL+EWRR+NITE
Sbjct  463  MKGKVIGVVETCGESFHRFDRYLNFSNPVIVKNFDPHACGWAFGMNVFDLAEWRRQNITE  522

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T  L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  523  IYHSWQKLNQDRLLWKLGTLPPGLITFWNKTLPLNRSWHVLGLGYNPHVSSRDIERAAVI  582

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFRNYWS +++YDQ FLREC
Sbjct  583  HYNGNMKPWLEIGLPKFRNYWSAYLDYDQPFLREC  617



>ref|NP_001061555.1| Os08g0327100 [Oryza sativa Japonica Group]
 dbj|BAD01674.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 dbj|BAD03445.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF23469.1| Os08g0327100 [Oryza sativa Japonica Group]
 gb|EEE68483.1| hypothetical protein OsJ_26894 [Oryza sativa Japonica Group]
Length=643

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKVIGVVETCGESFHRFDRYLNFSNP+I K+FDP ACGWAFGMN+ DL+EWRR+NITE
Sbjct  485  MKGKVIGVVETCGESFHRFDRYLNFSNPVIVKNFDPHACGWAFGMNVFDLAEWRRQNITE  544

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T  L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  545  IYHSWQKLNQDRLLWKLGTLPPGLITFWNKTLPLNRSWHVLGLGYNPHVSSRDIERAAVI  604

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFRNYWS +++YDQ FLREC
Sbjct  605  HYNGNMKPWLEIGLPKFRNYWSAYLDYDQPFLREC  639



>gb|KDO78641.1| hypothetical protein CISIN_1g005035mg [Citrus sinensis]
Length=717

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  559  LKGKVNGAVETCGETFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWRRQNITD  618

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAVI
Sbjct  619  VYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDRFWHVLGLGYNPSVNQRDIERAAVI  678

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  679  HYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  713



>ref|XP_006449975.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
 gb|ESR63215.1| hypothetical protein CICLE_v10014426mg [Citrus clementina]
Length=717

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  559  LKGKVNGAVETCGETFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWRRQNITD  618

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAVI
Sbjct  619  VYHTWQKMNHDRQLWKLGTLPPGLITFWKRTYPLDRFWHVLGLGYNPSVNQRDIERAAVI  678

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ ++YDQ++LREC
Sbjct  679  HYNGNMKPWLEINIPKYRNYWTKHVDYDQLYLREC  713



>ref|XP_007026430.1| Galacturonosyltransferase 4 isoform 1 [Theobroma cacao]
 gb|EOY29052.1| Galacturonosyltransferase 4 isoform 1 [Theobroma cacao]
Length=626

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL EWRR+NITE
Sbjct  468  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLEEWRRQNITE  527

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNPNV Q+++ERAAVI
Sbjct  528  VYHRWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPNVNQREVERAAVI  587

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++NYW+++++YD ++LR+C
Sbjct  588  HYNGNLKPWLEIGIPKYKNYWAKYVDYDNMYLRDC  622



>ref|XP_007026431.1| Galacturonosyltransferase 4 isoform 2 [Theobroma cacao]
 gb|EOY29053.1| Galacturonosyltransferase 4 isoform 2 [Theobroma cacao]
Length=624

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL EWRR+NITE
Sbjct  466  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLEEWRRQNITE  525

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNPNV Q+++ERAAVI
Sbjct  526  VYHRWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPNVNQREVERAAVI  585

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++NYW+++++YD ++LR+C
Sbjct  586  HYNGNLKPWLEIGIPKYKNYWAKYVDYDNMYLRDC  620



>ref|XP_004486385.1| PREDICTED: probable galacturonosyltransferase 4-like [Cicer arietinum]
Length=660

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLI+K+FDPRACGWA+GMN+ DL EW+R+ ITE
Sbjct  502  LKGNVNGAVETCGESFHRFDRYLNFSNPLIAKNFDPRACGWAYGMNVFDLVEWKRQKITE  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPN+ QKDIER+AV+
Sbjct  562  VYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHVLGLGYNPNINQKDIERSAVM  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR+YWS+++ Y+ VFLREC
Sbjct  622  HYNGNMKPWLEISIPKFRSYWSKYVNYNHVFLREC  656



>gb|ACF83776.1| unknown [Zea mays]
Length=180

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHR+DRYLNFSNP+I+KSFDP AC WAFGMN+ DL+EWRR+NITE
Sbjct  22   MKGKVNGAVETCGESFHRYDRYLNFSNPIITKSFDPHACVWAFGMNVFDLAEWRRQNITE  81

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RSWHVLGLGYNP+V  +DIE AAVI
Sbjct  82   IYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRSWHVLGLGYNPHVNSRDIEHAAVI  141

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  142  HYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  176



>ref|XP_006660049.1| PREDICTED: probable galacturonosyltransferase 4-like, partial 
[Oryza brachyantha]
Length=616

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKVIGVVETCGESFHRFDRYLNFSNP+I+K+FDP ACGWAFGMN+ DL+EWR++NITE
Sbjct  458  MKGKVIGVVETCGESFHRFDRYLNFSNPVIAKNFDPHACGWAFGMNVFDLAEWRQQNITE  517

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T+ L+RSWHVLGLGYNP+V  +DI RAAVI
Sbjct  518  IYHSWQKLNQDRLLWKLGTLPPGLITFWNKTFPLNRSWHVLGLGYNPHVSSRDIVRAAVI  577

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFRNYWS +++YDQ FLR+C
Sbjct  578  HYNGNMKPWLEIGLPKFRNYWSTYLDYDQPFLRDC  612



>ref|XP_010252974.1| PREDICTED: probable galacturonosyltransferase 4 [Nelumbo nucifera]
Length=697

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL EW+++NIT 
Sbjct  539  LKGKVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLEEWKKQNITG  598

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DR+LWKLGTLPPGLITFWN T  LDRSWHVLGLGYNP++ QK+IERAAVI
Sbjct  599  VYHTWQKLNHDRRLWKLGTLPPGLITFWNRTLPLDRSWHVLGLGYNPSMNQKEIERAAVI  658

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IP++RNYW+RFI YDQV+LREC
Sbjct  659  HYNGNMKPWLEIGIPRYRNYWARFIYYDQVYLREC  693



>ref|XP_009374812.1| PREDICTED: probable galacturonosyltransferase 4 [Pyrus x bretschneideri]
Length=671

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  513  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLKEWKKQNITE  572

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNP+V QK I+RAAVI
Sbjct  573  VYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNQKQIDRAAVI  632

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YDQ+++REC
Sbjct  633  HYNGNMKPWLEIGIPKYRNYWAKFVDYDQMYMREC  667



>ref|XP_002444200.1| hypothetical protein SORBIDRAFT_07g014890 [Sorghum bicolor]
 gb|EES13695.1| hypothetical protein SORBIDRAFT_07g014890 [Sorghum bicolor]
Length=648

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHR+DRYLNFSNP+I+KSFDP ACGWAFGMN+ DL+EWRR+NIT+
Sbjct  490  MKGKVNGAVETCGESFHRYDRYLNFSNPIIAKSFDPHACGWAFGMNVFDLAEWRRQNITQ  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T+ L RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  550  IYHSWQKLNEDRSLWKLGTLPPGLITFWNKTFPLSRSWHVLGLGYNPHVNSRDIERAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+R+YWS++++YDQ FLREC
Sbjct  610  HYNGNMKPWLEIGLPKYRSYWSKYLDYDQSFLREC  644



>ref|XP_004134994.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
Length=625

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISKSFDP ACGWA+GMNI DL EW+R+NITE
Sbjct  467  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKSFDPHACGWAYGMNIFDLDEWKRQNITE  526

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN DRQLWKLGTLPPGLITFW  TY LD+SWHVLGLGYN NV QK+I+RAAVI
Sbjct  527  VYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLDKSWHVLGLGYNTNVGQKEIDRAAVI  586

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  587  HYNGNMKPWLEIAIPKYRNYWTKHVDFDNVYLREC  621



>ref|XP_011460082.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=644

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL +W+++NITE
Sbjct  486  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITE  545

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW HTY LDRSWHVLGLGYNP+V QK+I+RAAVI
Sbjct  546  VYHRWQKLNHDRQLWKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVI  605

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R+YW+++++YD  ++REC
Sbjct  606  HYNGNMKPWLEIGIPKYRSYWAKYVDYDHKYMREC  640



>ref|XP_011460081.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=647

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL +W+++NITE
Sbjct  489  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITE  548

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW HTY LDRSWHVLGLGYNP+V QK+I+RAAVI
Sbjct  549  VYHRWQKLNHDRQLWKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVI  608

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R+YW+++++YD  ++REC
Sbjct  609  HYNGNMKPWLEIGIPKYRSYWAKYVDYDHKYMREC  643



>ref|XP_010272524.1| PREDICTED: probable galacturonosyltransferase 4 [Nelumbo nucifera]
Length=673

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD YLNFSNPLISK+FDP ACGWA+GMNI DL EW+++NITE
Sbjct  515  LKGKVNGAVETCGESFHRFDHYLNFSNPLISKNFDPHACGWAYGMNIFDLDEWKKQNITE  574

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DRQLWKLGTLPPGLITFWN T+ALDRSWH LGLGYNPN+  ++IE+AAVI
Sbjct  575  VYHTWQKLNQDRQLWKLGTLPPGLITFWNRTFALDRSWHALGLGYNPNINLEEIEQAAVI  634

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +P++RNYW++F+ YD+V+LREC
Sbjct  635  HYNGNMKPWLEIGLPQYRNYWAKFVNYDEVYLREC  669



>ref|XP_011460080.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=648

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL +W+++NITE
Sbjct  490  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITE  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW HTY LDRSWHVLGLGYNP+V QK+I+RAAVI
Sbjct  550  VYHRWQKLNHDRQLWKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R+YW+++++YD  ++REC
Sbjct  610  HYNGNMKPWLEIGIPKYRSYWAKYVDYDHKYMREC  644



>ref|XP_002882844.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59103.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  443  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  502

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH+LGLGYNP+V Q+DIERAAVI
Sbjct  503  VYHRWQDLNRDRELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERAAVI  562

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R++WS+ ++Y+QV+LREC
Sbjct  563  HYNGNLKPWLEIGIPRYRSFWSKHVDYEQVYLREC  597



>gb|KJB67441.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=395

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL+EWRR++ITE
Sbjct  237  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLAEWRRQSITE  296

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+SWHVLGLGYNPNV Q++I+RAAVI
Sbjct  297  VYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKSWHVLGLGYNPNVNQREIDRAAVI  356

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  357  HYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  391



>ref|XP_003535002.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
1 [Glycine max]
Length=657

 Score =   285 bits (729),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EW+R+NITE
Sbjct  499  LKGNVNGAVETCGESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWKRQNITE  558

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWH+LGLGYNPNV Q+DIE++AV+
Sbjct  559  VYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHILGLGYNPNVNQRDIEQSAVV  618

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW+ +++YD V+LREC
Sbjct  619  HYNGNMKPWLEISIPKFRRYWTNYVDYDHVYLREC  653



>ref|XP_008440950.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Cucumis 
melo]
Length=627

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL EW+R+NITE
Sbjct  469  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLDEWKRQNITE  528

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN DRQLWKLGTLPPGLITFW  TY L++SWHVLGLGYNPNV QK+I+RAAVI
Sbjct  529  VYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLNKSWHVLGLGYNPNVGQKEIDRAAVI  588

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  589  HYNGNMKPWLEIAIPKYRNYWAKHVDFDNVYLREC  623



>ref|XP_004158838.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
 gb|KGN49014.1| hypothetical protein Csa_6G510320 [Cucumis sativus]
Length=641

 Score =   285 bits (728),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISKSFDP ACGWA+GMNI DL EW+R+NITE
Sbjct  483  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKSFDPHACGWAYGMNIFDLDEWKRQNITE  542

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN DRQLWKLGTLPPGLITFW  TY LD+SWHVLGLGYN NV QK+I+RAAVI
Sbjct  543  VYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLDKSWHVLGLGYNTNVGQKEIDRAAVI  602

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  603  HYNGNMKPWLEIAIPKYRNYWTKHVDFDNVYLREC  637



>ref|XP_010910637.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=549

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC ESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EWR++NITE
Sbjct  391  LKGKVNGAVETCRESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWRKQNITE  450

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN+DR LWKLGTLPPGLITFWN T+ LDRSWHVLGLGYNP+V QK+IE+AAVI
Sbjct  451  LYHSWQKLNHDRLLWKLGTLPPGLITFWNRTFPLDRSWHVLGLGYNPHVVQKEIEQAAVI  510

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RN+WS++I YDQVFL++C
Sbjct  511  HYNGNMKPWLEIGMPKYRNHWSKYINYDQVFLQDC  545



>gb|KHN40761.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=652

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EW+R+NITE
Sbjct  494  LKGNVNGAVETCGESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWKRQNITE  553

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWH+LGLGYNPNV Q+DIE++AV+
Sbjct  554  VYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHILGLGYNPNVNQRDIEQSAVV  613

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW+ +++YD V+LREC
Sbjct  614  HYNGNMKPWLEISIPKFRRYWTNYVDYDHVYLREC  648



>ref|XP_008440947.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008440949.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Cucumis 
melo]
Length=641

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL EW+R+NITE
Sbjct  483  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLDEWKRQNITE  542

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN DRQLWKLGTLPPGLITFW  TY L++SWHVLGLGYNPNV QK+I+RAAVI
Sbjct  543  VYHSWQKLNYDRQLWKLGTLPPGLITFWKRTYQLNKSWHVLGLGYNPNVGQKEIDRAAVI  602

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPK+RNYW++ +++D V+LREC
Sbjct  603  HYNGNMKPWLEIAIPKYRNYWAKHVDFDNVYLREC  637



>ref|XP_006597630.1| PREDICTED: probable galacturonosyltransferase 4-like [Glycine 
max]
 gb|KHN14400.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=657

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EW+R+NIT 
Sbjct  499  LKGNVNGAVETCGESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWKRQNITG  558

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWH+LGLGYNPNV Q+DIE++AV+
Sbjct  559  VYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHILGLGYNPNVNQRDIEQSAVV  618

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR+YW+++++YD V+LREC
Sbjct  619  HYNGNMKPWLEISIPKFRSYWTKYVDYDHVYLREC  653



>ref|XP_008384215.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Malus 
domestica]
Length=669

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  511  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLKEWKKQNITE  570

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNP+V +K+I+RAAVI
Sbjct  571  VYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNRKEIDRAAVI  630

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YDQ+++REC
Sbjct  631  HYNGNMKPWLEIGIPKYRNYWAKFVDYDQMYMREC  665



>ref|XP_008384214.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Malus 
domestica]
Length=671

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  513  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLKEWKKQNITE  572

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNP+V +K+I+RAAVI
Sbjct  573  VYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNRKEIDRAAVI  632

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YDQ+++REC
Sbjct  633  HYNGNMKPWLEIGIPKYRNYWAKFVDYDQMYMREC  667



>gb|EPS65589.1| hypothetical protein M569_09187 [Genlisea aurea]
Length=625

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKVIGVVETCGE+FHRFDRYLNFS+PLISK+F PRACGWAFGMNI+DL  WR+ NIT+
Sbjct  467  MRGKVIGVVETCGENFHRFDRYLNFSHPLISKTFRPRACGWAFGMNIVDLGAWRKENITQ  526

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN +RQLWKLGTLPPGLITFWNHT++L++SWHVLGLGY+P V  KD++RA+VI
Sbjct  527  VYHKWQNLNQERQLWKLGTLPPGLITFWNHTFSLEKSWHVLGLGYDPTVAAKDVDRASVI  586

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLE+SIPKFRNYW+++++Y+ V+LREC
Sbjct  587  HYNGNLKPWLEVSIPKFRNYWNKYVDYEHVYLREC  621



>gb|KHF97487.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
 gb|KHG30551.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=569

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL+EWRR+NITE
Sbjct  411  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLAEWRRQNITE  470

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+SWHVLGLGYNPNV Q++I+RAAVI
Sbjct  471  VYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKSWHVLGLGYNPNVNQREIDRAAVI  530

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  531  HYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  565



>ref|XP_010234583.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Brachypodium 
distachyon]
Length=639

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHRFDRYLNFSNP+I+K+FDP ACGWAFGMN+ DL+EWRR++ITE
Sbjct  481  MKGKVNGAVETCGESFHRFDRYLNFSNPVIAKNFDPHACGWAFGMNVFDLAEWRRQDITE  540

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T+ L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  541  IYHSWQKLNEDRLLWKLGTLPPGLITFWNKTFPLNRSWHVLGLGYNPHVNSRDIERAAVI  600

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS+++ YDQ FLREC
Sbjct  601  HYNGNMKPWLEIGLPKFRSYWSKYLYYDQPFLREC  635



>ref|XP_003573698.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Brachypodium 
distachyon]
Length=660

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHRFDRYLNFSNP+I+K+FDP ACGWAFGMN+ DL+EWRR++ITE
Sbjct  502  MKGKVNGAVETCGESFHRFDRYLNFSNPVIAKNFDPHACGWAFGMNVFDLAEWRRQDITE  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T+ L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  562  IYHSWQKLNEDRLLWKLGTLPPGLITFWNKTFPLNRSWHVLGLGYNPHVNSRDIERAAVI  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS+++ YDQ FLREC
Sbjct  622  HYNGNMKPWLEIGLPKFRSYWSKYLYYDQPFLREC  656



>gb|KDP29029.1| hypothetical protein JCGZ_16418 [Jatropha curcas]
Length=644

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KG V G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EWRR+NIT+
Sbjct  486  MKGNVNGAVETCGENFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLKEWRRQNITD  545

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DR LWKLGTLPPGLITFW  TY+L+RSWHVLGLGYNP++ Q++IERAAVI
Sbjct  546  VYHNWQKLNHDRTLWKLGTLPPGLITFWKWTYSLERSWHVLGLGYNPSLNQREIERAAVI  605

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYWS++++YD V+LREC
Sbjct  606  HYNGNMKPWLEIGIPKYRNYWSKYVDYDHVYLREC  640



>ref|XP_008349398.1| PREDICTED: probable galacturonosyltransferase 4 [Malus domestica]
Length=554

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  396  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLEEWKKQNITE  455

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNP+V QK+I+ AAVI
Sbjct  456  VYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNQKEIDGAAVI  515

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  516  HYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  550



>ref|XP_004973216.1| PREDICTED: probable galacturonosyltransferase 4-like [Setaria 
italica]
Length=648

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHRFD YLNFSNP+I+K+FDP ACGWAFGMN+ DL+EW+R+NIT+
Sbjct  490  MKGKVNGAVETCGESFHRFDHYLNFSNPVIAKNFDPHACGWAFGMNVFDLAEWKRQNITQ  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T+ L RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  550  IYHSWQKLNQDRSLWKLGTLPPGLITFWNKTFPLSRSWHVLGLGYNPHVNSRDIERAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWSR+++YDQ FLREC
Sbjct  610  HYNGNMKPWLEIGLPKFRSYWSRYLDYDQHFLREC  644



>ref|XP_010910636.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Elaeis 
guineensis]
Length=645

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC ESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EWR++NITE
Sbjct  487  LKGKVNGAVETCRESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWRKQNITE  546

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN+DR LWKLGTLPPGLITFWN T+ LDRSWHVLGLGYNP+V QK+IE+AAVI
Sbjct  547  LYHSWQKLNHDRLLWKLGTLPPGLITFWNRTFPLDRSWHVLGLGYNPHVVQKEIEQAAVI  606

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RN+WS++I YDQVFL++C
Sbjct  607  HYNGNMKPWLEIGMPKYRNHWSKYINYDQVFLQDC  641



>ref|XP_007213869.1| hypothetical protein PRUPE_ppa018681mg [Prunus persica]
 gb|EMJ15068.1| hypothetical protein PRUPE_ppa018681mg [Prunus persica]
Length=659

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD RACGWA+GMNI DL EW+++NITE
Sbjct  501  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDARACGWAYGMNIFDLEEWKKQNITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNP+V QK+I+RAAVI
Sbjct  561  VYHRWQELNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNQKEIDRAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW ++++YD +++REC
Sbjct  621  HYNGNMKPWLEIGIPKYRNYWVKYVDYDHMYMREC  655



>ref|XP_010910633.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010910634.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010910635.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
Length=659

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC ESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EWR++NITE
Sbjct  501  LKGKVNGAVETCRESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWRKQNITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN+DR LWKLGTLPPGLITFWN T+ LDRSWHVLGLGYNP+V QK+IE+AAVI
Sbjct  561  LYHSWQKLNHDRLLWKLGTLPPGLITFWNRTFPLDRSWHVLGLGYNPHVVQKEIEQAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RN+WS++I YDQVFL++C
Sbjct  621  HYNGNMKPWLEIGMPKYRNHWSKYINYDQVFLQDC  655



>gb|KJB67439.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=606

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL+EWRR++ITE
Sbjct  448  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLAEWRRQSITE  507

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+SWHVLGLGYNPNV Q++I+RAAVI
Sbjct  508  VYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKSWHVLGLGYNPNVNQREIDRAAVI  567

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  568  HYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  602



>ref|NP_568688.1| probable galacturonosyltransferase 4 [Arabidopsis thaliana]
 sp|Q93ZX7.1|GAUT4_ARATH RecName: Full=Probable galacturonosyltransferase 4; AltName: 
Full=Like glycosyl transferase 3 [Arabidopsis thaliana]
 gb|AAL07051.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14333.1| unknown protein [Arabidopsis thaliana]
 gb|AED95571.1| probable galacturonosyltransferase 4 [Arabidopsis thaliana]
 gb|AHL38587.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=616

 Score =   281 bits (720),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  458  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  517

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH+LGLGYNP+V Q+DIERAAVI
Sbjct  518  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERAAVI  577

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  578  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  612



>gb|KJB67440.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=603

 Score =   281 bits (719),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL+EWRR++ITE
Sbjct  445  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLAEWRRQSITE  504

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+SWHVLGLGYNPNV Q++I+RAAVI
Sbjct  505  VYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKSWHVLGLGYNPNVNQREIDRAAVI  564

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  565  HYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  599



>dbj|BAB11325.1| unnamed protein product [Arabidopsis thaliana]
Length=615

 Score =   281 bits (720),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  457  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  516

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH+LGLGYNP+V Q+DIERAAVI
Sbjct  517  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERAAVI  576

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  577  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  611



>gb|KJB67437.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=620

 Score =   281 bits (720),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDP ACGWA+GMNI DL+EWRR++ITE
Sbjct  462  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLAEWRRQSITE  521

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLGTLPPGLITFW  TY+LD+SWHVLGLGYNPNV Q++I+RAAVI
Sbjct  522  VYHRWQRLNRDRQLWKLGTLPPGLITFWKRTYSLDKSWHVLGLGYNPNVNQREIDRAAVI  581

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK++ YW+++++Y+ V+LREC
Sbjct  582  HYNGNLKPWLEIGIPKYKIYWAKYVDYETVYLREC  616



>ref|XP_008677252.1| PREDICTED: transferase, transferring glycosyl groups isoform 
X1 [Zea mays]
 gb|ACN31213.1| unknown [Zea mays]
 gb|AFW60919.1| hypothetical protein ZEAMMB73_694281 [Zea mays]
Length=649

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHR+DRYLNFSNP+I+KSFDP AC WAFGMN+ DL+EWRR+NITE
Sbjct  491  MKGKVNGAVETCGESFHRYDRYLNFSNPIITKSFDPHACVWAFGMNVFDLAEWRRQNITE  550

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RSWHVLGLGYNP+V  +DIE AAVI
Sbjct  551  IYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRSWHVLGLGYNPHVNSRDIEHAAVI  610

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  611  HYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  645



>ref|XP_004499343.1| PREDICTED: probable galacturonosyltransferase 4-like [Cicer arietinum]
Length=658

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFDRYLNFSNPL++++FDPRACGWA+GMN+ DL  W+++NITE
Sbjct  500  LKGNVNGAVETCAESFHRFDRYLNFSNPLVARNFDPRACGWAYGMNVFDLVGWKKQNITE  559

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPNV QKDIERAAVI
Sbjct  560  VYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHVLGLGYNPNVNQKDIERAAVI  619

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW+++++YD V+LREC
Sbjct  620  HYNGNMKPWLEISIPKFRAYWTKYVDYDIVYLREC  654



>gb|AFW60920.1| transferase [Zea mays]
Length=648

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHR+DRYLNFSNP+I+KSFDP AC WAFGMN+ DL+EWRR+NITE
Sbjct  490  MKGKVNGAVETCGESFHRYDRYLNFSNPIITKSFDPHACVWAFGMNVFDLAEWRRQNITE  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RSWHVLGLGYNP+V  +DIE AAVI
Sbjct  550  IYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRSWHVLGLGYNPHVNSRDIEHAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  610  HYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  644



>ref|XP_010686598.1| PREDICTED: probable galacturonosyltransferase 4 [Beta vulgaris 
subsp. vulgaris]
Length=640

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE+FHRFDRYLNFSNP ISK+FDP ACGWA+GMNI DL EW+R+NIT+
Sbjct  482  LKGNVNGAVETCGETFHRFDRYLNFSNPHISKNFDPHACGWAYGMNIFDLEEWKRQNITD  541

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V  +DIERAAVI
Sbjct  542  VYHTWQKLNHDRQLWKLGTLPPGLITFWKTTYPLDRLWHVLGLGYNPSVNSRDIERAAVI  601

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R YWS++I+YDQV+LREC
Sbjct  602  HYNGNMKPWLEIGIPKYRGYWSKYIDYDQVYLREC  636



>ref|XP_009107093.1| PREDICTED: probable galacturonosyltransferase 4 [Brassica rapa]
Length=631

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  473  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  532

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR LWKLGTLPPGLITFW  TY LDR WHVLGLGYNP+V Q+DIERAAV+
Sbjct  533  VYHRWQNLNQDRDLWKLGTLPPGLITFWKRTYPLDRKWHVLGLGYNPSVNQRDIERAAVV  592

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK+R  WS+ ++Y  V+LREC
Sbjct  593  HYNGNLKPWLEIGIPKYRGLWSKHVDYQHVYLREC  627



>ref|NP_001148932.1| transferase, transferring glycosyl groups [Zea mays]
 gb|ACG33522.1| transferase, transferring glycosyl groups [Zea mays]
Length=648

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHR+DRYLNFSNP+I+KSFDP AC WAFGMN+ DL+EWRR+NITE
Sbjct  490  MKGKVNGAVETCGESFHRYDRYLNFSNPVITKSFDPHACVWAFGMNVFDLAEWRRQNITE  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGL+TFWN T+ L RSWHVLGLGYNP+V  +DIE AAVI
Sbjct  550  IYHSWQKLNEDRSLWKLGTLPPGLVTFWNKTFPLSRSWHVLGLGYNPHVNSRDIEHAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS++++YDQ FLREC
Sbjct  610  HYNGNMKPWLEIGLPKFRSYWSKYLDYDQSFLREC  644



>ref|XP_008358828.1| PREDICTED: probable galacturonosyltransferase 4 [Malus domestica]
Length=669

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  511  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLEEWKKQNITE  570

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRSWHVLGLGYNP+V QK+I+ AAVI
Sbjct  571  VYHGWQKLNHDRQLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNQKEIDGAAVI  630

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  631  HYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  665



>ref|XP_006279595.1| hypothetical protein CARUB_v10026096mg [Capsella rubella]
 gb|EOA12493.1| hypothetical protein CARUB_v10026096mg [Capsella rubella]
Length=614

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  456  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  515

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY L+R WH+LGLGYNP+V Q+DIERAAVI
Sbjct  516  VYHRWQDLNQDRELWKLGTLPPGLITFWRQTYPLERKWHILGLGYNPSVNQRDIERAAVI  575

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  576  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  610



>ref|XP_010481273.1| PREDICTED: probable galacturonosyltransferase 4 isoform X8 [Camelina 
sativa]
Length=618

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  460  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  519

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  520  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  579

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  580  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  614



>ref|XP_010481270.1| PREDICTED: probable galacturonosyltransferase 4 isoform X6 [Camelina 
sativa]
 ref|XP_010481271.1| PREDICTED: probable galacturonosyltransferase 4 isoform X7 [Camelina 
sativa]
Length=619

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  461  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  520

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  521  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  580

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  581  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  615



>ref|XP_010481267.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Camelina 
sativa]
 ref|XP_010481268.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Camelina 
sativa]
 ref|XP_010481269.1| PREDICTED: probable galacturonosyltransferase 4 isoform X5 [Camelina 
sativa]
Length=619

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  461  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  520

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  521  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  580

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  581  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  615



>ref|XP_010481265.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
 ref|XP_010481266.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=620

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  462  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  521

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  522  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  581

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  582  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  616



>ref|XP_008384326.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
4 [Malus domestica]
Length=554

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  396  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLEEWKKQNITE  455

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLIT W  TY LDRSWHVLGLGYNP+V QK+I+ AAVI
Sbjct  456  VYHGWQKLNHDRQLWKLGTLPPGLITXWKRTYPLDRSWHVLGLGYNPSVNQKEIDGAAVI  515

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  516  HYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  550



>gb|KHN40223.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=664

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE FHRFDRYLNFSNP I+K+FDPRACGWA+GMN+ DL +W+R+NITE
Sbjct  506  LKGNVNGAVETCGERFHRFDRYLNFSNPHIAKNFDPRACGWAYGMNVFDLVQWKRQNITE  565

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPN+ QK+IERAAVI
Sbjct  566  VYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFQLNRSWHVLGLGYNPNINQKEIERAAVI  625

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEIS PKFR YW+++++YD V+LREC
Sbjct  626  HYNGNMKPWLEISFPKFRGYWTKYVDYDLVYLREC  660



>ref|XP_006584115.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Glycine max]
 ref|XP_006584116.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Glycine max]
Length=664

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE FHRFDRYLNFSNP I+K+FDPRACGWA+GMN+ DL +W+R+NITE
Sbjct  506  LKGNVNGAVETCGERFHRFDRYLNFSNPHIAKNFDPRACGWAYGMNVFDLVQWKRQNITE  565

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPN+ QK+IERAAVI
Sbjct  566  VYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFQLNRSWHVLGLGYNPNINQKEIERAAVI  625

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEIS PKFR YW+++++YD V+LREC
Sbjct  626  HYNGNMKPWLEISFPKFRGYWTKYVDYDLVYLREC  660



>ref|XP_010942526.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=659

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDP +CGWA+GMN+ DL+EWR++ ITE
Sbjct  501  LKGKVNGAVETCGENFHRFDRYLNFSNPLISKNFDPHSCGWAYGMNVFDLAEWRKQKITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLGTLP GLITFWN T+ L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  561  VYHSWQRLNHDRLLWKLGTLPAGLITFWNRTFPLNRSWHVLGLGYNPHVAPRDIERAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS+++ YDQVFLREC
Sbjct  621  HYNGNMKPWLEIGMPKYRNYWSKYVNYDQVFLREC  655



>ref|XP_010942525.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Elaeis 
guineensis]
Length=659

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDP +CGWA+GMN+ DL+EWR++ ITE
Sbjct  501  LKGKVNGAVETCGENFHRFDRYLNFSNPLISKNFDPHSCGWAYGMNVFDLAEWRKQKITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLGTLP GLITFWN T+ L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  561  VYHSWQRLNHDRLLWKLGTLPAGLITFWNRTFPLNRSWHVLGLGYNPHVAPRDIERAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS+++ YDQVFLREC
Sbjct  621  HYNGNMKPWLEIGMPKYRNYWSKYVNYDQVFLREC  655



>ref|XP_010942524.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Elaeis 
guineensis]
Length=660

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFDRYLNFSNPLISK+FDP +CGWA+GMN+ DL+EWR++ ITE
Sbjct  502  LKGKVNGAVETCGENFHRFDRYLNFSNPLISKNFDPHSCGWAYGMNVFDLAEWRKQKITE  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DR LWKLGTLP GLITFWN T+ L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  562  VYHSWQRLNHDRLLWKLGTLPAGLITFWNRTFPLNRSWHVLGLGYNPHVAPRDIERAAVI  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PK+RNYWS+++ YDQVFLREC
Sbjct  622  HYNGNMKPWLEIGMPKYRNYWSKYVNYDQVFLREC  656



>ref|XP_006600275.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X1 [Glycine max]
 ref|XP_006600276.1| PREDICTED: probable galacturonosyltransferase 4-like isoform 
X2 [Glycine max]
Length=661

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE FHRFDRYLNFSNPLI+K+FDPRACGWA+GMN+ DL +W+R+NIT+
Sbjct  503  LKGNVNGAVETCGERFHRFDRYLNFSNPLIAKNFDPRACGWAYGMNVFDLVQWKRQNITD  562

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ +N+DRQLWKLGTLPPGLITFW  T+ L RSWHVLGLGYNPN+ QK+IERAAVI
Sbjct  563  VYHKWQKMNHDRQLWKLGTLPPGLITFWKRTFQLHRSWHVLGLGYNPNINQKEIERAAVI  622

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW+++++Y+ V+LREC
Sbjct  623  HYNGNMKPWLEISIPKFRGYWTKYVDYNLVYLREC  657



>ref|XP_010495019.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=623

 Score =   279 bits (714),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  465  LRGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  524

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  525  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  584

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  585  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  619



>ref|XP_010495018.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
Length=624

 Score =   279 bits (714),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  466  LRGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  525

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  526  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  585

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  586  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  620



>ref|XP_002525229.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF37195.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=647

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE FHRFDRYLNFSNPLISK+FDP ACGWA+GMN+ DL +W+R+NIT 
Sbjct  489  LKGNVNGAVETCGERFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLDQWKRQNITG  548

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DR LWKLGTLPPGLITFW  TY++DRSWHVLGLGYNPNV Q++IERAAVI
Sbjct  549  VYHTWQKLNHDRLLWKLGTLPPGLITFWKQTYSIDRSWHVLGLGYNPNVNQREIERAAVI  608

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI I K+RNYW+++++YD V+LREC
Sbjct  609  HYNGNLKPWLEIGISKYRNYWAKYVDYDHVYLREC  643



>ref|XP_010441404.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Camelina 
sativa]
Length=613

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R++ITE
Sbjct  455  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQHITE  514

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  515  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  574

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  575  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  609



>ref|XP_010441403.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Camelina 
sativa]
Length=613

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R++ITE
Sbjct  455  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQHITE  514

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY LDR WH LGLGYNP+V Q+DIERAAVI
Sbjct  515  VYHRWQDLNQDRELWKLGTLPPGLITFWRRTYPLDRKWHTLGLGYNPSVNQRDIERAAVI  574

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +WS+ ++Y+ V+LREC
Sbjct  575  HYNGNLKPWLEIGIPRYRGFWSKHVDYEHVYLREC  609



>ref|XP_009101378.1| PREDICTED: probable galacturonosyltransferase 4 [Brassica rapa]
Length=634

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NITE
Sbjct  476  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITE  535

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY L+R WHVLGLGYNP+V Q+DIERAAV+
Sbjct  536  VYHRWQNLNQDRELWKLGTLPPGLITFWKRTYPLERRWHVLGLGYNPSVNQRDIERAAVV  595

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+R  WS+ ++Y  V+LREC
Sbjct  596  HYNGNLKPWLEIGLPKYRGIWSKHVDYQHVYLREC  630



>ref|XP_010942295.1| PREDICTED: probable galacturonosyltransferase 4 [Elaeis guineensis]
Length=670

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRF++YLNFSNP+ISK+FDP+ACGWA+GMNI DL+EWR++NITE
Sbjct  512  LKGNVNGAVETCGESFHRFNQYLNFSNPIISKNFDPKACGWAYGMNIFDLAEWRKQNITE  571

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH+WQ LN+DRQLW LG+LPPGLITF+N T ALDRSWHVLGLGY+P+V Q++IERAAVI
Sbjct  572  IYHTWQELNHDRQLWSLGSLPPGLITFYNRTVALDRSWHVLGLGYDPDVNQREIERAAVI  631

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +P++RNYWS++++YDQV+LR C
Sbjct  632  HYNGNMKPWLEIGMPQYRNYWSKYVDYDQVYLRNC  666



>ref|XP_006373556.1| hypothetical protein POPTR_0016s00360g [Populus trichocarpa]
 gb|ERP51353.1| hypothetical protein POPTR_0016s00360g [Populus trichocarpa]
Length=665

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE+FHRFDRYLNFSNP ISK+FDPRACGWA+GMNI DL EW+R+NIT+
Sbjct  507  LKGNVNGAVETCGENFHRFDRYLNFSNPHISKNFDPRACGWAYGMNIFDLKEWKRQNITD  566

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR WHVLGLGYNPNV Q++IERAAVI
Sbjct  567  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDRRWHVLGLGYNPNVSQREIERAAVI  626

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R+ W+++++YD  +LREC
Sbjct  627  HYNGNMKPWLEIGIPKYRSNWAKYVDYDHAYLREC  661



>ref|XP_003594361.1| Galacturonosyltransferase [Medicago truncatula]
 gb|AES64612.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=667

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL +W+R+ ITE
Sbjct  509  LKGNVNGAVETCGESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLVQWKRQKITE  568

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+++WHVLGLGYNPNV QKDI+RAAV+
Sbjct  569  VYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNKAWHVLGLGYNPNVNQKDIDRAAVM  628

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW++++ Y+ V+LREC
Sbjct  629  HYNGNMKPWLEISIPKFRGYWTKYVNYNHVYLREC  663



>gb|ABN08854.1| Glycosyl transferase, family 8 [Medicago truncatula]
Length=680

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL +W+R+ ITE
Sbjct  522  LKGNVNGAVETCGESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLVQWKRQKITE  581

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+++WHVLGLGYNPNV QKDI+RAAV+
Sbjct  582  VYHNWQNLNHDRQLWKLGTLPPGLITFWKRTFPLNKAWHVLGLGYNPNVNQKDIDRAAVM  641

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW++++ Y+ V+LREC
Sbjct  642  HYNGNMKPWLEISIPKFRGYWTKYVNYNHVYLREC  676



>ref|XP_004168876.1| PREDICTED: probable galacturonosyltransferase 4-like [Cucumis 
sativus]
Length=649

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFD+YLNFSN LISK+FDPRACGWA+GMNI DL+EW+R+NIT 
Sbjct  491  LKGNVNGAVETCGESFHRFDKYLNFSNELISKNFDPRACGWAYGMNIFDLNEWKRQNITG  550

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDRSWHVLGLGYNP+V QK+IERAAVI
Sbjct  551  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDRSWHVLGLGYNPSVNQKEIERAAVI  610

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IP++RNYW ++++++Q +LR+C
Sbjct  611  HYNGNMKPWLEIAIPRYRNYWMKYVDFNQEYLRQC  645



>ref|XP_008775901.1| PREDICTED: probable galacturonosyltransferase 4 [Phoenix dactylifera]
Length=654

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD+YLNFSNP+ISK+FDP ACGWA+GMNI DL+EWR++NITE
Sbjct  496  LKGKVNGAVETCGESFHRFDKYLNFSNPIISKNFDPDACGWAYGMNIFDLAEWRKQNITE  555

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN+DR LW LGTLPPGLITF+N T+ALDRSWHVLGLGY+P+V Q DIERAAVI
Sbjct  556  IYHFWQELNHDRLLWSLGTLPPGLITFYNRTFALDRSWHVLGLGYDPDVNQTDIERAAVI  615

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +P++RNYWS++++YDQ +LR C
Sbjct  616  HYNGNMKPWLEIVMPQYRNYWSKYVDYDQPYLRAC  650



>ref|XP_011016525.1| PREDICTED: probable galacturonosyltransferase 4 [Populus euphratica]
Length=660

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EW+R+NIT+
Sbjct  502  LKGNVNGAVETCGENFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLKEWKRQNITD  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR WHVLGLGYNPNV  ++IERAAVI
Sbjct  562  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDRRWHVLGLGYNPNVSLREIERAAVI  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R+ W+++++YD  +LREC
Sbjct  622  HYNGNMKPWLEIGIPKYRSNWAKYVDYDHAYLREC  656



>ref|XP_011040102.1| PREDICTED: probable galacturonosyltransferase 4 [Populus euphratica]
Length=660

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE+FHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EW+R+NIT+
Sbjct  502  LKGNVNGAVETCGENFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLKEWKRQNITD  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDR WHVLGLGYNPNV  ++IERAAVI
Sbjct  562  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDRRWHVLGLGYNPNVSLREIERAAVI  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R+ W+++++YD  +LREC
Sbjct  622  HYNGNMKPWLEIGIPKYRSNWAKYVDYDHAYLREC  656



>ref|XP_008464310.1| PREDICTED: probable galacturonosyltransferase 4 [Cucumis melo]
Length=648

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFD+YLNFSN LISK+FDPRACGWA+GMNI DL EW+R+NIT+
Sbjct  490  LKGNVNGAVETCGESFHRFDKYLNFSNELISKNFDPRACGWAYGMNIFDLEEWKRQNITD  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ LDRSWHVLGLGYNP+V QK+IERAAVI
Sbjct  550  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTHPLDRSWHVLGLGYNPSVNQKEIERAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IP++RNYW ++++++  +LR+C
Sbjct  610  HYNGNMKPWLEIAIPRYRNYWMKYVDFNHEYLRQC  644



>ref|XP_007147564.1| hypothetical protein PHAVU_006G135100g [Phaseolus vulgaris]
 gb|ESW19558.1| hypothetical protein PHAVU_006G135100g [Phaseolus vulgaris]
Length=661

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFS+PLI+K+FDP ACGWA+GMNI DL +W+R+ ITE
Sbjct  503  LKGNVNGAVETCGESFHRFDRYLNFSHPLIAKNFDPHACGWAYGMNIFDLVQWKRQKITE  562

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPNV QKDIE++AV+
Sbjct  563  VYHNWQHLNRDRQLWKLGTLPPGLITFWKRTFPLNRSWHVLGLGYNPNVGQKDIEQSAVV  622

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR+YW+++++Y+ V+LREC
Sbjct  623  HYNGNMKPWLEISIPKFRSYWTKYVDYNHVYLREC  657



>ref|XP_006398488.1| hypothetical protein EUTSA_v10000819mg [Eutrema salsugineum]
 gb|ESQ39941.1| hypothetical protein EUTSA_v10000819mg [Eutrema salsugineum]
Length=631

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMNI DL EW+++NITE
Sbjct  473  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWKKQNITE  532

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQTLN  R+LWKLGTLPPGLITFW  TY LDR WH+LGLGYNP+V Q+DIER AVI
Sbjct  533  VYHRWQTLNEGRELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERGAVI  592

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IP++R +W++ ++Y+ V+LREC
Sbjct  593  HYNGNLKPWLEIGIPRYRGFWAKHVDYEHVYLREC  627



>gb|KHG17315.1| putative galacturonosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=611

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LK  V G VETCGESFHRFDRYLNFS+PLISK+FDP ACGWA+GMNI DL+EWRR+NITE
Sbjct  453  LKANVNGAVETCGESFHRFDRYLNFSHPLISKNFDPHACGWAYGMNIFDLAEWRRQNITE  512

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+ RQLWKLGTLPPGLITFW   + L+RSWHVLGLGYNPNV Q++IERAAVI
Sbjct  513  VYHRWQKLNHGRQLWKLGTLPPGLITFWKRIHPLNRSWHVLGLGYNPNVNQREIERAAVI  572

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI IPK+RNYW++++ YD V+LR+C
Sbjct  573  HYNGNLKPWLEIGIPKYRNYWAKYVHYDSVYLRDC  607



>gb|KGN65009.1| hypothetical protein Csa_1G179740 [Cucumis sativus]
Length=649

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFD+YLNFSN LISK+FDPRACGWA+GMNI DL+EW+R+NIT+
Sbjct  491  LKGNVNGAVETCGESFHRFDKYLNFSNELISKNFDPRACGWAYGMNIFDLNEWKRQNITD  550

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW   + LDRSWHVLGLGYNP+V QK+IERAAVI
Sbjct  551  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRIHPLDRSWHVLGLGYNPSVNQKEIERAAVI  610

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IP++RNYW ++++++Q +LR+C
Sbjct  611  HYNGNMKPWLEIAIPRYRNYWMKYVDFNQEYLRQC  645



>ref|XP_009395236.1| PREDICTED: probable galacturonosyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=636

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLI+++FDP ACGWAFGMN+ DL EWR++NI +
Sbjct  478  LKGKVNGAVETCGESFHRFDRYLNFSNPLIAENFDPHACGWAFGMNVFDLDEWRKQNIID  537

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQTLN DR LWKLGTLPPGLITFW  TY LDRSWHVLGLGYNPNV Q+DIE AA I
Sbjct  538  IYHHWQTLNEDRLLWKLGTLPPGLITFWKRTYPLDRSWHVLGLGYNPNVNQQDIEGAAAI  597

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI + K+ NYWS+++ YDQV+LR+C
Sbjct  598  HYNGNMKPWLEIGMAKYHNYWSKYVNYDQVYLRDC  632



>gb|KHN03562.1| Putative galacturonosyltransferase 4 [Glycine soja]
Length=656

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGE FHRFDRYLNFSNP I+K+FDPRACGWA+GMN+ DL +W+R+NIT+
Sbjct  498  LKGNVNGAVETCGERFHRFDRYLNFSNPHIAKNFDPRACGWAYGMNVFDLVQWKRQNITD  557

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ +N+DRQLWKLGTLPPGLITFW  T+ L RSWHVLGLGYNPN+ QK+IERAAVI
Sbjct  558  VYHNWQKMNHDRQLWKLGTLPPGLITFWKRTFQLHRSWHVLGLGYNPNINQKEIERAAVI  617

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEISIPKFR YW+++++Y+ V+LREC
Sbjct  618  HYNGNMKPWLEISIPKFRGYWTKYVDYNLVYLREC  652



>ref|XP_009363241.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
4 [Pyrus x bretschneideri]
Length=667

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VE+CGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  509  LKGNVNGAVESCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLEEWKKQNITE  568

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKL TLPPGLITFW  TY LDRSWHVLGLGYNP+V QK+I+ AAVI
Sbjct  569  VYHGWQKLNHDRQLWKLXTLPPGLITFWKRTYPLDRSWHVLGLGYNPSVNQKEIDGAAVI  628

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW++F++YD  ++REC
Sbjct  629  HYNGNMKPWLEIGIPKYRNYWAKFVDYDHTYMREC  663



>gb|AET04592.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=580

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG + G VETC + FHRFD YLNFSNPL++K+FDPRACGWA+GMN+ DL EW+++NITE
Sbjct  422  LKGNINGAVETCTKKFHRFDSYLNFSNPLVAKNFDPRACGWAYGMNVFDLVEWKKQNITE  481

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPNV QKDIERAAVI
Sbjct  482  VYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHVLGLGYNPNVNQKDIERAAVI  541

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKF+ YW+++++Y+  +LREC
Sbjct  542  HYNGNLKPWLEISIPKFKGYWTKYVDYESEYLREC  576



>ref|XP_008224656.1| PREDICTED: probable galacturonosyltransferase 4 [Prunus mume]
 ref|XP_008224657.1| PREDICTED: probable galacturonosyltransferase 4 [Prunus mume]
Length=658

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL EW+++NITE
Sbjct  500  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDAHACGWAYGMNIFDLEEWKKQNITE  559

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLPPGLITFW  TY LDRS HVLGLGYNP+V QK+I+RAAVI
Sbjct  560  VYHRWQELNHDRQLWKLGTLPPGLITFWKRTYPLDRSCHVLGLGYNPSVNQKEIDRAAVI  619

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+RNYW ++++YD +++REC
Sbjct  620  HYNGNMKPWLEIGIPKYRNYWVKYVDYDHMYMREC  654



>gb|KFK31342.1| hypothetical protein AALP_AA6G099900 [Arabis alpina]
Length=651

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FDPRACGWA+GMN+ DL EW+R+NIT+
Sbjct  493  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITD  552

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR+LWKLGTLPPGLITFW  TY +DR WH LGLGYNP+V Q+DIERAAVI
Sbjct  553  VYHRWQDLNQDRELWKLGTLPPGLITFWKRTYPIDRKWHTLGLGYNPSVNQRDIERAAVI  612

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +P++R +WS+ ++Y  V+LREC
Sbjct  613  HYNGNLKPWLEIGLPRYRGFWSKHVDYGHVYLREC  647



>ref|XP_004959557.1| PREDICTED: probable galacturonosyltransferase 4-like [Setaria 
italica]
Length=753

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC E+FHRFD+YLNFSNPLI+K+FDP ACGWA+GMNI DLSEWR++NITE
Sbjct  595  LKGKVNGAVETCRETFHRFDKYLNFSNPLIAKNFDPHACGWAYGMNIFDLSEWRKQNITE  654

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN +R LWKLGTLP GL+TFWN T+ LDRSWH LGLGYNPNV +KDI RAAVI
Sbjct  655  VYHTWQKLNENRLLWKLGTLPAGLVTFWNRTFPLDRSWHQLGLGYNPNVNEKDIRRAAVI  714

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+R YWSR +++DQVFLREC
Sbjct  715  HYNGNLKPWLEIGLPKYRKYWSRHVDFDQVFLREC  749



>emb|CAJ19325.1| glycosyl transferase-like protein [Triticum aestivum]
Length=697

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD+YLNFSNPLI+ +FDP ACGWA+GMN+ DLSEWR++NIT+
Sbjct  539  LKGKVNGAVETCGESFHRFDKYLNFSNPLIASNFDPHACGWAYGMNMFDLSEWRKQNITD  598

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DR LWKLG+LP GL+TFWNHT+ LDRSWH+LGLGYNPNV +K+I RA+VI
Sbjct  599  VYHTWQNLNEDRLLWKLGSLPAGLVTFWNHTFPLDRSWHLLGLGYNPNVNEKEIRRASVI  658

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  659  HYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  693



>ref|XP_007154076.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
 gb|ESW26070.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
Length=655

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMNI DL +W+++NITE
Sbjct  497  LKGNVNGAVETCRESFHRFDRYLNFSNPLIAKNFDPNACGWAYGMNIFDLVQWKKQNITE  556

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DR+LWKLGTLPPGLITFW  T+ L RSWHVLGLGYNPN  QK+IERAAVI
Sbjct  557  VYHNWQKLNHDRRLWKLGTLPPGLITFWKRTFPLHRSWHVLGLGYNPNTNQKEIERAAVI  616

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPKFR YW++++++D V+LREC
Sbjct  617  HYNGNMKPWLEITIPKFRGYWTKYVDHDLVYLREC  651



>ref|XP_007154077.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
 gb|ESW26071.1| hypothetical protein PHAVU_003G088900g [Phaseolus vulgaris]
Length=663

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFDRYLNFSNPLI+K+FDP ACGWA+GMNI DL +W+++NITE
Sbjct  505  LKGNVNGAVETCRESFHRFDRYLNFSNPLIAKNFDPNACGWAYGMNIFDLVQWKKQNITE  564

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DR+LWKLGTLPPGLITFW  T+ L RSWHVLGLGYNPN  QK+IERAAVI
Sbjct  565  VYHNWQKLNHDRRLWKLGTLPPGLITFWKRTFPLHRSWHVLGLGYNPNTNQKEIERAAVI  624

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI+IPKFR YW++++++D V+LREC
Sbjct  625  HYNGNMKPWLEITIPKFRGYWTKYVDHDLVYLREC  659



>ref|XP_010647025.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Vitis 
vinifera]
 ref|XP_010647026.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Vitis 
vinifera]
 emb|CBI18781.3| unnamed protein product [Vitis vinifera]
Length=638

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL +W++++ITE
Sbjct  480  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDSHACGWAYGMNIFDLDQWKKQHITE  539

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ +DRSWHVLGLGYNP+V +++IERAAVI
Sbjct  540  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTFPIDRSWHVLGLGYNPSVNRREIERAAVI  599

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  600  HYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  634



>ref|XP_010647027.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Vitis 
vinifera]
Length=637

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL +W++++ITE
Sbjct  479  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDSHACGWAYGMNIFDLDQWKKQHITE  538

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ +DRSWHVLGLGYNP+V +++IERAAVI
Sbjct  539  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTFPIDRSWHVLGLGYNPSVNRREIERAAVI  598

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  599  HYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  633



>ref|XP_002308736.1| hypothetical protein POPTR_0006s00320g [Populus trichocarpa]
 gb|EEE92259.1| hypothetical protein POPTR_0006s00320g [Populus trichocarpa]
Length=648

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC ESFHRFD YLNFSNPLIS +FDPRACGWA+GMN+ DL EW+R+NIT+
Sbjct  490  LKGKVNGAVETCRESFHRFDTYLNFSNPLISNNFDPRACGWAYGMNLFDLEEWKRQNITD  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLIT W  T+ LDR WHVLGLGYNPNV Q +IER AVI
Sbjct  550  VYHSWQKLNHDRQLWKLGTLPPGLITLWKRTHPLDRRWHVLGLGYNPNVSQIEIERGAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R YW+++++Y  V+LREC
Sbjct  610  HYNGNMKPWLEIGIPKYRKYWAKYVDYVNVYLREC  644



>ref|XP_010647084.1| PREDICTED: probable galacturonosyltransferase 4 [Vitis vinifera]
Length=638

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL +W++++ITE
Sbjct  480  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDSHACGWAYGMNIFDLDQWKKQHITE  539

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T  +DRSWHVLGLGYNP+V +++IERAAVI
Sbjct  540  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTLPIDRSWHVLGLGYNPSVNRREIERAAVI  599

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  600  HYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  634



>ref|XP_009390606.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLI+++FDP ACGWA+GMN+ DL EW+++NIT+
Sbjct  458  LKGKVNGAVETCGESFHRFDRYLNFSNPLIAETFDPHACGWAYGMNVFDLDEWKKQNITD  517

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RSWHVLGLGY+ NV QKD+E AAVI
Sbjct  518  VYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERSWHVLGLGYSLNVEQKDVEAAAVI  577

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  578  HYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  612



>ref|XP_009390607.1| PREDICTED: probable galacturonosyltransferase 4 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLI+++FDP ACGWA+GMN+ DL EW+++NIT+
Sbjct  458  LKGKVNGAVETCGESFHRFDRYLNFSNPLIAETFDPHACGWAYGMNVFDLDEWKKQNITD  517

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RSWHVLGLGY+ NV QKD+E AAVI
Sbjct  518  VYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERSWHVLGLGYSLNVEQKDVEAAAVI  577

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  578  HYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  612



>ref|XP_009390604.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=617

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLI+++FDP ACGWA+GMN+ DL EW+++NIT+
Sbjct  459  LKGKVNGAVETCGESFHRFDRYLNFSNPLIAETFDPHACGWAYGMNVFDLDEWKKQNITD  518

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RSWHVLGLGY+ NV QKD+E AAVI
Sbjct  519  VYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERSWHVLGLGYSLNVEQKDVEAAAVI  578

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  579  HYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  613



>ref|XP_009390605.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFDRYLNFSNPLI+++FDP ACGWA+GMN+ DL EW+++NIT+
Sbjct  458  LKGKVNGAVETCGESFHRFDRYLNFSNPLIAETFDPHACGWAYGMNVFDLDEWKKQNITD  517

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN+DRQLWKLGTLP GLITFWN TY L+RSWHVLGLGY+ NV QKD+E AAVI
Sbjct  518  VYHHWQNLNDDRQLWKLGTLPAGLITFWNSTYPLERSWHVLGLGYSLNVEQKDVEAAAVI  577

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+RN+WS +++Y+Q +LR+C
Sbjct  578  HYNGNLKPWLEIGMTKYRNFWSNYVDYNQAYLRDC  612



>emb|CAJ26362.1| glycosyl transferase-like protein [Brachypodium sylvaticum]
Length=689

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFD+YLNFSNP+++ +F P+ACGWAFGMN+ DLSEWR++NIT+
Sbjct  531  LKGKVNGAVETCGETFHRFDKYLNFSNPIVANNFHPQACGWAFGMNMFDLSEWRKQNITD  590

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DR LWKLGTLP GL+TFWN T+ LDRSWH+LGLGYNPNV ++DI RA+VI
Sbjct  591  VYHTWQKLNEDRLLWKLGTLPAGLVTFWNRTFPLDRSWHLLGLGYNPNVNERDIRRASVI  650

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWSR++++DQ+FLREC
Sbjct  651  HYNGNLKPWLEIGLSKYRKYWSRYVDFDQIFLREC  685



>ref|XP_003630117.1| Nudix hydrolase [Medicago truncatula]
Length=868

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG + G VETC + FHRFD YLNFSNPL++K+FDPRACGWA+GMN+ DL EW+++NITE
Sbjct  710  LKGNINGAVETCTKKFHRFDSYLNFSNPLVAKNFDPRACGWAYGMNVFDLVEWKKQNITE  769

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPNV QKDIERAAVI
Sbjct  770  VYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHVLGLGYNPNVNQKDIERAAVI  829

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKF+ YW+++++Y+  +LREC
Sbjct  830  HYNGNLKPWLEISIPKFKGYWTKYVDYESEYLREC  864



>ref|XP_003630116.1| Nudix hydrolase [Medicago truncatula]
Length=886

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG + G VETC + FHRFD YLNFSNPL++K+FDPRACGWA+GMN+ DL EW+++NITE
Sbjct  728  LKGNINGAVETCTKKFHRFDSYLNFSNPLVAKNFDPRACGWAYGMNVFDLVEWKKQNITE  787

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T+ L+RSWHVLGLGYNPNV QKDIERAAVI
Sbjct  788  VYHNWQKLNHDRQLWKLGTLPPGLITFWKRTFPLNRSWHVLGLGYNPNVNQKDIERAAVI  847

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEISIPKF+ YW+++++Y+  +LREC
Sbjct  848  HYNGNLKPWLEISIPKFKGYWTKYVDYESEYLREC  882



>ref|XP_008782990.1| PREDICTED: probable galacturonosyltransferase 4 [Phoenix dactylifera]
Length=659

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC  SFHRFDRYLNFSNPLI+K+FDP ACGWA+GMN+ DL+EWR++NITE
Sbjct  501  LKGKVNGAVETCRGSFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWRKQNITE  560

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN+DR LWKLGTLPPGLITFW  T+ LD+SWHVLGLGYNP+V QK+IE+AAVI
Sbjct  561  LYHSWQKLNHDRLLWKLGTLPPGLITFWKRTFPLDQSWHVLGLGYNPHVDQKEIEQAAVI  620

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYN NLKPWLEI + K+RNYWS++I YDQVFL++C
Sbjct  621  HYNRNLKPWLEIGMLKYRNYWSKYINYDQVFLQDC  655



>ref|XP_006661357.1| PREDICTED: probable galacturonosyltransferase 4-like [Oryza brachyantha]
Length=688

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFD+YLNFSNPLI+ +FDPRACGWA+GMN+ DLSEWRR+ IT 
Sbjct  530  LKGKVNGAVETCGETFHRFDKYLNFSNPLIANNFDPRACGWAYGMNLFDLSEWRRQKITN  589

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN +RQLWKLGTLP GL+TFWN T+ LD SWH LGLGYNPN+ +KDI RA+VI
Sbjct  590  VYHNWQRLNENRQLWKLGTLPAGLVTFWNRTFPLDHSWHQLGLGYNPNINEKDIRRASVI  649

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWS++I++DQVFLR+C
Sbjct  650  HYNGNLKPWLEIGLAKYRKYWSKYIDFDQVFLRDC  684



>gb|EMS45059.1| putative galacturonosyltransferase 4 [Triticum urartu]
Length=674

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD+YLNFSNPLI+ +F+P ACGWA+GMN+ DLSEWR++NIT+
Sbjct  516  LKGKVNGAVETCGESFHRFDKYLNFSNPLIASNFNPHACGWAYGMNMFDLSEWRKQNITD  575

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DR LWKLG+LP GL+TFWN T+ LDRSWH+LGLGYNPNV +K+I RA+VI
Sbjct  576  VYHTWQNLNEDRLLWKLGSLPAGLVTFWNRTFPLDRSWHLLGLGYNPNVNEKEIRRASVI  635

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  636  HYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  670



>gb|EMT04178.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=670

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD+YLNFSNPLI+ +F+P ACGWA+GMN+ DLSEWR++NIT+
Sbjct  512  LKGKVNGAVETCGESFHRFDKYLNFSNPLIASNFNPHACGWAYGMNMFDLSEWRKQNITD  571

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DR LWKLG+LP GL+TFWN T+ LDRSWH+LGLGYNPNV +K+I RA+VI
Sbjct  572  VYHTWQNLNEDRLLWKLGSLPAGLVTFWNRTFPLDRSWHLLGLGYNPNVNEKEIRRASVI  631

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  632  HYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  666



>ref|XP_011005780.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Populus 
euphratica]
 ref|XP_011005781.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Populus 
euphratica]
Length=655

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD YLNFSNPLIS +FDPRACGWA+GMN+ DL EW+R+NIT+
Sbjct  497  LKGNVNGAVETCRESFHRFDTYLNFSNPLISNNFDPRACGWAYGMNLFDLEEWKRQNITD  556

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLIT W  T+ LDR WHVLGLGYNP V Q +IER AVI
Sbjct  557  VYHSWQKLNHDRQLWKLGTLPPGLITLWKRTHPLDRRWHVLGLGYNPIVSQIEIERGAVI  616

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R YW+++++YD V+LREC
Sbjct  617  HYNGNMKPWLEIGIPKYRKYWAKYVDYDNVYLREC  651



>ref|XP_011005782.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Populus 
euphratica]
Length=648

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD YLNFSNPLIS +FDPRACGWA+GMN+ DL EW+R+NIT+
Sbjct  490  LKGNVNGAVETCRESFHRFDTYLNFSNPLISNNFDPRACGWAYGMNLFDLEEWKRQNITD  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYHSWQ LN+DRQLWKLGTLPPGLIT W  T+ LDR WHVLGLGYNP V Q +IER AVI
Sbjct  550  VYHSWQKLNHDRQLWKLGTLPPGLITLWKRTHPLDRRWHVLGLGYNPIVSQIEIERGAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI IPK+R YW+++++YD V+LREC
Sbjct  610  HYNGNMKPWLEIGIPKYRKYWAKYVDYDNVYLREC  644



>ref|XP_002460421.1| hypothetical protein SORBIDRAFT_02g027840 [Sorghum bicolor]
 gb|EER96942.1| hypothetical protein SORBIDRAFT_02g027840 [Sorghum bicolor]
Length=705

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC ++FHRFD+YLNFSNPLI+K+FDP ACGWA+GMN+ DLSEWR++NITE
Sbjct  547  LKGKVNGAVETCRQAFHRFDKYLNFSNPLIAKNFDPHACGWAYGMNMFDLSEWRKQNITE  606

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN +R LWKLGTLP GL+TFWN T+ LD SWH LGLGYNPNV +KDI RAAVI
Sbjct  607  VYHTWQKLNENRLLWKLGTLPAGLVTFWNRTFPLDHSWHQLGLGYNPNVNEKDIRRAAVI  666

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+R YWS  + YDQVFLREC
Sbjct  667  HYNGNLKPWLEIGLPKYRKYWSAHVNYDQVFLREC  701



>gb|EPS62143.1| hypothetical protein M569_12650, partial [Genlisea aurea]
Length=475

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV+G VETCGE FHRFD YLNFSNPLI+KSFDPRACGWAFGMN+ DL EWRR+NIT 
Sbjct  318  LNGKVVGAVETCGEKFHRFDHYLNFSNPLIAKSFDPRACGWAFGMNVFDLREWRRQNITR  377

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN +R LWKLGTLPPGL+TFWN ++AL++SWHVLGLGY+     +DIERAAVI
Sbjct  378  IYHRWQELNEERLLWKLGTLPPGLLTFWNRSFALEKSWHVLGLGYDAKTSTRDIERAAVI  437

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWLEI I KFR+YW+++++YDQ +LR+C
Sbjct  438  HYNGNAKPWLEIGIAKFRSYWTKYVDYDQRYLRDC  472



>emb|CAN70213.1| hypothetical protein VITISV_038741 [Vitis vinifera]
Length=759

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCGESFHRFDRYLNFSNPLISK+FD  ACGWA+GMNI DL +W++++ITE
Sbjct  601  LKGNVNGAVETCGESFHRFDRYLNFSNPLISKNFDSHACGWAYGMNIFDLDQWKKQHITE  660

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN+DRQLWKLGTLPPGLITFW  T  +DRSWHVLGLGYNP+V +++IERAAVI
Sbjct  661  VYHTWQKLNHDRQLWKLGTLPPGLITFWKRTXPIDRSWHVLGLGYNPSVNRREIERAAVI  720

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PKFRNYW++F ++D  +LR+C
Sbjct  721  HYNGNLKPWLEIGMPKFRNYWAKFADFDNEYLRDC  755



>dbj|BAK01477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=697

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD+YLNFSNPLI+ +F+P +CGWA+GMN+ DLSEWR++NIT+
Sbjct  539  LKGKVNGAVETCGESFHRFDKYLNFSNPLIASNFNPHSCGWAYGMNMFDLSEWRKQNITD  598

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DR LWKLG+LP GL+TFWN T+ LDRSWH+LGLGYNPNV +K+I RA+VI
Sbjct  599  VYHTWQNLNEDRLLWKLGSLPAGLVTFWNRTFPLDRSWHLLGLGYNPNVNEKEIRRASVI  658

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWSR + YDQVF+REC
Sbjct  659  HYNGNLKPWLEIGLSKYRKYWSRHVNYDQVFIREC  693



>ref|XP_008670271.1| PREDICTED: probable galacturonosyltransferase 4 [Zea mays]
 tpg|DAA40342.1| TPA: hypothetical protein ZEAMMB73_504957 [Zea mays]
Length=713

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETC + FHRFD+YLNFSNPLI+K+FDP ACGWA+GMN+ DLS+WR++NITE
Sbjct  555  LKGKVNGAVETCRQDFHRFDKYLNFSNPLIAKNFDPHACGWAYGMNMFDLSDWRKQNITE  614

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN +R LWKLGTLP GL+TFWN T+ LDRSWH LGLGYNPNV  KDI RAAVI
Sbjct  615  VYHTWQKLNENRLLWKLGTLPAGLVTFWNRTFPLDRSWHQLGLGYNPNVNVKDIRRAAVI  674

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PK+R YWS  + YDQVFLREC
Sbjct  675  HYNGNLKPWLEIGLPKYRKYWSAHVNYDQVFLREC  709



>ref|XP_004974813.1| PREDICTED: probable galacturonosyltransferase 4-like [Setaria 
italica]
Length=687

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G V TCGE+FH FDRYLNFSNPLI+K FD RACGWA+GMN+ DLSEWR++NIT+
Sbjct  529  LKGKVNGAVHTCGETFHMFDRYLNFSNPLIAKKFDRRACGWAYGMNMFDLSEWRKQNITD  588

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
             YH WQ LN +RQLWKLGTLP GL+TFWNHT+ LDRSWH+LGLGY PNV Q+DIERAAV+
Sbjct  589  AYHYWQNLNANRQLWKLGTLPAGLVTFWNHTFPLDRSWHLLGLGYKPNVNQRDIERAAVV  648

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWLEI +P++R +WS+++ +D VFLREC
Sbjct  649  HYNGNRKPWLEIGLPRYRQFWSKYVNFDHVFLREC  683



>ref|XP_006857626.1| hypothetical protein AMTR_s00061p00126570 [Amborella trichopoda]
 gb|ERN19093.1| hypothetical protein AMTR_s00061p00126570 [Amborella trichopoda]
Length=672

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGK+ G VETC ESFHRFDRYLNFSNPLISK+F+  ACGWAFGMNI DL EW+++ ITE
Sbjct  514  LKGKINGAVETCRESFHRFDRYLNFSNPLISKNFEAHACGWAFGMNIFDLKEWKKQEITE  573

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LNNDRQLWKLGTLPPGLITF+N T+ L+R WHVLGLGY+P+V Q+DI+RAA I
Sbjct  574  IYHSWQKLNNDRQLWKLGTLPPGLITFYNRTFPLNRGWHVLGLGYDPSVNQRDIQRAAAI  633

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI +PKFR YW ++I Y+Q +L++C
Sbjct  634  HYNGNLKPWLEIGLPKFRGYWQKYINYNQPYLQDC  668



>ref|XP_003578298.1| PREDICTED: probable galacturonosyltransferase 4 [Brachypodium 
distachyon]
Length=696

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFD+YLNFSNP+I+ +F PRACGWA+GMN+ DLSEWR++NIT+
Sbjct  538  LKGKVNGAVETCGETFHRFDKYLNFSNPIIANNFHPRACGWAYGMNMFDLSEWRKQNITD  597

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN DR LWKLGTLP GL+TFWN T+ LD SWH+LGLGYN NV ++DI RA+VI
Sbjct  598  VYHTWQKLNEDRLLWKLGTLPAGLVTFWNRTFPLDSSWHLLGLGYNTNVNERDIRRASVI  657

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+R YWSR++++DQ+FLREC
Sbjct  658  HYNGNLKPWLEIGLSKYRKYWSRYVDFDQIFLREC  692



>ref|XP_010538434.1| PREDICTED: probable galacturonosyltransferase 4 [Tarenaya hassleriana]
Length=649

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETCG+SFHRFDRYLNFSNPLI+++FDP ACGWA+GMNI DL EW+R+NITE
Sbjct  491  LKGNVNGAVETCGQSFHRFDRYLNFSNPLIAENFDPHACGWAYGMNIFDLDEWKRQNITE  550

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DR LWKLGTLPPGLITFW  T+ LDR+WHVLGLGYNP+V  +DI RAAVI
Sbjct  551  VYHRWQNLNQDRSLWKLGTLPPGLITFWKRTHPLDRNWHVLGLGYNPSVNPRDIGRAAVI  610

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI I ++R YWS++++Y+  ++REC
Sbjct  611  HYNGNLKPWLEIGITRYRGYWSKYVDYEHEYMREC  645



>ref|XP_009398761.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=675

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G +ETCG+SFHRFD+YLNFSNPLI+K F+PRACGWA+GMN+ DL EWR++ +TE
Sbjct  517  MKGKVNGAIETCGQSFHRFDKYLNFSNPLIAKRFNPRACGWAYGMNVFDLDEWRKQKVTE  576

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLG+LPPGLITF+N T ++DR WHVLGLGYNP+V  KDIE+AAVI
Sbjct  577  VYHYWQNLNIDRQLWKLGSLPPGLITFYNRTLSIDRRWHVLGLGYNPHVDHKDIEQAAVI  636

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWL+I IP++R YWS+ ++Y+ +FLREC
Sbjct  637  HYNGNMKPWLDIGIPQYRGYWSKNVDYNHIFLREC  671



>ref|XP_009398763.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=663

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G +ETCG+SFHRFD+YLNFSNPLI+K F+PRACGWA+GMN+ DL EWR++ +TE
Sbjct  505  MKGKVNGAIETCGQSFHRFDKYLNFSNPLIAKRFNPRACGWAYGMNVFDLDEWRKQKVTE  564

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLG+LPPGLITF+N T ++DR WHVLGLGYNP+V  KDIE+AAVI
Sbjct  565  VYHYWQNLNIDRQLWKLGSLPPGLITFYNRTLSIDRRWHVLGLGYNPHVDHKDIEQAAVI  624

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWL+I IP++R YWS+ ++Y+ +FLREC
Sbjct  625  HYNGNMKPWLDIGIPQYRGYWSKNVDYNHIFLREC  659



>ref|XP_009398760.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G +ETCG+SFHRFD+YLNFSNPLI+K F+PRACGWA+GMN+ DL EWR++ +TE
Sbjct  526  MKGKVNGAIETCGQSFHRFDKYLNFSNPLIAKRFNPRACGWAYGMNVFDLDEWRKQKVTE  585

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLWKLG+LPPGLITF+N T ++DR WHVLGLGYNP+V  KDIE+AAVI
Sbjct  586  VYHYWQNLNIDRQLWKLGSLPPGLITFYNRTLSIDRRWHVLGLGYNPHVDHKDIEQAAVI  645

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWL+I IP++R YWS+ ++Y+ +FLREC
Sbjct  646  HYNGNMKPWLDIGIPQYRGYWSKNVDYNHIFLREC  680



>gb|EMS56269.1| putative galacturonosyltransferase 4 [Triticum urartu]
Length=689

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFHRFDRYLNFS+P+++K+FDP AC WAFGMN+ DL+EWRR+NITE
Sbjct  531  MKGKVNGAVETCGESFHRFDRYLNFSSPVVAKNFDPNACVWAFGMNLFDLAEWRRQNITE  590

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN D  LWKLGTLP GL+TFWN T+ LDRSWH+LGLGYNP+V    +ERAAVI
Sbjct  591  IYHFWQKLNEDGLLWKLGTLPLGLVTFWNKTFPLDRSWHILGLGYNPHVSSSGLERAAVI  650

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS +++YDQ FLREC
Sbjct  651  HYNGNMKPWLEIGLPKFRSYWSEYLDYDQPFLREC  685



>gb|EAZ09508.1| hypothetical protein OsI_31783 [Oryza sativa Indica Group]
Length=679

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFD+YLNFSNPLI+ +FDPRACGWA+GMN+ DLSEWRR+ IT+
Sbjct  521  LKGKVNGAVETCGETFHRFDKYLNFSNPLIASNFDPRACGWAYGMNVFDLSEWRRQKITD  580

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN +R LWKLGTLP GL+TFWN T+ L  SWH LGLGYNPN+ +KDI RA+VI
Sbjct  581  VYHNWQRLNENRILWKLGTLPAGLVTFWNRTFPLHHSWHQLGLGYNPNINEKDIRRASVI  640

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + ++R YWS+++++DQVFLR+C
Sbjct  641  HYNGNLKPWLEIGLSRYRKYWSKYVDFDQVFLRDC  675



>ref|NP_001063487.1| Os09g0480400 [Oryza sativa Japonica Group]
 dbj|BAD33390.1| glycosyltransferase family-like [Oryza sativa Japonica Group]
 dbj|BAD46337.1| glycosyltransferase family-like [Oryza sativa Japonica Group]
 dbj|BAF25401.1| Os09g0480400 [Oryza sativa Japonica Group]
 dbj|BAG94697.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69919.1| hypothetical protein OsJ_29771 [Oryza sativa Japonica Group]
Length=707

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGE+FHRFD+YLNFSNPLI+ +FDPRACGWA+GMN+ DLSEWRR+ IT+
Sbjct  549  LKGKVNGAVETCGETFHRFDKYLNFSNPLIASNFDPRACGWAYGMNVFDLSEWRRQKITD  608

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH+WQ LN +R LWKLGTLP GL+TFWN T+ L  SWH LGLGYNPN+ +KDI RA+VI
Sbjct  609  VYHNWQRLNENRILWKLGTLPAGLVTFWNRTFPLHHSWHQLGLGYNPNINEKDIRRASVI  668

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + ++R YWS+++++DQVFLR+C
Sbjct  669  HYNGNLKPWLEIGLSRYRKYWSKYVDFDQVFLRDC  703



>gb|EMT08109.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=660

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G VETCGESFH FDRYLNFS+P+++K+FDP AC WAFGMN+ DL+EWRR+NITE
Sbjct  502  MKGKVNGAVETCGESFHSFDRYLNFSSPVVAKNFDPNACVWAFGMNMFDLAEWRRQNITE  561

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN D  L KLGTLP GL+TFWN T+ LDRSWHVLGLGYNP+V   D+ERAAVI
Sbjct  562  IYHFWQKLNEDGSLRKLGTLPLGLVTFWNKTFPLDRSWHVLGLGYNPHVSSGDLERAAVI  621

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI +PKFR+YWS +++YDQ FLREC
Sbjct  622  HYNGNMKPWLEIGLPKFRSYWSEYLDYDQPFLREC  656



>ref|XP_009407928.1| PREDICTED: probable galacturonosyltransferase 4 [Musa acuminata 
subsp. malaccensis]
Length=661

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKV G +ETCGESFHRFD+YLNFSNPLI+K+F+PRACGWA+GMN+ DL EWR++ IT+
Sbjct  503  MKGKVSGAIETCGESFHRFDKYLNFSNPLIAKNFNPRACGWAYGMNVFDLDEWRKQKITQ  562

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ LN DRQLW+LG+LPPGLITF+NHT  +D  WH+LGLGYN  V  KDIE AAVI
Sbjct  563  VYHYWQNLNIDRQLWRLGSLPPGLITFYNHTIPIDHRWHILGLGYNAQVDLKDIESAAVI  622

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWL+I +PK+R YWS+++ YD +F+R+C
Sbjct  623  HYNGNMKPWLDIGMPKYRGYWSKYVNYDHIFIRDC  657



>ref|XP_002969595.1| GAUT1, alpha-1,4-galacturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ29683.1| GAUT1, alpha-1,4-galacturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=525

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCG SFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  368  LHGKVNGAVETCGASFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLEEWKKRDITG  427

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQT+N DR LWKLGTLPPGLITF+N TY LD+SWHVLGLGYNP V  +DI+ AAV+
Sbjct  428  IYHKWQTMNKDRTLWKLGTLPPGLITFYNLTYPLDKSWHVLGLGYNPGVEPEDIDAAAVV  487

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + +F+ YWSR+++YD  +L+EC
Sbjct  488  HYNGNLKPWLEIGLSRFKGYWSRYVKYDHPYLQEC  522



>gb|EMS57452.1| putative galacturonosyltransferase 4 [Triticum urartu]
Length=643

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG+V G V+TCGE FHRFDRYLNFSNPLI+K FD RACGWA+GMN+ DLSEWRR+NIT 
Sbjct  485  LKGRVNGAVKTCGEIFHRFDRYLNFSNPLIAKKFDRRACGWAYGMNMFDLSEWRRQNITA  544

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ  N  R LWKLGTLP GL+TFWN+T+ LDRSWH+LGLGY  NV  KDIE+AAVI
Sbjct  545  VYHYWQEQNEHRLLWKLGTLPAGLVTFWNNTFPLDRSWHLLGLGYKRNVNPKDIEQAAVI  604

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLE+ +PK+RNYWS+++ +D  F+REC
Sbjct  605  HYNGNLKPWLEVGLPKYRNYWSKYVIFDHAFIREC  639



>emb|CAJ75629.1| glycosyl transferase-like protein [Brachypodium sylvaticum]
Length=501

 Score =   252 bits (644),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G V+TCGE FHRFDRYLNFSNPLI+K+FD RACGWA+GMN+ DLSEWRR+NIT+
Sbjct  343  LKGKVNGAVQTCGEVFHRFDRYLNFSNPLIAKNFDRRACGWAYGMNMFDLSEWRRQNITD  402

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ  N  R LWKLGTLP GL+TFWN T+ LDRSWH+LGLGY  NV  +DIERAAVI
Sbjct  403  VYHYWQEQNEHRLLWKLGTLPAGLVTFWNRTFPLDRSWHLLGLGYKQNVNPEDIERAAVI  462

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLE+ + K+R YW++++  DQ F+R C
Sbjct  463  HYNGNLKPWLEVGLSKYRKYWTKYVNSDQAFIRGC  497



>dbj|BAD10126.1| glycosyltransferase family-like [Oryza sativa Japonica Group]
 gb|EEC83808.1| hypothetical protein OsI_29736 [Oryza sativa Indica Group]
Length=726

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G ++TCGE+FHRFDRYLNFSNPLI+K+F+ RACGWA+GMN+ DLSEWR+RNIT+
Sbjct  568  LKGKVNGAIQTCGETFHRFDRYLNFSNPLIAKNFERRACGWAYGMNMFDLSEWRKRNITD  627

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ  N  R LWKLGTLP GL+TFWN T+ LD  WH+LGLGY PNV QKDIE AAVI
Sbjct  628  VYHYWQEQNEHRLLWKLGTLPAGLVTFWNQTFPLDHKWHLLGLGYKPNVNQKDIEGAAVI  687

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWLEI++ K+R YWS+++ +D VF+R+C
Sbjct  688  HYNGNRKPWLEIAMAKYRKYWSKYVNFDNVFIRQC  722



>ref|XP_002970865.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ28191.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=525

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCG SFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  368  LHGKVNGAVETCGASFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLEEWKKRDITG  427

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQT+N DR LWKLGTLPPGLITF+N TY LD+SWHVLGLGYNP V  ++I+ AAV+
Sbjct  428  IYHKWQTMNKDRTLWKLGTLPPGLITFYNLTYPLDKSWHVLGLGYNPGVDPEEIDAAAVV  487

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + +F+ YWSR+++YD  +L+EC
Sbjct  488  HYNGNLKPWLEIGLSRFKGYWSRYVKYDHPYLQEC  522



>gb|EEE68930.1| hypothetical protein OsJ_27797 [Oryza sativa Japonica Group]
Length=723

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G ++TCGE+FHRFDRYLNFSNPLI+K+F+ RACGWA+GMN+ DLSEWR+RNIT+
Sbjct  565  LKGKVNGAIQTCGETFHRFDRYLNFSNPLIAKNFERRACGWAYGMNMFDLSEWRKRNITD  624

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ  N  R LWKLGTLP GL+TFWN T+ LD  WH+LGLGY PNV QKDIE AAVI
Sbjct  625  VYHYWQEQNEHRLLWKLGTLPAGLVTFWNQTFPLDHKWHLLGLGYKPNVNQKDIEGAAVI  684

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWLEI++ K+R YWS+++ +D VF+R+C
Sbjct  685  HYNGNRKPWLEIAMAKYRKYWSKYVNFDNVFIRQC  719



>ref|XP_010235254.1| PREDICTED: probable galacturonosyltransferase 4 [Brachypodium 
distachyon]
Length=607

 Score =   252 bits (644),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G V+TCGE FHRFDRYLNFSNPLI+K+FD RACGWA+GMN+ DLSEWRR+NIT+
Sbjct  449  LKGKVNGAVQTCGEVFHRFDRYLNFSNPLIAKNFDRRACGWAYGMNMFDLSEWRRQNITD  508

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ  N  R LWKLGTLP GL+TFWN T+ LDRSWH+LGLGY  NV  KDIERAAVI
Sbjct  509  VYHYWQGQNEHRLLWKLGTLPAGLVTFWNRTFPLDRSWHLLGLGYKQNVTPKDIERAAVI  568

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLE+ + K+  YW++++  DQ F+R C
Sbjct  569  HYNGNLKPWLEVGLSKYHKYWTKYVNSDQAFIRGC  603



>gb|KJB24654.1| hypothetical protein B456_004G155600 [Gossypium raimondii]
Length=668

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  510  LHGKVNGAVETCGESFHRFDKYLNFSNPHISRNFDPNACGWAYGMNMFDLKEWKKRDITG  569

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V +K+IE AAVI
Sbjct  570  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDKKEIEHAAVI  629

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  630  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  664



>gb|KJB24655.1| hypothetical protein B456_004G155600 [Gossypium raimondii]
 gb|KJB24656.1| hypothetical protein B456_004G155600 [Gossypium raimondii]
Length=672

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  514  LHGKVNGAVETCGESFHRFDKYLNFSNPHISRNFDPNACGWAYGMNMFDLKEWKKRDITG  573

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V +K+IE AAVI
Sbjct  574  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDKKEIEHAAVI  633

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  634  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  668



>gb|EEC83380.1| hypothetical protein OsI_28795 [Oryza sativa Indica Group]
Length=650

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KGKVIGVVETCGESFHRFDRYLNFSNP+I K+FDP ACGWAFGMN+ DL+EWRR+NITE
Sbjct  485  MKGKVIGVVETCGESFHRFDRYLNFSNPVIVKNFDPHACGWAFGMNVFDLAEWRRQNITE  544

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YHSWQ LN DR LWKLGTLPPGLITFWN T  L+RSWHVLGLGYNP+V  +DIERAAVI
Sbjct  545  IYHSWQKLNQDRLLWKLGTLPPGLITFWNKTLPLNRSWHVLGLGYNPHVSSRDIERAAVI  604

Query  392  HYNGNLKPWLEISIP  348
            HYNGN+KPWLEI  P
Sbjct  605  HYNGNMKPWLEIVCP  619



>ref|XP_002963967.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ34300.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=446

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETCG SFHRFD+YLNFSNPLISKSFDP ACGWA+GMNI DL +WR ++IT 
Sbjct  288  LRGNVNGAVETCGASFHRFDKYLNFSNPLISKSFDPNACGWAYGMNIFDLRQWRDKDITG  347

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N TY+L++ WHVLGLGYN  V+ KDI  AAVI
Sbjct  348  IYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYSLNKHWHVLGLGYNSEVKSKDIHSAAVI  407

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI + K+++YWSR + +D  +L++C
Sbjct  408  HYNGNMKPWLEIGMAKYKHYWSRHVMFDHPYLQQC  442



>gb|EMT19760.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=671

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG+V   V+TCGE FHRFDRYLNFSNPLI+K FD  ACGWA+GMN+ DLSEWRR+NIT 
Sbjct  513  LKGRVNAAVKTCGEVFHRFDRYLNFSNPLIAKKFDRHACGWAYGMNMFDLSEWRRQNITA  572

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ  N  R LWKLGTLP GL+TFWN+T+ LDRSWH+LGLGY  NV   DIE+AAVI
Sbjct  573  VYHYWQEQNEHRLLWKLGTLPAGLVTFWNNTFPLDRSWHLLGLGYKRNVNPMDIEQAAVI  632

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLE+ +PK+R+YWS+++ +D  F+REC
Sbjct  633  HYNGNLKPWLEVGLPKYRSYWSKYVNFDHAFIREC  667



>gb|KHG14424.1| Alpha-1,4-galacturonosyltransferase 1 -like protein [Gossypium 
arboreum]
Length=672

 Score =   252 bits (643),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL EW+ R+IT 
Sbjct  514  LHGKVNGAVETCGESFHRFDKYLNFSNPHISRNFDPNACGWAYGMNMFDLKEWKNRDITG  573

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V +K+IE AAVI
Sbjct  574  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDKKEIEHAAVI  633

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  634  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  668



>ref|XP_010450980.1| PREDICTED: probable galacturonosyltransferase 3, partial [Camelina 
sativa]
Length=264

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  106  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  165

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RSWHVLGLGY+P + Q  IE AAV+
Sbjct  166  IYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERSWHVLGLGYDPALNQTAIENAAVV  225

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  226  HYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  260



>ref|NP_001131608.1| uncharacterized protein LOC100192958 [Zea mays]
 gb|ACF80095.1| unknown [Zea mays]
Length=228

 Score =   238 bits (608),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  70   LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITG  129

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  130  IYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVV  189

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  190  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  224



>ref|XP_006445203.1| hypothetical protein CICLE_v10019146mg [Citrus clementina]
 ref|XP_006490965.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Citrus sinensis]
 gb|ESR58443.1| hypothetical protein CICLE_v10019146mg [Citrus clementina]
Length=683

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCGESFHRFD+YLNF+NP I++SFDP ACGWA+GMN+ DL EW++++IT 
Sbjct  525  LQGKVNGAVETCGESFHRFDKYLNFTNPHIARSFDPNACGWAYGMNMFDLKEWKKKDITG  584

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ L++SWHVLGLGYNP+V + +IE AAV+
Sbjct  585  IYHKWQNMNEDRTLWKLGTLPPGLITFYNLTHPLEKSWHVLGLGYNPSVDRSEIENAAVV  644

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  645  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRNC  679



>gb|KDO85920.1| hypothetical protein CISIN_1g005683mg [Citrus sinensis]
 gb|KDO85921.1| hypothetical protein CISIN_1g005683mg [Citrus sinensis]
Length=683

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCGESFHRFD+YLNF+NP I++SFDP ACGWA+GMN+ DL EW++++IT 
Sbjct  525  LQGKVNGAVETCGESFHRFDKYLNFTNPHIARSFDPNACGWAYGMNMFDLKEWKKKDITG  584

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ L++SWHVLGLGYNP+V + +IE AAV+
Sbjct  585  IYHKWQNMNEDRTLWKLGTLPPGLITFYNLTHPLEKSWHVLGLGYNPSVDRSEIENAAVV  644

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  645  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRNC  679



>ref|XP_007051985.1| Galacturonosyltransferase 1 [Theobroma cacao]
 gb|EOX96142.1| Galacturonosyltransferase 1 [Theobroma cacao]
Length=676

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  518  LHGKVNGAVETCGESFHRFDKYLNFSNPHISRNFDPNACGWAYGMNIFDLKEWKKKDITG  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V +++I+RAAVI
Sbjct  578  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRREIDRAAVI  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  638  HYNGNMKPWLELAMTKYRPYWAKYIKYDHPYLRSC  672



>ref|XP_001785716.1| predicted protein [Physcomitrella patens]
 gb|EDQ49475.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L G V G VETCG SFHRFD+YLNFSNPLIS++FDP ACGWA+GMN+ DL +W++ +IT 
Sbjct  70   LNGNVNGAVETCGASFHRFDKYLNFSNPLISENFDPNACGWAYGMNVFDLKQWKKEDITG  129

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ+LN DR LWKLGTLPPGLITF+N T  L++SWHVLGLGYNP + + +IE AAVI
Sbjct  130  IYHRWQSLNEDRTLWKLGTLPPGLITFYNLTQPLEKSWHVLGLGYNPAIEESEIETAAVI  189

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            H+NGN+KPWLEI + KF+ YW++F++Y+  FL++C
Sbjct  190  HWNGNMKPWLEIGMVKFKPYWTKFVKYNHPFLQQC  224



>ref|XP_010661600.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Vitis vinifera]
 emb|CBI38820.3| unnamed protein product [Vitis vinifera]
Length=681

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW RR+IT 
Sbjct  523  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWTRRDITG  582

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ +++SWHVLGLGYNP++ + DIE AAVI
Sbjct  583  IYHKWQNMNEDRTLWKLGTLPPGLITFYKLTHPIEKSWHVLGLGYNPSIDKSDIENAAVI  642

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +LR C
Sbjct  643  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLRSC  677



>ref|XP_002967953.1| GAUT1, alpha-1,4-galacturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ31300.1| GAUT1, alpha-1,4-galacturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=654

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETCG SFHRFD+YLNFSNPLISKSFDP ACGWA+GMNI DL +WR R+IT 
Sbjct  496  LRGNVNGAVETCGASFHRFDKYLNFSNPLISKSFDPNACGWAYGMNIFDLRQWRDRDITG  555

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N TY+L++ WHVLGLGYN  V+ KDI  AAVI
Sbjct  556  IYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYSLNKHWHVLGLGYNSEVKSKDIHSAAVI  615

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI + K+++YWSR + +D  +L++C
Sbjct  616  HYNGNMKPWLEIGMAKYKHYWSRHVMFDHPYLQQC  650



>gb|KJB09887.1| hypothetical protein B456_001G172800 [Gossypium raimondii]
Length=676

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL  WR+++IT 
Sbjct  518  LHGKVNGAVETCGESFHRFDKYLNFSNPHISQNFDPNACGWAYGMNMFDLKVWRKKDITG  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNPNV +K+IE AAVI
Sbjct  578  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPNVDKKEIESAAVI  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +L  C
Sbjct  638  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLHSC  672



>ref|XP_010056256.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Eucalyptus grandis]
 gb|KCW72890.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
 gb|KCW72891.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
Length=675

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  517  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKRDITG  576

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP+V + DI+ AAV+
Sbjct  577  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSVDRSDIDNAAVV  636

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  637  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRTC  671



>gb|KHG01394.1| Alpha-1,4-galacturonosyltransferase 1 [Gossypium arboreum]
Length=691

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL  WR+++IT 
Sbjct  528  LHGKVNGAVETCGESFHRFDKYLNFSNPHISQNFDPNACGWAYGMNMFDLKVWRKKDITG  587

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNPNV +K+IE AAVI
Sbjct  588  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPNVDKKEIESAAVI  647

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +L  C
Sbjct  648  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLHSC  682



>ref|XP_002962728.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ36191.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=533

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCG SFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW+RR+IT 
Sbjct  375  LQGKVNGAVETCGASFHRFDKYLNFSNPHIARNFNPDACGWAYGMNVFDLKEWKRRDITG  434

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ LD+SWHVLGLGYNP++ + D++ AAV+
Sbjct  435  IYHKWQNMNEDRLLWKLGTLPPGLITFYNLTHPLDKSWHVLGLGYNPSIDKADMDAAAVV  494

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWL+I + ++++YW+R++ YD  +L++C
Sbjct  495  HYNGNLKPWLDIGLSRYKSYWTRYVSYDHPYLQQC  529



>ref|XP_002980359.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ18619.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=533

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCG SFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW+RR+IT 
Sbjct  375  LQGKVNGAVETCGASFHRFDKYLNFSNPHIARNFNPDACGWAYGMNVFDLKEWKRRDITG  434

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ LD+SWHVLGLGYNP++ + D++ AAV+
Sbjct  435  IYHKWQNMNEDRLLWKLGTLPPGLITFYNLTHPLDKSWHVLGLGYNPSIDKADMDAAAVV  494

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWL+I + ++++YW+R++ YD  +L++C
Sbjct  495  HYNGNLKPWLDIGLSRYKSYWTRYVSYDHPYLQQC  529



>ref|XP_010255603.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Nelumbo nucifera]
Length=648

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  490  LRGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITG  549

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N  R LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNP++ + +IE AAVI
Sbjct  550  IYHKWQNMNEQRVLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSIDRSEIESAAVI  609

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R+YW+++I+YD  +LR C
Sbjct  610  HYNGNMKPWLEIAMNKYRSYWTKYIKYDHPYLRNC  644



>ref|XP_010667722.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Beta vulgaris subsp. vulgaris]
Length=684

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL EW++++IT 
Sbjct  526  LHGKVNGAVETCGESFHRFDKYLNFSNPHISRNFDPSACGWAYGMNLFDLKEWKKKDITG  585

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L+++WHVLGLGYNP++ + +IE+AAV+
Sbjct  586  IYHKWQNMNEDRTLWKLGTLPPGLITFYGLTHPLEKTWHVLGLGYNPSIDKSEIEKAAVV  645

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R+ W+++I+YD  +LR C
Sbjct  646  HYNGNMKPWLEIAMTKYRSVWTKYIKYDHPYLRRC  680



>ref|XP_006375320.1| hypothetical protein POPTR_0014s06970g [Populus trichocarpa]
 gb|ERP53117.1| hypothetical protein POPTR_0014s06970g [Populus trichocarpa]
Length=468

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I++ FDP +CGWA+GMNI DL  W++++IT 
Sbjct  310  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARHFDPNSCGWAYGMNIFDLKVWKKKDITG  369

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ L +SWHVLGLGYNP++ + +IE AAV+
Sbjct  370  IYHKWQNMNEDRVLWKLGTLPPGLITFYNLTHPLQKSWHVLGLGYNPSIDRSEIENAAVV  429

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  430  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRNC  464



>ref|XP_001756118.1| predicted protein [Physcomitrella patens]
 gb|EDQ78984.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCG+SFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  332  LEGKVNGAVETCGKSFHRFDKYLNFSNPHIARNFDPHACGWAYGMNIFDLKEWKKRHITA  391

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQTLN +R LWKLGTLPPGL TF+  ++ LD+SWHVLGLGYNPN+ +  IE AAV+
Sbjct  392  IYHKWQTLNANRTLWKLGTLPPGLATFYKLSHPLDKSWHVLGLGYNPNIDKSLIEGAAVV  451

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI I KF+ +W+++++YD ++L++C
Sbjct  452  HYNGNMKPWLEIGISKFKRHWAQYVKYDHLWLQQC  486



>ref|XP_011040799.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Populus 
euphratica]
Length=615

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHRFD+YLNFSNP I  +FDP ACGWAFGMN+ DL +W+R NIT 
Sbjct  456  LQGMVNGAVETCKESFHRFDKYLNFSNPKIYNNFDPNACGWAFGMNMFDLKQWKRSNITG  515

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLGTLPPGLITF+N TY LDRSWHVLGLGY+P + Q +IE AAV+
Sbjct  516  IYHHWQDLNEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNQTEIENAAVV  575

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL++++ K++ YWSR+++YD  +L++C
Sbjct  576  HYNGNYKPWLDLAVAKYKPYWSRYVQYDNPYLQQC  610



>ref|XP_010436923.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Camelina 
sativa]
Length=544

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  386  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  445

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RSWHVLGLGY+P + Q  IE AAV+
Sbjct  446  IYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERSWHVLGLGYDPALNQTAIENAAVV  505

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  506  HYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  540



>ref|XP_008460145.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis melo]
Length=679

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I++ FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  521  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITG  580

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN +R LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ + +IE AAVI
Sbjct  581  IYHKWQNLNEERLLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIENAAVI  640

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+Y+  +LR+C
Sbjct  641  HYNGNMKPWLELAMTKYRGYWTKYIKYNHPYLRQC  675



>ref|XP_010918998.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Elaeis guineensis]
Length=701

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETCG+SFHRFD+YLNFSNP I+K+FDP ACGWA+GMN+ DL+EW++++IT 
Sbjct  543  LRGNVNGAVETCGQSFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNMFDLNEWKKKDITG  602

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ+LN +R LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +IE AAVI
Sbjct  603  IYHKWQSLNENRALWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIENAAVI  662

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLEI + K+RNYW+R+I+YD  +++ C
Sbjct  663  HYNGNLKPWLEIGMTKYRNYWTRYIKYDHPYVKIC  697



>ref|XP_010255599.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010255600.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010255601.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Nelumbo nucifera]
Length=692

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  534  LRGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITG  593

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N  R LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNP++ + +IE AAVI
Sbjct  594  IYHKWQNMNEQRVLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSIDRSEIESAAVI  653

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R+YW+++I+YD  +LR C
Sbjct  654  HYNGNMKPWLEIAMNKYRSYWTKYIKYDHPYLRNC  688



>gb|KHG01393.1| Alpha-1,4-galacturonosyltransferase 1 [Gossypium arboreum]
Length=752

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP IS++FDP ACGWA+GMN+ DL  WR+++IT 
Sbjct  589  LHGKVNGAVETCGESFHRFDKYLNFSNPHISQNFDPNACGWAYGMNMFDLKVWRKKDITG  648

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNPNV +K+IE AAVI
Sbjct  649  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPNVDKKEIESAAVI  708

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I+YD  +L  C
Sbjct  709  HYNGNMKPWLELAMTKYRSYWTKYIKYDHPYLHSC  743



>ref|XP_010255602.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Nelumbo nucifera]
Length=686

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  528  LRGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITG  587

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N  R LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNP++ + +IE AAVI
Sbjct  588  IYHKWQNMNEQRVLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSIDRSEIESAAVI  647

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R+YW+++I+YD  +LR C
Sbjct  648  HYNGNMKPWLEIAMNKYRSYWTKYIKYDHPYLRNC  682



>ref|NP_001063757.1| Os09g0531900 [Oryza sativa Japonica Group]
 dbj|BAD46018.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD46265.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF25671.1| Os09g0531900 [Oryza sativa Japonica Group]
 gb|EEE70102.1| hypothetical protein OsJ_30110 [Oryza sativa Japonica Group]
Length=695

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  537  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  596

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ++N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  597  IYHKWQSMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVV  656

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  657  HYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  691



>gb|EEC84934.1| hypothetical protein OsI_32147 [Oryza sativa Indica Group]
Length=695

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  537  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  596

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ++N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  597  IYHKWQSMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVV  656

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  657  HYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  691



>ref|XP_003603462.1| Alpha-1,4-galacturonosyltransferase [Medicago truncatula]
Length=439

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG VIG VETC ESFHRFD+YLNFSNPLIS +F P ACGWAFGMN+ DL EW++RNIT 
Sbjct  281  LKGMVIGSVETCKESFHRFDKYLNFSNPLISNNFSPDACGWAFGMNVFDLKEWKKRNITG  340

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLGTLPPGLITF+N TY LDR WHVLGLGY+P +   +I+ AAV+
Sbjct  341  IYHRWQDLNEDRTLWKLGTLPPGLITFYNLTYPLDRGWHVLGLGYDPALNLTEIDNAAVV  400

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL +++ K+++YWS+++ +D  +L+ C
Sbjct  401  HYNGNFKPWLNLAVSKYKSYWSKYVMFDNPYLQVC  435



>emb|CAB37483.1| putative protein [Arabidopsis thaliana]
 emb|CAB80492.1| putative protein [Arabidopsis thaliana]
Length=658

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  500  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  559

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRSWHVLGLGY+P + Q  IE AAV+
Sbjct  560  IYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRSWHVLGLGYDPALNQTAIENAAVV  619

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  620  HYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  654



>ref|NP_195540.2| galacturonosyltransferase 3 [Arabidopsis thaliana]
 sp|Q0WQD2.2|GAUT3_ARATH RecName: Full=Probable galacturonosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE86907.1| galacturonosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38654.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=680

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  522  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  581

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRSWHVLGLGY+P + Q  IE AAV+
Sbjct  582  IYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRSWHVLGLGYDPALNQTAIENAAVV  641

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  642  HYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  676



>ref|XP_011458093.1| PREDICTED: probable galacturonosyltransferase 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=604

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHR+D+YLNFSNP+IS +FDP ACGWAFGMN+ DL EWR+RN+T 
Sbjct  446  LQGMVNGAVETCKESFHRYDKYLNFSNPIISANFDPNACGWAFGMNMFDLKEWRKRNMTG  505

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ +N +R LWKLGTLPPGLITF+N TY LDR WH LGLGY+P + Q  IE AAVI
Sbjct  506  VYHKWQDMNEERTLWKLGTLPPGLITFYNLTYPLDRGWHSLGLGYDPALNQTAIENAAVI  565

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++I K++NYWS+++ YD  +LR C
Sbjct  566  HYNGNYKPWLDLAISKYKNYWSKYVMYDNPYLRIC  600



>dbj|BAF00667.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  522  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  581

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRSWHVLGLGY+P + Q  IE AAV+
Sbjct  582  IYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRSWHVLGLGYDPALNQTAIENAAVV  641

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  642  HYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  676



>ref|XP_002320745.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|EEE99060.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
Length=520

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I++ FDP +CGWA+GMNI DL  W++++IT 
Sbjct  362  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARHFDPNSCGWAYGMNIFDLKVWKKKDITG  421

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ L +SWHVLGLGYNP++ + +IE AAV+
Sbjct  422  IYHKWQNMNEDRVLWKLGTLPPGLITFYNLTHPLQKSWHVLGLGYNPSIDRSEIENAAVV  481

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  482  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRNC  516



>emb|CDX71763.1| BnaC08g31110D [Brassica napus]
Length=673

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  515  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  574

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ +KDI+ AAV+
Sbjct  575  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVV  634

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  635  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  669



>ref|XP_010431762.1| PREDICTED: probable galacturonosyltransferase 3 [Camelina sativa]
Length=598

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  440  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  499

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RSWHVLGLGY+P + Q  IE AAV+
Sbjct  500  IYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERSWHVLGLGYDPALNQTAIENAAVV  559

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  560  HYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  594



>ref|NP_001190952.1| galacturonosyltransferase 3 [Arabidopsis thaliana]
 gb|AEE86908.1| galacturonosyltransferase 3 [Arabidopsis thaliana]
Length=676

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  518  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLG+LPPGLITF+N TYA+DRSWHVLGLGY+P + Q  IE AAV+
Sbjct  578  IYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRSWHVLGLGYDPALNQTAIENAAVV  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  638  HYNGNYKPWLGLAFAKYKPYWSKYVEYDNPYLRRC  672



>ref|XP_009116771.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Brassica rapa]
Length=671

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  513  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  572

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ +KDI+ AAV+
Sbjct  573  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVV  632

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  633  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  667



>emb|CDY52336.1| BnaA09g38850D [Brassica napus]
Length=671

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  513  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  572

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ +KDI+ AAV+
Sbjct  573  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVV  632

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  633  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  667



>ref|XP_011088710.1| PREDICTED: probable galacturonosyltransferase 3 [Sesamum indicum]
Length=680

 Score =   246 bits (629),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHRFD+YLNFSNP IS++FDP ACGWAFGMNI DL EWR+R+IT 
Sbjct  522  LQGMVNGAVETCKESFHRFDKYLNFSNPKISENFDPNACGWAFGMNIFDLREWRKRDITG  581

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N TY LDRSWHVLGLGY+P + Q +IE AAV+
Sbjct  582  IYHHWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNQTEIENAAVV  641

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++I K+++YWSR++ +D  +++ C
Sbjct  642  HYNGNYKPWLDLAIAKYKSYWSRYVMFDNYYVQLC  676



>ref|XP_004172284.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
Length=679

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I++ FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  521  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITG  580

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN +R LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ + +I+ AAVI
Sbjct  581  IYHKWQNLNEERLLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIDNAAVI  640

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+Y+  +LR+C
Sbjct  641  HYNGNMKPWLELAMTKYRGYWTKYIKYNHPYLRQC  675



>gb|KJB12347.1| hypothetical protein B456_002G013600 [Gossypium raimondii]
Length=616

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD+YLNFSNP+I ++FDP ACGWAFGMNI DL EWR+RNIT 
Sbjct  458  LKGMVNGAVETCKESFHRFDKYLNFSNPIIIENFDPNACGWAFGMNIFDLKEWRKRNITA  517

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN+DR LWKLGTLPPGLITF+N T+ LDR WHVLGLGY+P + + +IE AAVI
Sbjct  518  IYHHWQDLNDDRTLWKLGTLPPGLITFYNLTHPLDRKWHVLGLGYDPALNRTEIENAAVI  577

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL++++ K+++YWS+++  D  +L+ C
Sbjct  578  HYNGNYKPWLDLAVSKYQSYWSKYVSSDNYYLQRC  612



>ref|XP_011040798.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Populus 
euphratica]
Length=683

 Score =   246 bits (628),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHRFD+YLNFSNP I  +FDP ACGWAFGMN+ DL +W+R NIT 
Sbjct  524  LQGMVNGAVETCKESFHRFDKYLNFSNPKIYNNFDPNACGWAFGMNMFDLKQWKRSNITG  583

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLGTLPPGLITF+N TY LDRSWHVLGLGY+P + Q +IE AAV+
Sbjct  584  IYHHWQDLNEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNQTEIENAAVV  643

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL++++ K++ YWSR+++YD  +L++C
Sbjct  644  HYNGNYKPWLDLAVAKYKPYWSRYVQYDNPYLQQC  678



>ref|XP_004229870.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Solanum lycopersicum]
Length=688

 Score =   246 bits (628),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCG+SFHRFD+YLNFSNP I+++FDP ACGWA+GMN+ DL EW++++IT 
Sbjct  530  LHGKVNGAVETCGQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITG  589

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ + DIE AAV+
Sbjct  590  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDRSDIENAAVV  649

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  ++R C
Sbjct  650  HYNGNMKPWLELAMTKYRPYWTKYIKFDHPYMRSC  684



>ref|XP_004144992.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
 ref|XP_004153994.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
 gb|KGN46221.1| hypothetical protein Csa_6G075210 [Cucumis sativus]
Length=679

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I++ FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  521  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITG  580

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN +R LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ + +I+ AAVI
Sbjct  581  IYHKWQNLNEERLLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIDNAAVI  640

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+Y+  +LR+C
Sbjct  641  HYNGNMKPWLELAMTKYRGYWTKYIKYNHPYLRQC  675



>ref|XP_004501287.1| PREDICTED: probable galacturonosyltransferase 3-like isoform 
X2 [Cicer arietinum]
Length=584

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD+YLNFSNPLIS +F P ACGWAFGMN+ DL EW++RNIT 
Sbjct  426  LKGMVNGAVETCKESFHRFDKYLNFSNPLISNNFSPDACGWAFGMNVFDLKEWKKRNITG  485

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR WHVLGLGY+P +   +IE AAV+
Sbjct  486  IYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRGWHVLGLGYDPALNLTEIENAAVV  545

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL +++ K+R+YWSR++ +D  +LR C
Sbjct  546  HYNGNYKPWLNLAVSKYRSYWSRYVMFDNPYLRVC  580



>ref|XP_002462717.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
 gb|EER99238.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
Length=683

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  525  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITG  584

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  585  IYHKWQNLNEDRALWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDSAAVV  644

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  645  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  679



>ref|XP_008650863.1| PREDICTED: uncharacterized protein LOC100192958 isoform X3 [Zea 
mays]
Length=608

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  450  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITG  509

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  510  IYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVV  569

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  570  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  604



>ref|XP_010266351.1| PREDICTED: probable galacturonosyltransferase 3 [Nelumbo nucifera]
Length=519

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  734  GVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITEVYHSWQ  555
            G VETC ESFHRFD+YLNFSNP IS++FDP ACGWAFGMNI DL EW++R+IT +YH WQ
Sbjct  367  GAVETCKESFHRFDKYLNFSNPKISENFDPNACGWAFGMNIFDLKEWKKRDITGIYHHWQ  426

Query  554  TLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVIHYNGNL  375
             +N DR LWKLGTLPPGLITF+N TY LDRSWHVLGLGY+P + Q +I+ AAV+HYNGN 
Sbjct  427  DMNEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNQTEIDNAAVVHYNGNY  486

Query  374  KPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            KPWL++++ K+++YWSR++ YD  +L+ C
Sbjct  487  KPWLDLAVTKYKSYWSRYVMYDNPYLQRC  515



>ref|XP_008670350.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X5 [Zea mays]
 ref|XP_008670351.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X5 [Zea mays]
Length=557

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  399  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  458

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N  R LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP+V + +I+ AAV+
Sbjct  459  IYHKWQNMNEGRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVV  518

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  519  HYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  553



>ref|XP_006660882.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Oryza brachyantha]
Length=693

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  535  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  594

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  595  IYHRWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVV  654

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  655  HYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  689



>ref|XP_006384847.1| hypothetical protein POPTR_0004s21600g [Populus trichocarpa]
 gb|ERP62644.1| hypothetical protein POPTR_0004s21600g [Populus trichocarpa]
Length=655

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHRFD+YLNFSNP I  +FDP ACGWAFGMN+ DL +W+R NIT 
Sbjct  496  LQGMVNGAVETCKESFHRFDKYLNFSNPKIYNNFDPNACGWAFGMNMFDLKQWKRSNITG  555

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLG+LPPGLITF+N TY LDRSWHVLGLGY+P + Q +IE AAV+
Sbjct  556  IYHHWQDLNEDRTLWKLGSLPPGLITFYNLTYPLDRSWHVLGLGYDPALNQTEIENAAVV  615

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL++++ K++ YWSR+++YD  +L++C
Sbjct  616  HYNGNYKPWLDLAVAKYKPYWSRYVQYDNPYLKQC  650



>dbj|BAJ53137.1| JHL05D22.8 [Jatropha curcas]
Length=693

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNF+NP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  535  LGGKVNGAVETCGESFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITG  594

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V + +I+ AAVI
Sbjct  595  IYHKWQKMNEDRVLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDNAAVI  654

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R YW+++I+YD  +L  C
Sbjct  655  HYNGNMKPWLEIAMTKYRTYWTKYIKYDHPYLHSC  689



>ref|XP_006339506.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Solanum tuberosum]
Length=688

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCG+SFHRFD+YLNFSNP I+++FDP ACGWA+GMN+ DL EW++++IT 
Sbjct  530  LHGKVNGAVETCGQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKQDITG  589

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ LD+SWHVLGLGYNP++ + DIE AAV+
Sbjct  590  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDRSDIENAAVV  649

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  ++R C
Sbjct  650  HYNGNMKPWLELAMTKYRPYWTKYIKFDHPYMRSC  684



>ref|XP_010272612.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nelumbo nucifera]
 ref|XP_010272613.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nelumbo nucifera]
Length=682

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMNI DL EW++R+IT 
Sbjct  524  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNIFDLKEWKKRDITG  583

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNP++ + +IE AAVI
Sbjct  584  IYHKWQNMNEERVLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSIDRSEIENAAVI  643

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R YW+R+I+YD  +LR C
Sbjct  644  HYNGNMKPWLEIAMTKYRPYWTRYIKYDHPYLRNC  678



>emb|CDP08918.1| unnamed protein product [Coffea canephora]
Length=683

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  522  LRGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  581

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V + +I+ AAVI
Sbjct  582  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDGAAVI  641

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I +D  +LR C
Sbjct  642  HYNGNMKPWLELAMTKYRSYWTKYIMFDHPYLRNC  676



>ref|XP_009382742.1| PREDICTED: probable galacturonosyltransferase 3 [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KG V G VETC ESFHRFD YLNFSNPLIS++FDP+ACGWAFGMNI DL EW++RNIT 
Sbjct  487  MKGMVNGAVETCKESFHRFDTYLNFSNPLISQNFDPQACGWAFGMNIFDLKEWKKRNITG  546

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR LWKLG+LPPGLITF+N TY LDRSWHVLGLGY+P V   +IE AAVI
Sbjct  547  IYHYWQDLNEDRMLWKLGSLPPGLITFYNLTYPLDRSWHVLGLGYDPAVNPLEIENAAVI  606

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++  K++ YWS+F++ D  ++++C
Sbjct  607  HYNGNYKPWLDLAFTKYQPYWSKFVDVDNPYIQDC  641



>emb|CDY42486.1| BnaC04g21950D [Brassica napus]
Length=670

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  512  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  571

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L+++WHVLGLGYNP++ +KDIE AAV+
Sbjct  572  IYHKWQNMNENRTLWKLGTLPPGLITFYELTHPLNKAWHVLGLGYNPSIAKKDIENAAVV  631

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  632  HYNGNMKPWLELAMSKYRPYWTKYIQFDHPYLRRC  666



>ref|XP_011458092.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=686

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHR+D+YLNFSNP+IS +FDP ACGWAFGMN+ DL EWR+RN+T 
Sbjct  528  LQGMVNGAVETCKESFHRYDKYLNFSNPIISANFDPNACGWAFGMNMFDLKEWRKRNMTG  587

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            VYH WQ +N +R LWKLGTLPPGLITF+N TY LDR WH LGLGY+P + Q  IE AAVI
Sbjct  588  VYHKWQDMNEERTLWKLGTLPPGLITFYNLTYPLDRGWHSLGLGYDPALNQTAIENAAVI  647

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++I K++NYWS+++ YD  +LR C
Sbjct  648  HYNGNYKPWLDLAISKYKNYWSKYVMYDNPYLRIC  682



>gb|KDP28715.1| hypothetical protein JCGZ_14486 [Jatropha curcas]
Length=686

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNF+NP I+++FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  528  LGGKVNGAVETCGESFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITG  587

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP+V + +I+ AAVI
Sbjct  588  IYHKWQKMNEDRVLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDNAAVI  647

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLEI++ K+R YW+++I+YD  +L  C
Sbjct  648  HYNGNMKPWLEIAMTKYRTYWTKYIKYDHPYLHSC  682



>ref|XP_010512445.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Camelina sativa]
Length=674

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  516  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  575

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ +KDIE AAV+
Sbjct  576  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVV  635

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  636  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  670



>ref|XP_010469034.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Camelina sativa]
Length=673

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  515  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  574

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ +KDIE AAV+
Sbjct  575  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVV  634

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  635  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  669



>ref|XP_010512446.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Camelina sativa]
Length=673

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  515  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  574

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ +KDIE AAV+
Sbjct  575  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVV  634

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  635  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  669



>ref|XP_011002080.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Populus euphratica]
Length=686

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL  W++++IT 
Sbjct  528  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKVWKKKDITG  587

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR+LWKLGTLPPGLITF+N T  L+++WHVLGLGYNP++ + +IE AAV+
Sbjct  588  IYHKWQNMNEDRELWKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVV  647

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  648  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRSC  682



>ref|XP_010523706.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Tarenaya hassleriana]
Length=682

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKGKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  524  LKGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  583

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L+++WHVLGLGYNP++ +K+IE AAVI
Sbjct  584  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKEIENAAVI  643

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  644  HYNGNMKPWLELAMSKYRPYWTKYIKYDHPYVRRC  678



>ref|XP_010413456.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Camelina sativa]
Length=673

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  515  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  574

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ +KDIE AAV+
Sbjct  575  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVV  634

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  635  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  669



>ref|XP_002302550.1| hypothetical protein POPTR_0002s15270g [Populus trichocarpa]
 gb|EEE81823.1| hypothetical protein POPTR_0002s15270g [Populus trichocarpa]
Length=644

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+K+FDP ACGWA+GMNI DL  W++++IT 
Sbjct  486  LHGKVNGAVETCGESFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNIFDLKVWKKKDITG  545

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T  L+++WHVLGLGYNP++ + +IE AAV+
Sbjct  546  IYHKWQNMNEDRVLWKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVV  605

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  606  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRNC  640



>ref|XP_010512443.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Camelina sativa]
Length=676

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  518  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  577

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ +KDIE AAV+
Sbjct  578  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVV  637

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  638  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  672



>ref|XP_007043045.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 ref|XP_007043048.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 ref|XP_007043049.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 gb|EOX98876.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 gb|EOX98879.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
 gb|EOX98880.1| Galacturonosyltransferase 3 isoform 2 [Theobroma cacao]
Length=495

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMNI  L EWR+RNIT 
Sbjct  337  LQGMVNGAVETCKESFHRFDKYLNFSNPKISENFDSNACGWAFGMNIFYLKEWRKRNITG  396

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR WHVLGLGY+P + Q +IE AAVI
Sbjct  397  IYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRKWHVLGLGYDPALNQTEIENAAVI  456

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++I K+++YWS++++ D  +LR C
Sbjct  457  HYNGNYKPWLDLAIAKYKSYWSKYVKVDNYYLRLC  491



>ref|XP_011002081.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Populus euphratica]
Length=683

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL  W++++IT 
Sbjct  525  LHGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKVWKKKDITG  584

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR+LWKLGTLPPGLITF+N T  L+++WHVLGLGYNP++ + +IE AAV+
Sbjct  585  IYHKWQNMNEDRELWKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVV  644

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  645  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRSC  679



>ref|XP_010512444.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Camelina sativa]
Length=675

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  517  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  576

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ +KDIE AAV+
Sbjct  577  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVV  636

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  637  HYNGNMKPWLELAMSKYRPYWTKYIKFDHPYLRRC  671



>ref|XP_008650862.1| PREDICTED: uncharacterized protein LOC100192958 isoform X2 [Zea 
mays]
 tpg|DAA62449.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea mays]
Length=683

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  525  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITG  584

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  585  IYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVV  644

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  645  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  679



>dbj|BAK02036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD YLNFS+P IS++FDPRACGWAFGMN+ DL EW++RNIT 
Sbjct  265  LKGMVNGAVETCKESFHRFDTYLNFSHPKISENFDPRACGWAFGMNMFDLKEWKKRNITG  324

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN DR+LWKLGTLPPGLITF+N T+ LD +WHVLGLGY+P V   +IE AAV+
Sbjct  325  IYHYWQNLNEDRKLWKLGTLPPGLITFYNLTHPLDHTWHVLGLGYDPAVDIAEIENAAVV  384

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++I K++ YWS++++ D   +R C
Sbjct  385  HYNGNYKPWLDLAISKYKAYWSKYVDVDSSHIRHC  419



>ref|XP_008670348.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Zea mays]
 ref|XP_008670349.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Zea mays]
Length=606

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  448  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  507

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N  R LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP+V + +I+ AAV+
Sbjct  508  IYHKWQNMNEGRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVV  567

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  568  HYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  602



>emb|CDX89098.1| BnaA04g00880D [Brassica napus]
Length=671

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  513  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITG  572

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L+++WHVLGLGYNP++ +KDIE AAV+
Sbjct  573  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIAKKDIENAAVV  632

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  633  HYNGNMKPWLELAMSKYRPYWTKYIQFDHPYLRRC  667



>ref|XP_006843539.1| hypothetical protein AMTR_s00007p00049440 [Amborella trichopoda]
 gb|ERN05214.1| hypothetical protein AMTR_s00007p00049440 [Amborella trichopoda]
Length=399

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            +KG V G VETC ESFHRFD+YLNFSNP+IS++FDP ACGWAFGMN+ DL EWR+R++T 
Sbjct  242  MKGMVNGAVETCKESFHRFDKYLNFSNPIISQNFDPNACGWAFGMNMFDLKEWRKRDMTS  301

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN +R LWKLG+LPPGLITF+N TY +D+SWHVLGLGY+  V + DI  A VI
Sbjct  302  IYHRWQNLNENRTLWKLGSLPPGLITFYNLTYPMDKSWHVLGLGYDATVNETDIHDAGVI  361

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGNLKPWLE++I KF  +W++++  D  +L++C
Sbjct  362  HYNGNLKPWLELAISKFIPFWTKYVPVDHPYLQQC  396



>ref|XP_006411618.1| hypothetical protein EUTSA_v10024734mg [Eutrema salsugineum]
 gb|ESQ53071.1| hypothetical protein EUTSA_v10024734mg [Eutrema salsugineum]
Length=596

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  436  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  495

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLG+LPPGLITF+N TYA++RSWHVLGLGY+P + Q  IE AAV+
Sbjct  496  IYHYWQDMNEERTLWKLGSLPPGLITFYNLTYAMERSWHVLGLGYDPALNQTAIENAAVV  555

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  556  HYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  590



>ref|XP_008670347.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Zea mays]
Length=624

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  466  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  525

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N  R LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP+V + +I+ AAV+
Sbjct  526  IYHKWQNMNEGRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVV  585

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+R+I+YD  ++R C
Sbjct  586  HYNGNMKPWLELAMTKYRPYWTRYIKYDHPYIRGC  620



>ref|XP_010436922.1| PREDICTED: probable galacturonosyltransferase 3 isoform X1 [Camelina 
sativa]
Length=634

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            ++GKV G VETC ESFHRFD+YLNFSNP IS++FD  ACGWAFGMN+ DL EWR+RNIT 
Sbjct  476  MQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNMFDLKEWRKRNITG  535

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLG+LPPGLITF+N TYA++RSWHVLGLGY+P + Q  IE AAV+
Sbjct  536  IYHYWQDMNEDRTLWKLGSLPPGLITFYNLTYAMERSWHVLGLGYDPALNQTAIENAAVV  595

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL ++  K++ YWS+++EYD  +LR C
Sbjct  596  HYNGNYKPWLGLAFAKYKAYWSKYVEYDNPYLRRC  630



>gb|EYU32902.1| hypothetical protein MIMGU_mgv1a002354mg [Erythranthe guttata]
Length=684

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+K+FDP ACGWA+GMN+ DL EW++++IT 
Sbjct  526  LHGKVNGAVETCGESFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNMFDLVEWKKQDITG  585

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L+++WHVLGLGYNP+V + DIE AAV+
Sbjct  586  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKTWHVLGLGYNPSVDRSDIENAAVV  645

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K++ YW+++I+YD  ++R C
Sbjct  646  HYNGNMKPWLELAMTKYKPYWTKYIKYDHPYIRNC  680



>ref|XP_009138790.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brassica rapa]
Length=674

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++F+P ACGWA+GMN+ DL EW++R+IT 
Sbjct  516  LNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLXEWKKRDITG  575

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N +R LWKLGTLPPGLITF+  T+ L+++WHVLGLGYNP++ +KDIE AAV+
Sbjct  576  IYHKWQNMNENRTLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIAKKDIENAAVV  635

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I++D  +LR C
Sbjct  636  HYNGNMKPWLELAMSKYRPYWTKYIQFDHPYLRRC  670



>ref|XP_010106747.1| Alpha-1,4-galacturonosyltransferase 1 [Morus notabilis]
 gb|EXC11714.1| Alpha-1,4-galacturonosyltransferase 1 [Morus notabilis]
Length=678

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNF+NP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  520  LHGKVNGAVETCGESFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITG  579

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L +SWHVLGLGYNP+V + +I+ AAVI
Sbjct  580  IYHKWQNMNEDRALWKLGTLPPGLITFYGLTHPLAKSWHVLGLGYNPSVDRSEIDNAAVI  639

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  +LR C
Sbjct  640  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYLRNC  674



>gb|EYU38036.1| hypothetical protein MIMGU_mgv1a002760mg [Erythranthe guttata]
Length=640

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L+G V G VETC ESFHRFD+YLNFSNP IS++FDP ACGWAFGMNI DL EWR+R+IT 
Sbjct  482  LQGMVNGAVETCKESFHRFDKYLNFSNPKISENFDPNACGWAFGMNIFDLREWRKRDITG  541

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N T+ L+RSWHVLGLGY+P + Q +I+ AAV+
Sbjct  542  IYHHWQEMNEDRTLWKLGTLPPGLITFYNLTHPLERSWHVLGLGYDPALNQTEIQNAAVV  601

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL+++I K+R+YWSR++ +D  +L+ C
Sbjct  602  HYNGNYKPWLDLAIGKYRSYWSRYVMFDNFYLQLC  636



>ref|XP_004957448.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Setaria italica]
Length=682

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCGESFHRFD+YLNFSNP I+++FDP ACGWA+GMNI DL EW++++IT 
Sbjct  524  LNGKVNGAVETCGESFHRFDKYLNFSNPHIAQNFDPNACGWAYGMNIFDLKEWKKKDITG  583

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGYNP++ + +I+ AAV+
Sbjct  584  IYHKWQNMNEDRVLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDGAAVV  643

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R YW+++I+YD  ++R C
Sbjct  644  HYNGNMKPWLELAMTKYRPYWTKYIKYDHPYIRGC  678



>ref|XP_009589124.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nicotiana tomentosiformis]
Length=687

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L GKV G VETCG+SFHRFD+YLNFSNP I+++FDP ACGWA+GMN+ DL EW++R+IT 
Sbjct  529  LHGKVNGAVETCGQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKRDITG  588

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+  T+ L++SWHVLGLGYNP++ + +IE AAVI
Sbjct  589  IYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSIDRSEIENAAVI  648

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+R+YW+++I++D  ++R C
Sbjct  649  HYNGNMKPWLELAMTKYRSYWTKYIKFDHPYIRSC  683



>ref|XP_004248575.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Solanum lycopersicum]
Length=635

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            L  KV G VETCGESFHRFD+YLNFSNP I+K+FDP ACGWA+GMNI DL EW++R+IT 
Sbjct  477  LHEKVNGAVETCGESFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNIFDLKEWKKRDITG  536

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGL+TF+  T+ LD+SWHVLGLGY+P++   +IE+AAVI
Sbjct  537  IYHKWQNMNEDRVLWKLGTLPPGLMTFYGLTHPLDKSWHVLGLGYSPSIDGSEIEKAAVI  596

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN+KPWLE+++ K+++YW+++I++D  ++R C
Sbjct  597  HYNGNMKPWLELAMTKYKSYWTKYIKFDHPYIRTC  631



>gb|KHG03188.1| putative galacturonosyltransferase 3 -like protein [Gossypium 
arboreum]
Length=400

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD+YLNFSNP+I ++F+P ACGWAFGMNI DL EWR+RNIT 
Sbjct  242  LKGMVNGAVETCKESFHRFDKYLNFSNPIIIENFNPNACGWAFGMNIFDLKEWRKRNITA  301

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ LN+DR LWKLGTLPPGLITF+N T+ LDR WHVLGLGY+P + + +IE AAVI
Sbjct  302  IYHHWQDLNDDRTLWKLGTLPPGLITFYNLTHPLDRKWHVLGLGYDPALNRTEIENAAVI  361

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL++++ K+++YWS+++     +L+ C
Sbjct  362  HYNGNYKPWLDLAVSKYQSYWSKYVSSGNYYLQRC  396



>ref|XP_004501286.1| PREDICTED: probable galacturonosyltransferase 3-like isoform 
X1 [Cicer arietinum]
Length=665

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  LKGKVIGVVETCGESFHRFDRYLNFSNPLISKSFDPRACGWAFGMNILDLSEWRRRNITE  573
            LKG V G VETC ESFHRFD+YLNFSNPLIS +F P ACGWAFGMN+ DL EW++RNIT 
Sbjct  507  LKGMVNGAVETCKESFHRFDKYLNFSNPLISNNFSPDACGWAFGMNVFDLKEWKKRNITG  566

Query  572  VYHSWQTLNNDRQLWKLGTLPPGLITFWNHTYALDRSWHVLGLGYNPNVRQKDIERAAVI  393
            +YH WQ +N DR LWKLGTLPPGLITF+N TY LDR WHVLGLGY+P +   +IE AAV+
Sbjct  567  IYHRWQDMNEDRTLWKLGTLPPGLITFYNLTYPLDRGWHVLGLGYDPALNLTEIENAAVV  626

Query  392  HYNGNLKPWLEISIPKFRNYWSRFIEYDQVFLREC  288
            HYNGN KPWL +++ K+R+YWSR++ +D  +LR C
Sbjct  627  HYNGNYKPWLNLAVSKYRSYWSRYVMFDNPYLRVC  661



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840