BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025O23

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011093846.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    142   5e-35   Sesamum indicum [beniseed]
ref|XP_002277641.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    142   1e-34   Vitis vinifera
ref|XP_009597215.1|  PREDICTED: uncharacterized protein LOC104093199    141   2e-34   Nicotiana tomentosiformis
emb|CDP03063.1|  unnamed protein product                                140   2e-34   Coffea canephora [robusta coffee]
ref|XP_011093845.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    140   2e-34   Sesamum indicum [beniseed]
gb|KDO73864.1|  hypothetical protein CISIN_1g004349mg                   139   5e-34   Citrus sinensis [apfelsine]
ref|XP_006474710.1|  PREDICTED: uncharacterized protein LOC102609180    139   9e-34   Citrus sinensis [apfelsine]
ref|XP_006452827.1|  hypothetical protein CICLE_v10007546mg             138   1e-33   Citrus clementina [clementine]
ref|XP_009796968.1|  PREDICTED: uncharacterized protein LOC104243478    137   3e-33   Nicotiana sylvestris
ref|XP_006342396.1|  PREDICTED: poly [ADP-ribose] polymerase 4-like     133   1e-31   Solanum tuberosum [potatoes]
ref|XP_011007767.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    127   9e-30   Populus euphratica
gb|KDP33933.1|  hypothetical protein JCGZ_07504                         127   2e-29   Jatropha curcas
ref|XP_010047465.1|  PREDICTED: uncharacterized protein LOC104436401    126   2e-29   Eucalyptus grandis [rose gum]
ref|XP_002324729.2|  inter-alpha-trypsin inhibitor heavy chain-re...    125   7e-29   
ref|XP_008242260.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    123   2e-28   
ref|XP_011078109.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    123   2e-28   
ref|XP_011078108.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    123   2e-28   
ref|XP_011078107.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    123   2e-28   
ref|XP_002516254.1|  inter-alpha-trypsin inhibitor heavy chain, p...    123   4e-28   Ricinus communis
ref|XP_007204639.1|  hypothetical protein PRUPE_ppa001864mg             122   1e-27   Prunus persica
ref|XP_006587053.1|  PREDICTED: uncharacterized protein LOC100820133    121   2e-27   Glycine max [soybeans]
ref|XP_007154569.1|  hypothetical protein PHAVU_003G129800g             120   3e-27   Phaseolus vulgaris [French bean]
ref|XP_003595328.1|  Inter-alpha-trypsin inhibitor heavy chain H3       120   3e-27   Medicago truncatula
ref|XP_006345262.1|  PREDICTED: uncharacterized protein LOC102582049    120   3e-27   Solanum tuberosum [potatoes]
ref|XP_008242259.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    120   3e-27   Prunus mume [ume]
ref|XP_009337232.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    120   4e-27   
gb|KHN17734.1|  von Willebrand factor A domain-containing protein       120   4e-27   Glycine soja [wild soybean]
ref|XP_003551107.1|  PREDICTED: von Willebrand factor A domain-co...    120   4e-27   Glycine max [soybeans]
ref|XP_007154568.1|  hypothetical protein PHAVU_003G129800g             118   7e-27   Phaseolus vulgaris [French bean]
ref|XP_011078106.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    119   9e-27   Sesamum indicum [beniseed]
ref|XP_006416537.1|  hypothetical protein EUTSA_v10006890mg             119   9e-27   Eutrema salsugineum [saltwater cress]
gb|KCW71312.1|  hypothetical protein EUGRSUZ_F04397                     118   1e-26   Eucalyptus grandis [rose gum]
gb|AAF79294.1|AC068602_17  F14D16.26                                    119   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173345.2|  inter-alpha-trypsin inhibitor heavy chain-like ...    118   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010261798.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    117   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004251694.1|  PREDICTED: uncharacterized protein LOC101250962    117   3e-26   Solanum lycopersicum
ref|XP_010654418.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    116   4e-26   Vitis vinifera
gb|KHN12291.1|  Inter-alpha-trypsin inhibitor heavy chain H1            116   5e-26   Glycine soja [wild soybean]
ref|XP_010242255.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    116   8e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010064019.1|  PREDICTED: uncharacterized protein LOC104450974    116   1e-25   Eucalyptus grandis [rose gum]
ref|XP_009149386.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    115   1e-25   Brassica rapa
ref|XP_009624355.1|  PREDICTED: uncharacterized protein LOC104115430    115   2e-25   Nicotiana tomentosiformis
emb|CDY26699.1|  BnaA06g13230D                                          115   2e-25   Brassica napus [oilseed rape]
ref|XP_010666845.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    115   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004488096.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    114   2e-25   
ref|XP_002271630.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    115   2e-25   Vitis vinifera
ref|XP_004488095.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    114   3e-25   Cicer arietinum [garbanzo]
ref|XP_008388928.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    114   3e-25   
ref|XP_003542365.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    114   3e-25   Glycine max [soybeans]
gb|KFK44049.1|  hypothetical protein AALP_AA1G209400                    114   5e-25   Arabis alpina [alpine rockcress]
ref|XP_006426697.1|  hypothetical protein CICLE_v10024980mg             114   6e-25   
ref|XP_007138645.1|  hypothetical protein PHAVU_009G226200g             113   6e-25   Phaseolus vulgaris [French bean]
ref|XP_009777936.1|  PREDICTED: uncharacterized protein LOC104227395    114   7e-25   Nicotiana sylvestris
ref|XP_007138646.1|  hypothetical protein PHAVU_009G226200g             113   8e-25   Phaseolus vulgaris [French bean]
emb|CDX81914.1|  BnaC08g36870D                                          113   9e-25   
emb|CDY41019.1|  BnaC05g14770D                                          113   9e-25   Brassica napus [oilseed rape]
gb|EYU25841.1|  hypothetical protein MIMGU_mgv1a001817mg                113   1e-24   Erythranthe guttata [common monkey flower]
gb|KHG04434.1|  von Willebrand factor A domain-containing               112   1e-24   Gossypium arboreum [tree cotton]
emb|CDX83787.1|  BnaC08g18580D                                          112   1e-24   
gb|KHN07890.1|  von Willebrand factor A domain-containing protein       112   1e-24   Glycine soja [wild soybean]
ref|XP_010459567.1|  PREDICTED: uncharacterized protein LOC104740606    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004508009.1|  PREDICTED: uncharacterized protein LOC101514299    112   2e-24   Cicer arietinum [garbanzo]
ref|XP_002890318.1|  hypothetical protein ARALYDRAFT_472131             112   2e-24   
ref|XP_008356516.1|  PREDICTED: von Willebrand factor A domain-co...    109   2e-24   
ref|XP_010498320.1|  PREDICTED: uncharacterized protein LOC104776024    112   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009359719.1|  PREDICTED: uncharacterized protein LOC103950254    112   3e-24   Pyrus x bretschneideri [bai li]
gb|KJB35005.1|  hypothetical protein B456_006G094900                    110   4e-24   Gossypium raimondii
ref|XP_008337842.1|  PREDICTED: von Willebrand factor A domain-co...    110   4e-24   
ref|XP_006465891.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    111   4e-24   Citrus sinensis [apfelsine]
gb|KDO64972.1|  hypothetical protein CISIN_1g004469mg                   111   5e-24   Citrus sinensis [apfelsine]
ref|XP_009117566.1|  PREDICTED: uncharacterized protein LOC103842665    111   5e-24   Brassica rapa
emb|CDY21682.1|  BnaA09g44330D                                          111   6e-24   Brassica napus [oilseed rape]
ref|XP_008337841.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   6e-24   Malus domestica [apple tree]
ref|XP_010477113.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   7e-24   Camelina sativa [gold-of-pleasure]
gb|KJB82977.1|  hypothetical protein B456_013G222900                    109   9e-24   Gossypium raimondii
gb|KCW71310.1|  hypothetical protein EUGRSUZ_F04397                     110   9e-24   Eucalyptus grandis [rose gum]
gb|KJB07329.1|  hypothetical protein B456_001G016000                    108   1e-23   Gossypium raimondii
ref|XP_010654417.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   1e-23   Vitis vinifera
ref|XP_009110301.1|  PREDICTED: uncharacterized protein LOC103835866    109   2e-23   Brassica rapa
gb|KJB82978.1|  hypothetical protein B456_013G222900                    109   2e-23   Gossypium raimondii
ref|XP_011072601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    109   2e-23   Sesamum indicum [beniseed]
gb|KHG29331.1|  von Willebrand factor A domain-containing               109   2e-23   Gossypium arboreum [tree cotton]
ref|XP_006385524.1|  hypothetical protein POPTR_0003s06600g             107   2e-23   
ref|XP_006385523.1|  hypothetical protein POPTR_0003s06600g             107   2e-23   
ref|XP_010537668.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    109   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_009625888.1|  PREDICTED: von Willebrand factor A domain-co...    108   2e-23   Nicotiana tomentosiformis
emb|CDO97834.1|  unnamed protein product                                109   3e-23   Coffea canephora [robusta coffee]
ref|XP_010273853.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    108   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009625883.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    108   3e-23   
ref|XP_008342579.1|  PREDICTED: uncharacterized protein LOC103405374    108   3e-23   Malus domestica [apple tree]
ref|XP_009625881.1|  PREDICTED: von Willebrand factor A domain-co...    108   4e-23   Nicotiana tomentosiformis
gb|KDP40680.1|  hypothetical protein JCGZ_24679                         108   4e-23   Jatropha curcas
ref|XP_004235553.1|  PREDICTED: uncharacterized protein LOC101253...    108   4e-23   Solanum lycopersicum
gb|KJB07325.1|  hypothetical protein B456_001G016000                    107   4e-23   Gossypium raimondii
ref|XP_006342928.1|  PREDICTED: uncharacterized protein LOC102599336    108   4e-23   Solanum tuberosum [potatoes]
ref|XP_010537666.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    108   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_007024661.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    107   8e-23   
emb|CDX96680.1|  BnaA08g22230D                                          107   9e-23   
ref|XP_010273855.1|  PREDICTED: uncharacterized protein LOC104609...    107   1e-22   Nelumbo nucifera [Indian lotus]
gb|KJB07327.1|  hypothetical protein B456_001G016000                    107   1e-22   Gossypium raimondii
ref|XP_006369125.1|  hypothetical protein POPTR_0001s16700g             106   1e-22   
gb|KJB35006.1|  hypothetical protein B456_006G094900                    107   1e-22   Gossypium raimondii
gb|KJB35007.1|  hypothetical protein B456_006G094900                    107   2e-22   Gossypium raimondii
ref|XP_007012610.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    107   2e-22   
gb|AES92187.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    107   2e-22   Medicago truncatula
ref|XP_003608035.1|  von Willebrand factor A domain-containing pr...    106   2e-22   
ref|XP_008373868.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    106   2e-22   Malus domestica [apple tree]
ref|XP_009344471.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    106   2e-22   Pyrus x bretschneideri [bai li]
gb|KEH32426.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    106   2e-22   Medicago truncatula
ref|XP_004287649.1|  PREDICTED: uncharacterized protein LOC101300180    106   2e-22   Fragaria vesca subsp. vesca
gb|KJB65321.1|  hypothetical protein B456_010G089800                    105   2e-22   Gossypium raimondii
ref|XP_010537667.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    106   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_011036460.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    105   3e-22   Populus euphratica
ref|XP_009764208.1|  PREDICTED: uncharacterized protein LOC104215...    105   4e-22   Nicotiana sylvestris
ref|XP_010537665.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    105   5e-22   Tarenaya hassleriana [spider flower]
ref|XP_011035744.1|  PREDICTED: uncharacterized protein LOC105133...    104   8e-22   Populus euphratica
gb|KJB65318.1|  hypothetical protein B456_010G089800                    104   8e-22   Gossypium raimondii
ref|XP_009625882.1|  PREDICTED: von Willebrand factor A domain-co...    104   1e-21   Nicotiana tomentosiformis
ref|XP_010531895.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    104   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_002304123.1|  hypothetical protein POPTR_0003s06600g             104   1e-21   
ref|XP_006385521.1|  hypothetical protein POPTR_0003s06600g             104   1e-21   Populus trichocarpa [western balsam poplar]
gb|KJB65322.1|  hypothetical protein B456_010G089800                    103   1e-21   Gossypium raimondii
ref|XP_011036459.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    103   2e-21   Populus euphratica
ref|XP_008450941.1|  PREDICTED: uncharacterized protein LOC103492379    103   3e-21   Cucumis melo [Oriental melon]
ref|XP_010318474.1|  PREDICTED: uncharacterized protein LOC101253...    103   3e-21   Solanum lycopersicum
ref|XP_011036458.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    103   3e-21   Populus euphratica
ref|XP_004144038.1|  PREDICTED: uncharacterized protein LOC101210279    103   3e-21   Cucumis sativus [cucumbers]
ref|XP_011035743.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    102   4e-21   Populus euphratica
gb|KHG11270.1|  von Willebrand factor A domain-containing               102   5e-21   Gossypium arboreum [tree cotton]
ref|XP_007012611.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    102   6e-21   
ref|XP_004303707.1|  PREDICTED: von Willebrand factor A domain-co...    102   7e-21   Fragaria vesca subsp. vesca
ref|XP_002532724.1|  inter-alpha-trypsin inhibitor heavy chain, p...    101   9e-21   Ricinus communis
ref|XP_009764209.1|  PREDICTED: uncharacterized protein LOC104215...    100   2e-20   Nicotiana sylvestris
ref|XP_010318475.1|  PREDICTED: uncharacterized protein LOC101253...    100   2e-20   Solanum lycopersicum
ref|XP_006306812.1|  hypothetical protein CARUB_v10008355mg           99.0    7e-20   
dbj|BAJ95100.1|  predicted protein                                    99.0    9e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB07323.1|  hypothetical protein B456_001G016000                  97.8    2e-19   Gossypium raimondii
ref|XP_010273854.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  97.1    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_004141711.1|  PREDICTED: uncharacterized protein LOC101206287  96.7    5e-19   Cucumis sativus [cucumbers]
gb|EYU21307.1|  hypothetical protein MIMGU_mgv1a001939mg              96.7    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_003557739.1|  PREDICTED: uncharacterized protein LOC100836064  96.3    6e-19   Brachypodium distachyon [annual false brome]
ref|XP_008462288.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  95.5    9e-19   Cucumis melo [Oriental melon]
ref|XP_008228173.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  95.9    1e-18   Prunus mume [ume]
ref|XP_006390650.1|  hypothetical protein EUTSA_v10018177mg           95.5    1e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010685291.1|  PREDICTED: uncharacterized protein LOC104899734  95.1    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001141509.1|  hypothetical protein                             92.4    2e-18   
ref|XP_010111991.1|  von Willebrand factor A domain-containing pr...  94.4    3e-18   
ref|XP_008462286.1|  PREDICTED: uncharacterized protein LOC103500...  94.4    3e-18   Cucumis melo [Oriental melon]
ref|XP_008462285.1|  PREDICTED: uncharacterized protein LOC103500...  94.4    3e-18   Cucumis melo [Oriental melon]
ref|XP_009105911.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  94.4    3e-18   Brassica rapa
emb|CDX72920.1|  BnaC06g33680D                                        93.6    5e-18   
ref|XP_004984065.1|  PREDICTED: uncharacterized protein LOC101774...  92.4    9e-18   
dbj|BAC80088.1|  unknown protein                                      90.1    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060262.2|  Os07g0614300                                     90.1    1e-17   
ref|XP_006598837.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  92.0    2e-17   Glycine max [soybeans]
gb|KHN39616.1|  Inter-alpha-trypsin inhibitor heavy chain H5          91.7    2e-17   Glycine soja [wild soybean]
ref|XP_004984064.1|  PREDICTED: uncharacterized protein LOC101774...  91.3    3e-17   Setaria italica
ref|XP_008667805.1|  PREDICTED: hypothetical protein isoform X1       90.9    4e-17   
ref|XP_004958289.1|  PREDICTED: uncharacterized protein LOC101756562  90.9    4e-17   
gb|KFK41669.1|  hypothetical protein AALP_AA2G157400                  90.5    5e-17   Arabis alpina [alpine rockcress]
ref|NP_001050335.2|  Os03g0407000                                     88.2    6e-17   
ref|XP_006650182.1|  PREDICTED: uncharacterized protein LOC102717967  90.1    7e-17   Oryza brachyantha
gb|KHN01425.1|  Inter-alpha-trypsin inhibitor heavy chain H3          89.7    1e-16   Glycine soja [wild soybean]
ref|XP_003528576.1|  PREDICTED: uncharacterized protein LOC100807...  89.7    1e-16   Glycine max [soybeans]
ref|XP_003627335.1|  hypothetical protein MTR_8g021260                86.3    1e-16   
ref|XP_010416000.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  89.4    2e-16   Camelina sativa [gold-of-pleasure]
gb|EEE67586.1|  hypothetical protein OsJ_25118                        89.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010471276.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  89.0    2e-16   Camelina sativa [gold-of-pleasure]
gb|ABF96528.1|  von Willebrand factor type A domain containing pr...  88.2    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010428136.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  89.0    2e-16   
ref|XP_009414822.1|  PREDICTED: uncharacterized protein LOC103995...  88.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC82439.1|  hypothetical protein OsI_26857                        89.0    2e-16   Oryza sativa Indica Group [Indian rice]
gb|AAG52586.1|AC016529_17  hypothetical protein; 14673-17893          87.8    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177394.2|  uncharacterized protein                             87.8    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782726.1|  PREDICTED: LOW QUALITY PROTEIN: inter alpha-...  87.4    5e-16   
ref|XP_002465153.1|  hypothetical protein SORBIDRAFT_01g032840        87.0    8e-16   Sorghum bicolor [broomcorn]
gb|EEE59232.1|  hypothetical protein OsJ_11214                        87.0    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002888881.1|  hypothetical protein ARALYDRAFT_476383           86.7    9e-16   Arabidopsis lyrata subsp. lyrata
gb|KEH18484.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  86.3    1e-15   Medicago truncatula
gb|AET01809.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...  86.7    1e-15   Medicago truncatula
gb|ABF96527.1|  von Willebrand factor type A domain containing pr...  86.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404352.1|  PREDICTED: uncharacterized protein LOC103987694  86.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006583165.1|  PREDICTED: uncharacterized protein LOC100807...  85.9    1e-15   Glycine max [soybeans]
ref|XP_008653341.1|  PREDICTED: von Willebrand factor A domain-co...  83.2    9e-15   
ref|XP_007135423.1|  hypothetical protein PHAVU_010G128200g           83.2    1e-14   Phaseolus vulgaris [French bean]
ref|XP_006658810.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  82.8    2e-14   
ref|XP_002461009.1|  hypothetical protein SORBIDRAFT_02g039160        82.0    3e-14   Sorghum bicolor [broomcorn]
ref|XP_010235662.1|  PREDICTED: uncharacterized protein LOC100843408  82.0    3e-14   Brachypodium distachyon [annual false brome]
tpg|DAA63586.1|  TPA: hypothetical protein ZEAMMB73_270893            81.6    4e-14   
ref|XP_006301970.1|  hypothetical protein CARUB_v10022450mg           81.3    6e-14   Capsella rubella
dbj|BAK07105.1|  predicted protein                                    78.2    3e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010937323.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  79.3    3e-13   Elaeis guineensis
ref|XP_009389548.1|  PREDICTED: uncharacterized protein LOC103976087  75.5    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83726.1|  hypothetical protein B456_013G261400                  75.1    6e-12   Gossypium raimondii
gb|EMT10977.1|  hypothetical protein F775_14225                       74.3    8e-12   
ref|XP_006836596.1|  hypothetical protein AMTR_s00131p00098870        73.6    2e-11   Amborella trichopoda
ref|XP_010537629.1|  PREDICTED: uncharacterized protein LOC104812256  70.5    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_004510514.1|  PREDICTED: uncharacterized protein LOC101499440  70.1    2e-10   Cicer arietinum [garbanzo]
ref|XP_010318476.1|  PREDICTED: von Willebrand factor A domain-co...  64.7    1e-08   Solanum lycopersicum
gb|KJB65319.1|  hypothetical protein B456_010G089800                  64.3    2e-08   Gossypium raimondii
gb|AAU89244.1|  von Willebrand factor type A domain containing pr...  63.2    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477112.1|  PREDICTED: uncharacterized protein LOC104756252  59.3    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003609990.1|  von Willebrand factor A domain-containing pr...  62.4    7e-08   
gb|KCW71308.1|  hypothetical protein EUGRSUZ_F04395                   57.0    3e-07   Eucalyptus grandis [rose gum]
gb|ABF96529.1|  von Willebrand factor type A domain containing pr...  60.5    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHN06057.1|  hypothetical protein glysoja_035963                   56.2    2e-06   Glycine soja [wild soybean]
ref|XP_007216978.1|  hypothetical protein PRUPE_ppa002885mg           58.2    2e-06   
ref|XP_007135424.1|  hypothetical protein PHAVU_010G128200g           58.2    2e-06   Phaseolus vulgaris [French bean]
tpg|DAA41433.1|  TPA: hypothetical protein ZEAMMB73_769800            58.2    2e-06   
ref|XP_006385522.1|  hypothetical protein POPTR_0003s06600g           57.8    2e-06   
tpg|DAA41434.1|  TPA: hypothetical protein ZEAMMB73_769800            57.8    3e-06   
gb|ETO27230.1|  hypothetical protein RFI_09901                        54.7    8e-06   Reticulomyxa filosa
gb|EPS65940.1|  hypothetical protein M569_08838                       55.5    2e-05   Genlisea aurea
gb|ETO32114.1|  hypothetical protein RFI_05003                        54.7    2e-05   Reticulomyxa filosa
gb|KDO73865.1|  hypothetical protein CISIN_1g004349mg                 53.9    5e-05   Citrus sinensis [apfelsine]
ref|XP_006452826.1|  hypothetical protein CICLE_v10007546mg           52.8    1e-04   
gb|KEH18487.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  52.4    2e-04   Medicago truncatula
gb|KEH18485.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  52.4    2e-04   Medicago truncatula
ref|XP_002503574.1|  predicted protein                                51.2    5e-04   Micromonas commoda
ref|XP_010462785.1|  PREDICTED: uncharacterized protein LOC104743395  50.4    5e-04   



>ref|XP_011093846.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Sesamum indicum]
Length=756

 Score =   142 bits (359),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 89/160 (56%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KE+P+ K++ K QIE LTA+AW+T+N++L+EKIA+ SVQ+ I+SEYTNM  + T++ K  
Sbjct  574  KEMPIDKIVVKHQIEQLTAQAWYTENQELKEKIAKMSVQNAIISEYTNMVLLETDKGKIN  633

Query  548  TEPSKVNKKTG--------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAA  399
             + + V K +G        DPK QK IIML N+G+GFG+LTATAEN PPGS  T  P+AA
Sbjct  634  ADSAVVKKVSGKGDHHKAEDPKPQK-IIMLPNMGIGFGNLTATAENIPPGSSYTRPPDAA  692

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+F +AAS+CC  +C +CCCMCCIQ CS++NDQCA+++TQ
Sbjct  693  EVFAKAASDCCASLCGRCCCMCCIQTCSRMNDQCAILITQ  732



>ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Vitis 
vinifera]
 emb|CBI27786.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   142 bits (357),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 90/161 (56%), Positives = 119/161 (74%), Gaps = 12/161 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KEIPL +VLAKQQI  LTA+AWF++NK+LEEKIA  S+Q G++SEYT M  + T+     
Sbjct  573  KEIPLDRVLAKQQIGWLTAQAWFSENKQLEEKIAEMSIQTGVISEYTRMILLETQGGAQV  632

Query  548  TEPSKV---------NKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEA  402
            +EP +V          +   D K+QK II+L++LG+GFG++ ATAEN PPGS     PEA
Sbjct  633  SEPGRVQEPPKTMEYQRPVVDSKVQK-IILLQSLGVGFGNVNATAENYPPGSEEVKLPEA  691

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AE+FV+AASNCC  +C  CCCMCCI+MC+++NDQCA+V+TQ
Sbjct  692  AEIFVKAASNCCAKMCGYCCCMCCIRMCTRMNDQCAIVLTQ  732



>ref|XP_009597215.1| PREDICTED: uncharacterized protein LOC104093199 [Nicotiana tomentosiformis]
Length=753

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 117/157 (75%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA+QQ+E+LTA+AW T+NK LE+KIA+ S+QH ++SEYT M  + T+  K  
Sbjct  575  KDIPLDKVLARQQVELLTAQAWLTENKDLEQKIAQTSIQHAVISEYTRMILMETDRGKVV  634

Query  548  TEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMF  390
            TE       S   KK  +PKL+K  I+L+NL +GFG+ +AT EN PPG S +KPE AE+ 
Sbjct  635  TESTSKRKVSTAAKKIEEPKLEKK-ILLQNLAVGFGNYSATVENIPPGASETKPETAEIL  693

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  +CD CCCMCCI+ CSK+NDQCA+V+TQ
Sbjct  694  AKAASNCCGKMCDICCCMCCIRTCSKMNDQCAIVLTQ  730



>emb|CDP03063.1| unnamed protein product [Coffea canephora]
Length=748

 Score =   140 bits (354),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 90/153 (59%), Positives = 120/153 (78%), Gaps = 4/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AKQ+IE+LTAEAWF +NK+LE KIA+ S+Q+ ++SE+T++  + T+     
Sbjct  574  KDIPLHKVQAKQEIELLTAEAWFAENKELETKIAKLSLQNSVISEFTHLLLLETDMVNKK  633

Query  548  TEPSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMFVQAA  378
              P KV+ ++  DPK QK II+ RNLG+GFG+LTATA+N PPGS  T   EAAE+ V+AA
Sbjct  634  QVPKKVDPQRAEDPKAQK-IIVKRNLGVGFGNLTATADNIPPGSDETKHLEAAEIIVKAA  692

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SNCC  +CD CCCMCCI++CS++NDQCAVV+TQ
Sbjct  693  SNCCGKLCDYCCCMCCIKVCSRLNDQCAVVLTQ  725



>ref|XP_011093845.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Sesamum indicum]
Length=758

 Score =   140 bits (354),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 89/162 (55%), Positives = 121/162 (75%), Gaps = 13/162 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KE+P+ K++ K QIE LTA+AW+T+N++L+EKIA+ SVQ+ I+SEYTNM  + T++ K  
Sbjct  574  KEMPIDKIVVKHQIEQLTAQAWYTENQELKEKIAKMSVQNAIISEYTNMVLLETDKGKIN  633

Query  548  TEPSKVNK----------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPE  405
             + + V K          K  DPK QK IIML N+G+GFG+LTATAEN PPGS  T  P+
Sbjct  634  ADSAVVKKLQVSGKGDHHKAEDPKPQK-IIMLPNMGIGFGNLTATAENIPPGSSYTRPPD  692

Query  404  AAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AAE+F +AAS+CC  +C +CCCMCCIQ CS++NDQCA+++TQ
Sbjct  693  AAEVFAKAASDCCASLCGRCCCMCCIQTCSRMNDQCAILITQ  734



>gb|KDO73864.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=759

 Score =   139 bits (351),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T+E    
Sbjct  576  KDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQTGVLCEYTRMIIVETDERNNA  635

Query  548  TEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--SKPEAAE  396
            +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS     PE AE
Sbjct  636  SESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPKLPEVAE  695

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +FV+AASNCC  + +KCCC+CCI+ C+K+NDQC +V+TQ
Sbjct  696  IFVKAASNCCSTLGNKCCCLCCIECCNKLNDQCVIVLTQ  734



>ref|XP_006474710.1| PREDICTED: uncharacterized protein LOC102609180 [Citrus sinensis]
Length=759

 Score =   139 bits (350),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T+E    
Sbjct  576  KDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQIGVLCEYTRMIIVETDERNNA  635

Query  548  TEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--SKPEAAE  396
            +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS     PE AE
Sbjct  636  SESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPKLPEVAE  695

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +FV+AASNCC  + +KCCC+CCI+ C+K+NDQC +V+TQ
Sbjct  696  IFVKAASNCCSTLGNKCCCLCCIECCNKLNDQCVIVLTQ  734



>ref|XP_006452827.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66067.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=758

 Score =   138 bits (348),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T+E    
Sbjct  576  KDLPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQTGVLCEYTRMIIVETDERNNA  635

Query  548  TEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--SKPEAAE  396
            +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS     PE AE
Sbjct  636  SESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPKLPEVAE  695

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +FV+AASNCC  + +KCCC+CCI+ C+K+NDQC +V+TQ
Sbjct  696  IFVKAASNCCSTLGNKCCCLCCIECCNKLNDQCVIVLTQ  734



>ref|XP_009796968.1| PREDICTED: uncharacterized protein LOC104243478 [Nicotiana sylvestris]
Length=753

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 115/157 (73%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA+QQ+E++TA+AW T+NK LE+KIA+ S+QH ++SEYT M  + T+  K  
Sbjct  575  KDIPLDKVLARQQVELITAQAWLTENKDLEQKIAQTSIQHAVISEYTRMILMETDRGKVV  634

Query  548  TEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMF  390
            TE       S   K   +PKL+K  I+L NL +GFG+ +AT EN PPG S +KPE AE+ 
Sbjct  635  TESTSKRKVSTAAKNIEEPKLEKK-ILLENLAVGFGNYSATVENIPPGASETKPETAEIL  693

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  +CD CCCMCCI+ CSK+NDQCA+V+TQ
Sbjct  694  AKAASNCCGKMCDICCCMCCIRTCSKMNDQCAIVLTQ  730



>ref|XP_006342396.1| PREDICTED: poly [ADP-ribose] polymerase 4-like [Solanum tuberosum]
Length=752

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 114/157 (73%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA+QQIE+LTA+AW T NK LE+KIA+ S+Q+G++SEYT M  I T++ K  
Sbjct  574  KDIPLDKVLARQQIELLTAQAWLTDNKDLEQKIAQTSIQNGVISEYTRMILIETDKGKVI  633

Query  548  TEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-KPEAAEMF  390
            TE       S   KK  + KLQK   +L+NLG GFG+ +AT EN  PG T  KPE AE+ 
Sbjct  634  TESTSKRKVSTAPKKIEEAKLQKK-TLLQNLGAGFGNYSATIENISPGITEKKPETAEIL  692

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  +CD CCCMCCI+ CSK+NDQCA+V+TQ
Sbjct  693  AKAASNCCGKMCDICCCMCCIRTCSKMNDQCAIVLTQ  729



>ref|XP_011007767.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Populus 
euphratica]
Length=756

 Score =   127 bits (320),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 85/159 (53%), Positives = 118/159 (74%), Gaps = 10/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT------  567
            K+IPL  V AKQQI++LTA+AWF++NK+LEEK+A+ S+Q G++SEYT M+ + T      
Sbjct  574  KDIPLHSVSAKQQIDLLTAQAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLETDRGNQA  633

Query  566  -EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
             E   G   P +VN +  D + ++  I LRNLG+GFG+LTATAEN  PG+     PEAAE
Sbjct  634  AESPGGRKLPRQVNPQKVDFQGRRR-IFLRNLGVGFGNLTATAENLRPGAEESKLPEAAE  692

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + ++AASNCC ++C++CCCMCC+Q CSKIN+Q A+V+TQ
Sbjct  693  IIIKAASNCCSIMCNQCCCMCCVQCCSKINNQFAIVLTQ  731



>gb|KDP33933.1| hypothetical protein JCGZ_07504 [Jatropha curcas]
Length=756

 Score =   127 bits (318),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 82/159 (52%), Positives = 113/159 (71%), Gaps = 10/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEE-TKG  552
            K++P  ++ AKQQI++LTA+AWF++NK+LEEK+ + S+Q G+ SEYT +  + T+   + 
Sbjct  574  KDMPFERIFAKQQIDLLTAQAWFSENKRLEEKVVKMSIQTGVFSEYTRLTLLETQRGNQA  633

Query  551  TTEPS------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAE  396
            T  PS      K +    D + +K  I+L+NLG+GFG+L ATAEN PPG      PEAAE
Sbjct  634  TDSPSTRTLLHKGDSSKVDSQGRKR-ILLQNLGVGFGNLAATAENIPPGIEEPKLPEAAE  692

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + ++AASNCC  +C  CCCMCCIQ CSKINDQCA+V+TQ
Sbjct  693  IIIKAASNCCGRICSHCCCMCCIQCCSKINDQCAIVLTQ  731



>ref|XP_010047465.1| PREDICTED: uncharacterized protein LOC104436401 [Eucalyptus grandis]
 gb|KCW79379.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=755

 Score =   126 bits (317),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 84/155 (54%), Positives = 112/155 (72%), Gaps = 6/155 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L ++ AKQQI+  TA+AWF+++K+LEEK+A+ S+Q GI SE+T M  I  +E    
Sbjct  579  KDILLDRLFAKQQIDHFTAKAWFSEDKQLEEKVAKLSIQSGIASEFTRMILIEADEATKA  638

Query  548  TEPS---KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMFVQ  384
            TE +   K  +K  DPK+ K  IMLR+L +GFG+LTAT EN PPG+     PEAAE+ V+
Sbjct  639  TESAGSDKAPRKMPDPKVYKQ-IMLRSLCIGFGNLTATIENIPPGAEQVKLPEAAEILVK  697

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AASNCC  +C+ CCCMCCIQ CS++NDQ  +VMTQ
Sbjct  698  AASNCCGTICNHCCCMCCIQCCSRLNDQFVMVMTQ  732



>ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
 gb|EEF03294.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
Length=752

 Score =   125 bits (314),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 81/155 (52%), Positives = 113/155 (73%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL  V AKQQI++LTA+AWF++NK+LEEK+A+ S+Q G++SEYT M+ + T+     
Sbjct  574  KDIPLHSVSAKQQIDLLTAQAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLETDRGNQA  633

Query  548  TEPSKVNKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQ  384
             E    +K   + K+    +  I LRNLG+GFG+LTATAEN  PG+     PEAAE+ ++
Sbjct  634  AESPGGHKVCANLKVDSQGRRRIFLRNLGVGFGNLTATAENLRPGAEESKLPEAAEIIIK  693

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AASNCC ++C +CCCMCC+Q C KIN+Q A+V+TQ
Sbjct  694  AASNCCSIMCKQCCCMCCVQCCFKINNQFAIVLTQ  728



>ref|XP_008242260.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Prunus mume]
Length=592

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +  E++   
Sbjct  416  KDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIIVDKEQSGPQ  475

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMFVQAAS  375
              P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+F +AAS
Sbjct  476  EAPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENVPPGSEEPKQPEAAEIFARAAS  534

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC  +C  CCCM CI+  S+IN QCA V  Q
Sbjct  535  NCCGSMCTHCCCMGCIKCFSRINPQCANVFAQ  566



>ref|XP_011078109.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
isoform X4 [Sesamum indicum]
Length=613

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  K T
Sbjct  433  KDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERMKIT  492

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   PEA 
Sbjct  493  ADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPPEAG  551

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  552  DAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  591



>ref|XP_011078108.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Sesamum indicum]
Length=641

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  K T
Sbjct  461  KDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERMKIT  520

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   PEA 
Sbjct  521  ADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPPEAG  579

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  580  DAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  619



>ref|XP_011078107.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Sesamum indicum]
Length=664

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  K T
Sbjct  484  KDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERMKIT  543

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   PEA 
Sbjct  544  ADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPPEAG  602

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  603  DAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  642



>ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF46256.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=755

 Score =   123 bits (308),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 78/158 (49%), Positives = 111/158 (70%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  K+ AKQQI++LTA+AW+++NK+LEEK+A+ S+Q G+ SEYT +  +  E     
Sbjct  574  KDVPFDKIFAKQQIDLLTAQAWYSENKQLEEKVAKMSIQTGVASEYTRLTLLEMERGNQA  633

Query  548  TEPSKVNK---KTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEM  393
             E  + +K   KT   K+    +  I+L+N G+GFG+L ATA+N PPG      PEAAE+
Sbjct  634  IESPRAHKFSNKTDSLKVDYKGRRRILLQNFGVGFGNLAATADNIPPGVEELKLPEAAEL  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             ++AASNCC  VC +CCCMCCIQ CS++NDQCA+ +TQ
Sbjct  694  IMKAASNCCGRVCGQCCCMCCIQCCSRMNDQCAIALTQ  731



>ref|XP_007204639.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
 gb|EMJ05838.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
Length=753

 Score =   122 bits (305),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 78/152 (51%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +G E++   
Sbjct  577  KDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIILGKEQSGPQ  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAEMFVQAAS  375
              P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+F +AAS
Sbjct  637  EVPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENIPPGSEEPKQPEAAEIFARAAS  695

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC  +C  CCCM CI+  S+IN QCA V  Q
Sbjct  696  NCCGSMCTHCCCMGCIKCFSRINPQCANVFAQ  727



>ref|XP_006587053.1| PREDICTED: uncharacterized protein LOC100820133 [Glycine max]
Length=759

 Score =   121 bits (303),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 108/158 (68%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI------GT  567
            K IP+ ++ A+ QIE LTA+AW +K++KLE+ +A+ S+Q G  SEYT+M  +        
Sbjct  578  KGIPVQRICARDQIEYLTAQAWLSKDEKLEQMVAKLSLQTGFTSEYTSMTILEIDLRKKA  637

Query  566  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  393
            +E+ G     K N ++G  + ++ +I+L  LG+GFG+LTATAEN  PGS  T  P+ AE+
Sbjct  638  KESDGKKVSKKSNPQSGAKEQEQRVILLPPLGIGFGNLTATAENIQPGSEETKGPDGAEI  697

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AA+NCC   C+ CCCMCCIQ  ++IN+QCA+  TQ
Sbjct  698  FVKAATNCCGTCCNYCCCMCCIQAFTRINNQCAIAFTQ  735



>ref|XP_007154569.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26563.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=753

 Score =   120 bits (302),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 78/157 (50%), Positives = 111/157 (71%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K++P+ +V A+ QI  LTA+AWF +NK+LE+K+A+ S+Q G +SEYT M  + T+     
Sbjct  574  KDMPVQRVSARDQIHHLTAQAWFLENKQLEQKVAKLSLQTGFISEYTRMVLLETDHIKKV  633

Query  563  -ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMF  390
             E+ GT    K N +   P   + +I+L +LG+GFG+LTATAENTPPG  SK PE  E+F
Sbjct  634  KESAGTKASEKSNGQFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGYESKLPEVPEIF  693

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AA+NCC+ +C  CCCMCCIQ C+++N+QCA  +TQ
Sbjct  694  -KAATNCCETLCSYCCCMCCIQCCARLNNQCATALTQ  729



>ref|XP_003595328.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Medicago truncatula]
 gb|AES65579.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=751

 Score =   120 bits (302),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 4/154 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE--ETK  555
            K++PL +V A++QIE LTA+AW T NK+LE KIA+ S+Q G +SEYT M+ +  +  +T 
Sbjct  575  KDMPLERVFAREQIEYLTAQAWLTNNKQLEHKIAKLSLQTGFLSEYTRMSVLEVDHLKTA  634

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMFVQA  381
              ++ +K +KK G+    +  ++L  LG+GFG+L ATAENTPPG    S  ++AEMFV+A
Sbjct  635  KQSDGTKASKKKGEKDQGQRTLLLPKLGIGFGNLAATAENTPPGGDEPSLNDSAEMFVKA  694

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A++CC    + CCCMCCIQ+C+K+N+QCA V +Q
Sbjct  695  ATHCCGSCLNHCCCMCCIQVCTKMNNQCATVFSQ  728



>ref|XP_006345262.1| PREDICTED: uncharacterized protein LOC102582049 [Solanum tuberosum]
Length=754

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K IPL K   KQQIEILTA+AWFT+NK LE+KIA+ S+Q  ++SEYT MA + TE+ K  
Sbjct  576  KAIPLDKARVKQQIEILTAQAWFTQNKDLEQKIAKMSIQDAVISEYTRMALVETEKVKII  635

Query  548  TEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTS-KPEAAEMFVQ  384
               +K    + D K+++ +    I+L  LG GFG+LTAT EN PPG+   + EAAE+  +
Sbjct  636  KPTTKRKVHSDDEKIEERLVQKTILLHYLGFGFGNLTATIENIPPGAIDIEDEAAEIIAK  695

Query  383  AASNcc-kmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A SNC  K+    CCC CCI+ CS +N QCA+ +TQ
Sbjct  696  ATSNCFGKLCGLCCCCSCCIRTCSTMNHQCAIALTQ  731



>ref|XP_008242259.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Prunus mume]
Length=753

 Score =   120 bits (301),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 77/152 (51%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +  E++   
Sbjct  577  KDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIIVDKEQSGPQ  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAEMFVQAAS  375
              P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+F +AAS
Sbjct  637  EAPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENVPPGSEEPKQPEAAEIFARAAS  695

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC  +C  CCCM CI+  S+IN QCA V  Q
Sbjct  696  NCCGSMCTHCCCMGCIKCFSRINPQCANVFAQ  727



>ref|XP_009337232.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Pyrus 
x bretschneideri]
Length=757

 Score =   120 bits (301),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 79/152 (52%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL K+  K QIE+LTA+AW+  NK+LE+K+A+ S+Q  +VSEYT M  + T E  G+
Sbjct  580  KDIPLDKICTKGQIELLTAQAWYGDNKQLEDKVAKLSMQTNVVSEYTRMVILHT-ELSGS  638

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAAS  375
             E SK   +T   +  + +++L  L +GFG+L ATAEN PPGS  +  PEAAE+FV+AAS
Sbjct  639  QEASK-KSRTNITRDSEKLMLLPTLSVGFGNLVATAENIPPGSEEQKLPEAAEIFVRAAS  697

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +CC  + ++CCCM CIQ CSK+N QCA V TQ
Sbjct  698  SCCGAIWNRCCCMACIQCCSKVNPQCATVFTQ  729



>gb|KHN17734.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=754

 Score =   120 bits (300),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 114/158 (72%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G +SEYT M  + T+     
Sbjct  574  KDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFMSEYTRMIILETDHLKKV  633

Query  563  -ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEM  393
             E+ GT E SK +    +  +Q + +I+L +LG+GFG+LTATAENTPPG  SK PE  E+
Sbjct  634  KESAGTKEASKKSHPQYEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKFPEVPEI  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F +AA+NCC+ +C  CCCMCCIQ C++IN+QCA  +TQ
Sbjct  694  F-KAATNCCETLCSYCCCMCCIQCCTRINNQCATALTQ  730



>ref|XP_003551107.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Glycine max]
Length=754

 Score =   120 bits (300),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 114/158 (72%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G +SEYT M  + T+     
Sbjct  574  KDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFMSEYTRMIILETDHLKKV  633

Query  563  -ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEM  393
             E+ GT E SK +    +  +Q + +I+L +LG+GFG+LTATAENTPPG  SK PE  E+
Sbjct  634  KESAGTKEASKKSHPQYEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKFPEVPEI  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F +AA+NCC+ +C  CCCMCCIQ C++IN+QCA  +TQ
Sbjct  694  F-KAATNCCETLCSYCCCMCCIQCCTRINNQCATALTQ  730



>ref|XP_007154568.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26562.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=602

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 111/157 (71%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K++P+ +V A+ QI  LTA+AWF +NK+LE+K+A+ S+Q G +SEYT M  + T+     
Sbjct  423  KDMPVQRVSARDQIHHLTAQAWFLENKQLEQKVAKLSLQTGFISEYTRMVLLETDHIKKV  482

Query  563  -ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMF  390
             E+ GT    K N +   P   + +I+L +LG+GFG+LTATAENTPPG  SK PE  E+F
Sbjct  483  KESAGTKASEKSNGQFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGYESKLPEVPEIF  542

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AA+NCC+ +C  CCCMCCIQ C+++N+QCA  +TQ
Sbjct  543  -KAATNCCETLCSYCCCMCCIQCCARLNNQCATALTQ  578



>ref|XP_011078106.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Sesamum indicum]
Length=764

 Score =   119 bits (298),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + TE  K T
Sbjct  584  KDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLETERMKIT  643

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++   PEA 
Sbjct  644  ADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAPKPPEAG  702

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + +++ AS CC  +C+  CC CC+ +CS++N++CA +MTQ
Sbjct  703  DAYIKGASRCCSWLCNHRCCWCCMGVCSRMNNECANLMTQ  742



>ref|XP_006416537.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
 gb|ESQ34890.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
Length=755

 Score =   119 bits (298),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 111/158 (70%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G+ SEYT M  I  E T+  
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVPSEYTRM--IQLEHTEEA  633

Query  548  TEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             +PS     KKT       K+    I L+NLG+GFGD TAT EN PPG   +  P+AAE 
Sbjct  634  LKPSDTGGKKKTASNGEKQKMISRTIPLQNLGIGFGDRTATTENVPPGFGEQRAPDAAEK  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  694  FVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  731



>gb|KCW71312.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=596

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T   K T
Sbjct  417  KDVPIDRLLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETVREKIT  476

Query  548  TE-----PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMF  390
            ++     P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +AA + 
Sbjct  477  SDVTLEVPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSDAANVL  535

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            V+AASNCC  + D+ CCMC IQ CS +ND+CAV ++Q
Sbjct  536  VKAASNCCGKLMDRICCMCFIQTCSYVNDRCAVALSQ  572



>gb|AAF79294.1|AC068602_17 F14D16.26 [Arabidopsis thaliana]
Length=736

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G++SEYT M  +   E    
Sbjct  558  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVLSEYTRMIQLENTEELKP  617

Query  548  TEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQ  384
            +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE FV+
Sbjct  618  SETGGKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFVK  677

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  678  AASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  712



>ref|NP_173345.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
 gb|AAM97055.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15507.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29803.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
Length=754

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G++SEYT M  +   E    
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVLSEYTRMIQLENTEELKP  635

Query  548  TEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQ  384
            +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE FV+
Sbjct  636  SETGGKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFVK  695

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  696  AASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  730



>ref|XP_010261798.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=753

 Score =   117 bits (294),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 75/159 (47%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AK+ I++LTA+AW ++NK LEEK+A+ S+Q G+ SEYT+M  + T++ K T
Sbjct  573  KDIPLDKVFAKRHIDLLTAQAWLSENKTLEEKVAKMSLQTGVPSEYTHMILLQTDKVKQT  632

Query  548  TEPSKVNKKTGDPKLQK-------AIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAE  396
             EP K  ++ G+  L K        I  L +LG  FG+LTAT EN PPGS      E+AE
Sbjct  633  PEPIKTREELGEIDLAKLVDSKGCKIYSLPSLGTSFGNLTATQENIPPGSGEAYSLESAE  692

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             FV+A S CC  +   CCCMC I+ CS++N++C++++TQ
Sbjct  693  TFVKATSGCCGKLVHACCCMCGIRACSRLNNECSIILTQ  731



>ref|XP_004251694.1| PREDICTED: uncharacterized protein LOC101250962 [Solanum lycopersicum]
Length=753

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 100/155 (65%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K IPL K   KQQIEILTA+AWFT+NK LE+KIA+ S+Q  ++SEYT MA +  E+ K  
Sbjct  576  KAIPLDKARVKQQIEILTAQAWFTQNKDLEKKIAKMSIQDAVISEYTRMALVEAEKVKII  635

Query  548  TEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMFVQA  381
               +K      D K+++ +    I+L+  G GFG+LTAT EN PPG+  K + AE+  +A
Sbjct  636  KSTTKRKVHCDDEKIEERLIQKTILLQYPGFGFGNLTATIENIPPGAIDKEDEAEIIAKA  695

Query  380  ASNcc-kmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             SNC  K+    CCC CCI  CS +N QCA+ +TQ
Sbjct  696  TSNCFGKLCGLCCCCSCCITACSNMNHQCAIALTQ  730



>ref|XP_010654418.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 isoform 
X3 [Vitis vinifera]
Length=624

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KEIPL +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T++ K  
Sbjct  452  KEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVTDKGKQA  511

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMFVQAAS  375
            +E   + +K  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++  +AA+
Sbjct  512  SESVMLQEKMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDVIFKAAT  570

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC MV D+ CCMC IQ CSK+N+QCA+  TQ
Sbjct  571  NCCAMVADRICCMCFIQACSKLNNQCAIAFTQ  602



>gb|KHN12291.1| Inter-alpha-trypsin inhibitor heavy chain H1, partial [Glycine 
soja]
Length=640

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 108/158 (68%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K IP+ ++ A+ QIE LTA+AW +K++KLE+ +A+ S+Q G  SEYT+M  +  +     
Sbjct  459  KGIPVQRICARDQIEYLTAQAWLSKDEKLEQMVAKLSLQTGFTSEYTSMTILEIDLRKKA  518

Query  563  -ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  393
             E+ G     K N ++G  + ++ +I+L  LG+GFG+LTATAEN  PGS  T  P+ AE+
Sbjct  519  KESDGKKVSKKSNPQSGAKEQEQRVILLPPLGIGFGNLTATAENIQPGSEETKGPDGAEI  578

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AA+NCC   C+ CCCMCCIQ  ++IN+QCA+  TQ
Sbjct  579  FVKAATNCCGTCCNYCCCMCCIQAFTRINNQCAIAFTQ  616



>ref|XP_010242255.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=750

 Score =   116 bits (290),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 78/158 (49%), Positives = 109/158 (69%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K IPL KV AKQQI +LTA+AWF+++K LE+K+A+ S+Q GI SEYT M  + TE  K T
Sbjct  573  KGIPLDKVFAKQQIGMLTAQAWFSESKPLEDKVAKMSLQTGIPSEYTCMVLLQTERGKHT  632

Query  548  TEP---SKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTPPGSTS-KPEAAEM  393
            +EP    +V  K    KL  +    I +L + G+GFG+L ATA+N PPGS     E  ++
Sbjct  633  SEPLGTGEVWYKIDLAKLMASKDCKINLLPSFGIGFGNLAATADNIPPGSAEVSLEPVDI  692

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             V+AASNCC ++ + CCC+ CIQ CS++NDQCA++++Q
Sbjct  693  LVKAASNCCDILSNNCCCLFCIQTCSRLNDQCAIILSQ  730



>ref|XP_010064019.1| PREDICTED: uncharacterized protein LOC104450974 [Eucalyptus grandis]
 gb|KCW71311.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=751

 Score =   116 bits (290),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T   K T
Sbjct  572  KDVPIDRLLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETVREKIT  631

Query  548  TE-----PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMF  390
            ++     P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +AA + 
Sbjct  632  SDVTLEVPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSDAANVL  690

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            V+AASNCC  + D+ CCMC IQ CS +ND+CAV ++Q
Sbjct  691  VKAASNCCGKLMDRICCMCFIQTCSYVNDRCAVALSQ  727



>ref|XP_009149386.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Brassica rapa]
Length=757

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 109/158 (69%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  E T+  
Sbjct  577  KDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQLENTEEA  634

Query  548  TEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             +PS     K+TG      KL    I L+N G+GFGD TAT EN PPG   +  P+AAE 
Sbjct  635  LKPSDTGGKKQTGSNGEKQKLISRTIPLQNFGIGFGDTTATRENVPPGFGEQRAPDAAEK  694

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  695  FVKAASSCCASLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732



>ref|XP_009624355.1| PREDICTED: uncharacterized protein LOC104115430 [Nicotiana tomentosiformis]
Length=757

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL K++ KQQ++ILTA+AWFT+NK L +KIA+ S Q+ +VSEY  MA + TE  +  
Sbjct  579  KDIPLDKIMVKQQVDILTAQAWFTENKDLAQKIAKMSAQNAVVSEYARMALVSTERVRVI  638

Query  548  TEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGST-SKPEAAEMFVQ  384
               +K    +   K+++ I    I+L  LG+GFG+LTAT EN PPG+  ++ EAAE+  +
Sbjct  639  KPTTKRKVHSDAEKIEERIVEKAILLHYLGIGFGNLTATIENIPPGAIETEDEAAEIIAK  698

Query  383  AASNcckmvcdkcccmcci-qmcsKINDQCAVVMTQ  279
            A SNCC  +C  CCC  C  + CSK+N QCA+ ++Q
Sbjct  699  ATSNCCGKLCGICCCCGCCIRTCSKMNHQCAIALSQ  734



>emb|CDY26699.1| BnaA06g13230D [Brassica napus]
Length=757

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 109/158 (69%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  E T+  
Sbjct  577  KDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQLENTEEA  634

Query  548  TEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             +PS     K+TG      KL    I L+N G+GFGD TAT EN PPG   +  P+AAE 
Sbjct  635  LKPSDTGGKKQTGSNGEKQKLISRTIPLQNFGIGFGDTTATRENVPPGFGEQRAPDAAEK  694

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  695  FVKAASSCCASLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732



>ref|XP_010666845.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Beta 
vulgaris subsp. vulgaris]
Length=758

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 107/160 (67%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K  PL K+LA Q I + T++AW   +K+LEEK+A+ SV  GIVSEYT+MA   TE  K  
Sbjct  576  KAFPLGKILAMQHIIMCTSQAWLLDDKQLEEKVAKMSVHSGIVSEYTSMALFVTETLKKE  635

Query  548  TEPSKVNKKTG--------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             E +   KKT         DPK QK + + +N+G+GFG++ ATAEN  PG T    PEAA
Sbjct  636  AEVAVKQKKTSSKSGAEKPDPKPQK-LKVSKNIGIGFGNVKATAENIAPGFTEPKPPEAA  694

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V+AAS+CC  +C  CCCMCCIQ CSKIN+QCA+ +TQ
Sbjct  695  EIIVKAASDCCTRMCGYCCCMCCIQACSKINNQCAITLTQ  734



>ref|XP_004488096.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Cicer arietinum]
Length=600

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ +V A++QIE LTA+AW +K+K+LE+K+A+ S+Q G +SEYT+MA +  +  K  
Sbjct  422  KDMPIERVFAREQIEYLTAQAWLSKDKQLEQKVAKISLQTGFLSEYTHMAILENDHLKKA  481

Query  548  --TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMFVQA  381
              ++ +KV+K  G     + +I+L  LG+GFG+LTAT+EN PPG   TS  + AE+FV+ 
Sbjct  482  KQSDGTKVSKGKGGNVQGQRMILLPKLGIGFGNLTATSENIPPGVEDTSLSDGAEIFVKK  541

Query  380  ASNcc-kmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A +CC       CCCMCCIQ C+KIN+QCA+  TQ
Sbjct  542  AVDCCGSFCNHCCCCMCCIQACTKINNQCAIAFTQ  576



>ref|XP_002271630.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Vitis vinifera]
 emb|CBI35850.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   115 bits (287),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 77/152 (51%), Positives = 105/152 (69%), Gaps = 3/152 (2%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KEIPL +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T++ K  
Sbjct  575  KEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVTDKGKQA  634

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMFVQAAS  375
            +E   + +K  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++  +AA+
Sbjct  635  SESVMLQEKMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDVIFKAAT  693

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC MV D+ CCMC IQ CSK+N+QCA+  TQ
Sbjct  694  NCCAMVADRICCMCFIQACSKLNNQCAIAFTQ  725



>ref|XP_004488095.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Cicer arietinum]
Length=752

 Score =   114 bits (286),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 73/155 (47%), Positives = 108/155 (70%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ +V A++QIE LTA+AW +K+K+LE+K+A+ S+Q G +SEYT+MA +  +  K  
Sbjct  574  KDMPIERVFAREQIEYLTAQAWLSKDKQLEQKVAKISLQTGFLSEYTHMAILENDHLKKA  633

Query  548  --TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMFVQA  381
              ++ +KV+K  G     + +I+L  LG+GFG+LTAT+EN PPG   TS  + AE+FV+ 
Sbjct  634  KQSDGTKVSKGKGGNVQGQRMILLPKLGIGFGNLTATSENIPPGVEDTSLSDGAEIFVKK  693

Query  380  ASN-cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A + C       CCCMCCIQ C+KIN+QCA+  TQ
Sbjct  694  AVDCCGSFCNHCCCCMCCIQACTKINNQCAIAFTQ  728



>ref|XP_008388928.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Malus 
domestica]
Length=755

 Score =   114 bits (286),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 79/152 (52%), Positives = 104/152 (68%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K  PL K+  K QIE+LTA+AW+  NKKLE+K+A+ S+Q  +VSEYT M  +  +E  G+
Sbjct  578  KXJPLDKLCTKGQIELLTAQAWYGDNKKLEDKVAKLSLQTNVVSEYTRMVIL-HKELSGS  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAAS  375
             E SK    T   K  +  ++L  L +GFG+L ATAEN PPGS  +  PEAAE+FV+AAS
Sbjct  637  QEASK-KSCTNITKDSEKPMLLPTLSVGFGNLVATAENIPPGSEEQKLPEAAEIFVRAAS  695

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +CC  + ++CCCM CIQ CSK+N QCA V TQ
Sbjct  696  SCCGAIWNRCCCMACIQCCSKVNPQCATVFTQ  727



>ref|XP_003542365.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Glycine max]
Length=754

 Score =   114 bits (286),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 78/158 (49%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G  SEYT M    T+  K  
Sbjct  574  KDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFTSEYTRMMIHETDHLKKV  633

Query  548  TE---PSKVNKKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEM  393
             E   P + +KK+      P   + +I+L +LG+GFG+LTATAENTPPG  SK PE  E+
Sbjct  634  KESSGPKEASKKSNPLFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKLPEVPEI  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F +AA+NC + +C  CCCMCCIQ C++IN QCA  + Q
Sbjct  694  F-KAATNCFETLCSYCCCMCCIQCCTRINSQCATALAQ  730



>gb|KFK44049.1| hypothetical protein AALP_AA1G209400 [Arabis alpina]
Length=761

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 109/158 (69%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  IE+LTAEAWF+++K+L EKIA+ S+Q  + SEYT M  I  E T+  
Sbjct  582  KDMPLDKVFAKNVIELLTAEAWFSEDKQLIEKIAKLSIQTSVPSEYTRM--IQLENTEEA  639

Query  548  TEPSKV---NKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  393
             +PS     NK   + + QK I   I L +LG+GFGD TAT EN PP  G    P+AAE 
Sbjct  640  LKPSDTGGKNKPASNGEKQKLISRTIPLLSLGIGFGDKTATRENVPPGFGEPKAPDAAEK  699

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  700  FVKAASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  737



>ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
 gb|ESR39937.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
Length=742

 Score =   114 bits (284),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 107/152 (70%), Gaps = 6/152 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M    +     T
Sbjct  574  KDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPSGSK--T  631

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMFVQAAS  375
            +EP  + ++  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   +A EM V AAS
Sbjct  632  SEPVFLKERV-DSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSSDATEMLVNAAS  689

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  + D+ CC C IQ CS +N+QC++V+ Q
Sbjct  690  ICCGRLLDRICCRCFIQTCSSMNNQCSIVLAQ  721



>ref|XP_007138645.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10639.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=600

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 109/160 (68%), Gaps = 10/160 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ ++ A+ QIE LTA+AW +K+++LE+++A+ S+Q G +SEYT+MA++  +  K  
Sbjct  417  KDIPIQRICARDQIEYLTAQAWLSKDERLEQQVAKLSLQTGFISEYTSMAYLENDHRKNV  476

Query  548  TEPS-------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAE  396
             E         K ++KTG  +  + + +L +LG+GFG+L ATAEN  PGS     P+ A+
Sbjct  477  KESDGKKEVSKKSHQKTGAKEQGQQMFLLPHLGIGFGNLIATAENIQPGSQEAKGPDGAD  536

Query  395  MFVQAASNcc-kmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +F++AA+NCC  +    CCCMCCI  C++IN+ CAV +TQ
Sbjct  537  IFIKAATNCCGSLCNHCCCCMCCIHTCTRINNHCAVTITQ  576



>ref|XP_009777936.1| PREDICTED: uncharacterized protein LOC104227395 [Nicotiana sylvestris]
Length=757

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 104/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL K++ KQQ+EILTA+AWFT+NK L +KIA+ S Q+ ++SEY  M  + TE  +  
Sbjct  579  KDIPLDKIMVKQQVEILTAQAWFTENKDLAQKIAKMSAQNAVISEYARMTLVSTERVRVV  638

Query  548  TEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGST-SKPEAAEMFVQ  384
               +K    +   K+++ I    I+L  LG+GFG++TAT EN PPG+  S+ EAAE+  +
Sbjct  639  KPTTKRKVHSDAEKIEERIVETTILLLYLGIGFGNITATIENIPPGAIESEDEAAEIIAK  698

Query  383  AASNcckmvcdkcccmcci-qmcsKINDQCAVVMTQ  279
            A SNCC  +C  CCC  C  + CSK+N QCA+ ++Q
Sbjct  699  ATSNCCGKLCGICCCCGCCIRTCSKMNHQCAIALSQ  734



>ref|XP_007138646.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10640.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=761

 Score =   113 bits (283),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 70/160 (44%), Positives = 111/160 (69%), Gaps = 10/160 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI------GT  567
            K+IP+ ++ A+ QIE LTA+AW +K+++LE+++A+ S+Q G +SEYT+MA++        
Sbjct  578  KDIPIQRICARDQIEYLTAQAWLSKDERLEQQVAKLSLQTGFISEYTSMAYLENDHRKNV  637

Query  566  EETKGTTEPS-KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
            +E+ G  E S K ++KTG  +  + + +L +LG+GFG+L ATAEN  PGS     P+ A+
Sbjct  638  KESDGKKEVSKKSHQKTGAKEQGQQMFLLPHLGIGFGNLIATAENIQPGSQEAKGPDGAD  697

Query  395  MFVQAASN-cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +F++AA+N C  +    CCCMCCI  C++IN+ CAV +TQ
Sbjct  698  IFIKAATNCCGSLCNHCCCCMCCIHTCTRINNHCAVTITQ  737



>emb|CDX81914.1| BnaC08g36870D [Brassica napus]
Length=754

 Score =   113 bits (283),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 110/158 (70%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF+++ +L+EKI R S+Q G+ SEYT M  I  E T+  
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDNQLKEKITRLSIQTGVPSEYTRM--IQLENTEEA  633

Query  548  TEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  393
            ++P      KKT  + + QK +   I L+N G+GFGD TAT EN PP  G    P+AAE 
Sbjct  634  SKPINTGGKKKTETNGEKQKVVSRTIPLQNFGIGFGDTTATKENVPPGFGEARAPDAAEK  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  694  FVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  731



>emb|CDY41019.1| BnaC05g14770D [Brassica napus]
Length=757

 Score =   113 bits (283),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 108/158 (68%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  E T+  
Sbjct  577  KDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQLENTEEA  634

Query  548  TEPSKVN--KKTG----DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             +PS     K+TG      KL    I L+N G+GFGD T T EN PPG   +  P+AAE 
Sbjct  635  LKPSDTGGKKQTGRNGEKQKLISRTIPLQNFGIGFGDTTVTRENVPPGFGEQRAPDAAEK  694

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  695  FVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732



>gb|EYU25841.1| hypothetical protein MIMGU_mgv1a001817mg [Erythranthe guttata]
Length=755

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (69%), Gaps = 12/161 (7%)
 Frame = -2

Query  725  EIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETK---  555
            EIP+ K++AK QIE LTA+AWF+ N++L++KIA+ SV +GI+SE+T+M  + TE  K   
Sbjct  576  EIPIAKIVAKHQIEQLTAQAWFSDNQELQDKIAKMSVLNGIISEHTSMVLLETERGKTKV  635

Query  554  GTTEPSKVNKKTGDPKLQKA-------IIMLRNLGLGFGDLTATAENTPPGS-TSKP-EA  402
             +T   +V+ K+   +  KA       I +L N+GLGFG+  AT +N PPG   +KP +A
Sbjct  636  DSTTKQQVSSKSKADQHNKAEDSKPKRISVLHNVGLGFGNPIATGDNIPPGCKDTKPADA  695

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AE+FV+AAS CC  + + CCCM CIQ CSK+NDQCA+  TQ
Sbjct  696  AEVFVKAASVCCGRLLNHCCCMYCIQCCSKMNDQCAIAFTQ  736



>gb|KHG04434.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=735

 Score =   112 bits (281),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 71/157 (45%), Positives = 104/157 (66%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL  VLA++QI++LTA+AWF++NK+ EE++A+ S+Q   +SEYT M  +   +   T
Sbjct  555  KDIPLDSVLARRQIDLLTAQAWFSENKRFEEEVAKLSIQTCNISEYTRMTLLEKNKMLKT  614

Query  548  TEPSKVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  390
             +     KK GDP +        +I+L+ L +GFGDL ATAEN  PGS     PE A++F
Sbjct  615  LKHFGAWKKKGDPHIVVESELPEMILLQRLSVGFGDLIATAENIRPGSQEPELPEVAKIF  674

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            ++  SN    +C++CCCM CI+ CSK+N+QCA  +TQ
Sbjct  675  IKTTSNYFGGICNRCCCMGCIRCCSKMNNQCATTLTQ  711



>emb|CDX83787.1| BnaC08g18580D [Brassica napus]
Length=756

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 110/161 (68%), Gaps = 16/161 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF ++K+L+EK+ + S+Q G+ SEYT M      + + T
Sbjct  576  KDMPLDKVFAKNLIDLLTAEAWFLEDKQLKEKVTKLSIQTGVPSEYTRMI-----QLENT  630

Query  548  TEPSKVNKKTGDPKL------QKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEA  402
             E SK +   G+ K+      QK I   I L+N  +GFGD+TAT EN PPG   +  P+A
Sbjct  631  EEASKQSDTGGNKKIASNGEKQKMISRTIPLQNFSIGFGDITATRENVPPGYGEQRAPDA  690

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  691  AEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  731



>gb|KHN07890.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=669

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G  SEYT M    T+  K  
Sbjct  489  KDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFTSEYTRMMIHETDHLKKV  548

Query  548  TE---PSKVNKKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEM  393
             E   P + +KK+      P   + +I+L +LG+GFG+LTATAENTPPG  SK PE  E+
Sbjct  549  KESSGPKEASKKSNPLFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKLPEVPEI  608

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F +AA+NC + +C  CCCMCCIQ C++IN+QCA  + Q
Sbjct  609  F-KAATNCFETLCSYCCCMCCIQCCTRINNQCATALAQ  645



>ref|XP_010459567.1| PREDICTED: uncharacterized protein LOC104740606 [Camelina sativa]
Length=754

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 112/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTEETKG  552
            K++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q  + SEYT M  +  TEE K 
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTSVPSEYTRMIQLEHTEELKP  635

Query  551  TTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFV  387
            +    K  K + + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE FV
Sbjct  636  SDTAGK-KKTSSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFV  694

Query  386  QAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  695  KAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  730



>ref|XP_004508009.1| PREDICTED: uncharacterized protein LOC101514299 [Cicer arietinum]
Length=751

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +     
Sbjct  573  KGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILENDHLKKV  632

Query  563  -ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
             E+ G  E SK      D  ++ + +I+L +LG+GFG+LTATAENTPPG  + PE AE+F
Sbjct  633  KESPGAKEVSKKKHSKYDVNVKGQRMILLPHLGIGFGNLTATAENTPPGYETVPEMAEIF  692

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  +C  CCCMCCIQ   KIN+QC   + Q
Sbjct  693  -KAASNCCSTMCGYCCCMCCIQCFDKINNQCLTALNQ  728



>ref|XP_002890318.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66577.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAE W +++K+L+EKIA+ S+Q G+ SEYT M  +   E    
Sbjct  577  KDMPLDKVFAKNVIDLLTAEVWLSEDKQLKEKIAKLSIQTGVPSEYTRMIQLENTEELKP  636

Query  548  TEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQ  384
            +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE FV+
Sbjct  637  SETGVKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFVK  696

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AAS+CC  +C+KCCCMCC+Q CSK+NDQC +V TQ
Sbjct  697  AASSCCVSLCNKCCCMCCVQCCSKLNDQCVLVFTQ  731



>ref|XP_008356516.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Malus domestica]
Length=308

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +VLA++ I++LTA AW + +K+LEEK+++ S Q G+ SEYT M  + T E K  
Sbjct  130  KDFPLDRVLARRHIDMLTAHAWLSGSKELEEKVSKLSKQTGVPSEYTCMILLQTNEAKKA  189

Query  548  TEPSKV----NKKTGDPKLQKA---IIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
             E   +    NK T   K Q +   +I L NLG+GFG+LTATA+N   GS  +   +A E
Sbjct  190  PESVMIQEVYNKITKWKKTQSSSQKMITLGNLGIGFGNLTATAQNKALGSEEEKAADATE  249

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + V+AASNCC    D+ CCMC I  CS +N+QCA+V+TQ
Sbjct  250  LLVKAASNCCSRALDRVCCMCFITTCSHMNNQCAIVLTQ  288



>ref|XP_010498320.1| PREDICTED: uncharacterized protein LOC104776024 [Camelina sativa]
Length=754

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 112/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTEETKG  552
            K++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q  + SEYT M  +  TEE K 
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTSVPSEYTIMIQLEHTEELKP  635

Query  551  TTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFV  387
            +    K  K + + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE FV
Sbjct  636  SDTAGK-KKTSNNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFV  694

Query  386  QAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  695  KAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  730



>ref|XP_009359719.1| PREDICTED: uncharacterized protein LOC103950254 [Pyrus x bretschneideri]
Length=755

 Score =   112 bits (279),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK QIE+LTA AW+  NK+LE+K+A+ S+Q  +VSEYT M  +  ++  G 
Sbjct  578  KDIPLDRVCAKGQIELLTARAWYGDNKELEDKVAKLSMQTNVVSEYTRMVIL-HKDLSGP  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAAS  375
             E SK N  T + K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+FV+AAS
Sbjct  637  QETSKKN-HTNETKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEIFVRAAS  695

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +CC  +  +CCCM CI  CSK+N QCA  +TQ
Sbjct  696  SCCGSIWYRCCCMACIHCCSKVNPQCANGLTQ  727



>gb|KJB35005.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=597

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 105/160 (66%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T+  K  
Sbjct  418  KDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQTDSEKKV  477

Query  548  TEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+     PE A
Sbjct  478  PEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEPKSPEGA  536

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V AA+NC  +V D+CCCMCCIQ  S +N+QC +V+TQ
Sbjct  537  EILVNAATNCFSLVLDRCCCMCCIQTLSYMNNQCYIVLTQ  576



>ref|XP_008337842.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like isoform X2 [Malus domestica]
Length=593

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK QIE+LTA AW+  NK+L++K+A  S+Q  +VSEYT M  +  +E  G 
Sbjct  420  KDIPLDRVCAKGQIELLTAWAWYGDNKELQDKVAELSMQTNVVSEYTCMVIL-HKELSGP  478

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAAS  375
             E SK   +T   K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+FV+AAS
Sbjct  479  QETSK-KSRTNKTKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEIFVRAAS  537

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +CC  + ++CCCM CIQ C K+N QCA V TQ
Sbjct  538  SCCGSMWNRCCCMACIQCCFKVNPQCANVFTQ  569



>ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Citrus sinensis]
Length=751

 Score =   111 bits (277),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--GTEETK  555
            K+IPL ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M     G++ ++
Sbjct  574  KDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPSGSKTSE  633

Query  554  GTTEPSKVNK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  393
                   +NK    K  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   +A EM
Sbjct  634  PVFLKELLNKVDLLKRVDSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSSDATEM  692

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             V AAS CC  + D+ CC C IQ CS +N+QC++V+ Q
Sbjct  693  LVNAASICCGRLLDRICCRCFIQTCSSMNNQCSIVLAQ  730



>gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=751

 Score =   111 bits (277),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 108/158 (68%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--GTEETK  555
            K+IPL ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M     G++ ++
Sbjct  574  KDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPSGSKTSE  633

Query  554  GTTEPSKVNK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  393
                   +NK    K  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   +A EM
Sbjct  634  PVFLKELLNKVDLLKRVDSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSSDATEM  692

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             V AAS CC  + D+ CC C IQ CS +N+QC++V+ Q
Sbjct  693  LVNAASICCGRLLDRICCRCFIQTCSSMNNQCSIVLAQ  730



>ref|XP_009117566.1| PREDICTED: uncharacterized protein LOC103842665 [Brassica rapa]
Length=754

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 109/158 (69%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF+++ + +EKI R S+Q G+ SEYT M  I  E T+  
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDNQPKEKITRLSIQTGVPSEYTRM--IQLENTEEA  633

Query  548  TEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  393
            ++P      KKT  + + QK I   I L+N G+GFGD TAT EN PP  G    P+AAE 
Sbjct  634  SKPINTGGKKKTETNGEKQKVISRTIPLQNFGIGFGDTTATKENVPPGFGEARAPDAAEK  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  694  FVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  731



>emb|CDY21682.1| BnaA09g44330D [Brassica napus]
Length=754

 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 109/158 (69%), Gaps = 10/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL KV AK  I++LTAEAWF+++ + +EKI R S+Q G+ SEYT M  I  E T+  
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDNQPKEKITRLSIQTGVPSEYTRM--IQLENTEEA  633

Query  548  TEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  393
            ++P      KKT  + + QK I   I L+N G+GFGD TAT EN PP  G    P+AAE 
Sbjct  634  SKPINTGGKKKTETNGEKQKVISRTIPLQNFGIGFGDTTATKENVPPGFGEARAPDAAEK  693

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  694  FVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCVIVFTQ  731



>ref|XP_008337841.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Malus domestica]
Length=751

 Score =   110 bits (276),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK QIE+LTA AW+  NK+L++K+A  S+Q  +VSEYT M  +  +E  G 
Sbjct  578  KDIPLDRVCAKGQIELLTAWAWYGDNKELQDKVAELSMQTNVVSEYTCMVIL-HKELSGP  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAAS  375
             E SK   +T   K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+FV+AAS
Sbjct  637  QETSK-KSRTNKTKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEIFVRAAS  695

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +CC  + ++CCCM CIQ C K+N QCA V TQ
Sbjct  696  SCCGSMWNRCCCMACIQCCFKVNPQCANVFTQ  727



>ref|XP_010477113.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
[Camelina sativa]
Length=755

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 7/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTEETKG  552
            K++PL KV AK  I++LTAEAWF+++K+L+EKIA+ S++  + SEYT M  +  TEE K 
Sbjct  577  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIETSVPSEYTRMIQLEHTEELKP  636

Query  551  TTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFV  387
            +    K  K   + + QK I   I L++LG+GFGD TAT EN PPG   +  P+AAE FV
Sbjct  637  SDTAGK-KKTASNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQRAPDAAEKFV  695

Query  386  QAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  696  KAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  731



>gb|KJB82977.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=552

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 15/159 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL  VLA++QI++LTA+AWF++NK+LEEK+A+ S+Q   +SEYT M  +     K  
Sbjct  376  KDIPLDSVLARRQIDLLTAQAWFSENKRLEEKVAKLSIQSCNISEYTRMTLL----EKNI  431

Query  548  TEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
             +     KK GDP  QK +       I+L+ L +GFGD  ATAEN  PGS     PE A+
Sbjct  432  MKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDPIATAENIRPGSQEPELPEVAK  489

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +F++  SN    +C++CCCM CI+ CSK+N+QCA  +TQ
Sbjct  490  IFIKTTSNYFGGICNRCCCMGCIRCCSKMNNQCATTLTQ  528



>gb|KCW71310.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=694

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = -2

Query  710  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE----  543
            ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T   K T++    
Sbjct  521  ELLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETVREKITSDVTLE  580

Query  542  -PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMFVQAASN  372
             P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +AA + V+AASN
Sbjct  581  VPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSDAANVLVKAASN  639

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D+ CCMC IQ CS +ND+CAV ++Q
Sbjct  640  CCGKLMDRICCMCFIQTCSYVNDRCAVALSQ  670



>gb|KJB07329.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=467

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   +    
Sbjct  287  KDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKNKIDKA  346

Query  548  TEPSKVNK-KTGDPK-----LQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             E S   K K  DP      L     +L++L +GFGDLTATAEN  PG   +  P+AAE+
Sbjct  347  IESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKLPDAAEV  406

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  407  FLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  444



>ref|XP_010654417.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Vitis vinifera]
Length=746

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KEIPL +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T++ K  
Sbjct  575  KEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVTDKGKQA  634

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEMFVQAAS  375
            +E S + ++  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++  +AA+
Sbjct  635  SE-SVMLQEMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDVIFKAAT  692

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC MV D+ CCMC IQ CSK+N+QCA+  TQ
Sbjct  693  NCCAMVADRICCMCFIQACSKLNNQCAIAFTQ  724



>ref|XP_009110301.1| PREDICTED: uncharacterized protein LOC103835866 [Brassica rapa]
Length=757

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 107/156 (69%), Gaps = 6/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTEETKG  552
            K++PL KV AK  I++LTAEAWF+++K+L EK+ + S+Q G+ SEYT M  +  TEE   
Sbjct  577  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLIEKVTKLSIQTGVPSEYTRMIQLENTEEASK  636

Query  551  TTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFV  387
             ++     K   + + QK I   I L+   +GFGD+TAT EN PPG   +  P+AAE FV
Sbjct  637  QSDTGGKKKTASNGEKQKLISRTIPLQKFSIGFGDITATRENVPPGYGEQRAPDAAEKFV  696

Query  386  QAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  697  KAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  732



>gb|KJB82978.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=749

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 15/159 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL  VLA++QI++LTA+AWF++NK+LEEK+A+ S+Q   +SEYT M  +     K  
Sbjct  573  KDIPLDSVLARRQIDLLTAQAWFSENKRLEEKVAKLSIQSCNISEYTRMTLL----EKNI  628

Query  548  TEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
             +     KK GDP  QK +       I+L+ L +GFGD  ATAEN  PGS     PE A+
Sbjct  629  MKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDPIATAENIRPGSQEPELPEVAK  686

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +F++  SN    +C++CCCM CI+ CSK+N+QCA  +TQ
Sbjct  687  IFIKTTSNYFGGICNRCCCMGCIRCCSKMNNQCATTLTQ  725



>ref|XP_011072601.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157816 
[Sesamum indicum]
Length=745

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 5/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K IP+ +VLA++QI  LTA AWF+ +K+LEEK  + S+  G+ SEYT M  I T++TK +
Sbjct  574  KNIPIDRVLARRQINALTAHAWFSGSKQLEEKATKLSLLTGVPSEYTIMILIETDKTKLS  633

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++     +KT D K QK I+ LR LG+GFG + ATAEN PP   ++P   E +E   +AA
Sbjct  634  SKSKTAEEKTPDLKGQK-IVFLRGLGIGFGSVQATAENRPP-EHAEPKLYETSEKIFKAA  691

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            S+ C  V D CCCMC IQ C+++NDQCAV +TQ
Sbjct  692  SDFCGRVVDCCCCMCFIQFCNRLNDQCAVALTQ  724



>gb|KHG29331.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=756

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 111/158 (70%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VLA+Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   +    
Sbjct  576  KDIPLDRVLARQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKNKIDKA  635

Query  548  TEPSKVNK-KTGDP-KLQKAI----IMLRNLGLGFGDLTATAENTPPG--STSKPEAAEM  393
             E S   K K  DP K++  +     +L++L +GFGDLTATAEN  PG      P+AAE+
Sbjct  636  IESSGAQKVKKTDPHKIEDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEEPKLPDAAEI  695

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F++A SNCC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  696  FLKATSNCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  733



>ref|XP_006385524.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63321.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=416

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 107/161 (66%), Gaps = 15/161 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T + +  
Sbjct  239  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLQDEKA  298

Query  548  TEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEA  402
             E        +K+N  KK     LQK  IML NL +GFG+LTATAEN PPG+  T   EA
Sbjct  299  PETILIQDVFNKINPLKKM---DLQKT-IMLGNLCVGFGNLTATAENIPPGTEETKSSEA  354

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  355  TEMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  395



>ref|XP_006385523.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63320.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=446

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 104/158 (66%), Gaps = 9/158 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT---EET  558
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T   E+ 
Sbjct  269  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLQDEKA  328

Query  557  KGTTEPSKVNKKTGDPK---LQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  393
              T     V  K    K   LQK  IML NL +GFG+LTATAEN PPG+  T   EA EM
Sbjct  329  PETILIQDVFNKINPLKKMDLQKT-IMLGNLCVGFGNLTATAENIPPGTEETKSSEATEM  387

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  388  LFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  425



>ref|XP_010537668.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Tarenaya hassleriana]
Length=752

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 107/155 (69%), Gaps = 7/155 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L KVLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +  E  +G 
Sbjct  576  KDMLLDKVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILL--ENIEGP  633

Query  548  TEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQ  384
                    K  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+AAEMFV+
Sbjct  634  KPKETARMKKVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDAAEMFVK  693

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AAS+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  694  AASSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  728



>ref|XP_009625888.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like isoform X4 [Nicotiana tomentosiformis]
Length=628

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 105/153 (69%), Gaps = 5/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  ++ + T
Sbjct  456  KDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENKKERQT  515

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM   AA
Sbjct  516  SKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEMVFAAA  573

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  574  SNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  606



>emb|CDO97834.1| unnamed protein product [Coffea canephora]
Length=736

 Score =   109 bits (272),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 72/153 (47%), Positives = 101/153 (66%), Gaps = 15/153 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ P+ ++ A+ QI+ LTA AW +++K+LEEK+ R S+Q G+ SEYTN+  + T++ K  
Sbjct  571  KDFPMERMCARSQIDALTANAWLSEDKQLEEKVERMSLQTGVPSEYTNLVLLETKKEKQI  630

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            +E S            K +I+LR +G GFG L ATAEN PP  T++P   E +EM  +AA
Sbjct  631  SESSG-----------KKVIVLRRVGAGFGSLKATAENLPP-ETAEPKLHETSEMITKAA  678

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             N C  + D CCCMC IQ CS++NDQCAVV+TQ
Sbjct  679  RNLCGRMLDCCCCMCFIQFCSRLNDQCAVVLTQ  711



>ref|XP_010273853.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Nelumbo nucifera]
Length=753

 Score =   108 bits (271),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 77/159 (48%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE  K  
Sbjct  578  KDIPLDKVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTEIGKKV  637

Query  548  TE---PSKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSKPEAAE  396
            TE     ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S  E  E
Sbjct  638  TESFGSEEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI-EPVE  696

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +FV+AASNCC  + + CCC+CCI+ CSK+N++CA V+ Q
Sbjct  697  IFVKAASNCCGKLANDCCCLCCIRACSKVNNECATVLLQ  735



>ref|XP_009625883.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625884.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625885.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625886.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
Length=632

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 105/153 (69%), Gaps = 5/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  ++ + T
Sbjct  460  KDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENKKERQT  519

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM   AA
Sbjct  520  SKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEMVFAAA  577

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  578  SNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  610



>ref|XP_008342579.1| PREDICTED: uncharacterized protein LOC103405374 [Malus domestica]
Length=745

 Score =   108 bits (271),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEYT +  + T E K  
Sbjct  567  KDIPLDQVLARRHIDMLTAHAWLLGSKELEEKVSKLSKQTGVPSEYTCLILLLTNEGKKA  626

Query  548  TEP-------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKP-EAAE  396
             E        +K+ ++       + +I+L NLG GFG+LTAT +N  PGS   KP +A E
Sbjct  627  PESVMIQEVYNKITQRKKPESNNQKVIILGNLGFGFGNLTATVQNKAPGSEEEKPADATE  686

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            M V AASNCC  V D+ CCMC I+ CS +N+QCA+V+TQ
Sbjct  687  MLVNAASNCCSRVLDRVCCMCFIRTCSHMNNQCAIVLTQ  725



>ref|XP_009625881.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X1 [Nicotiana tomentosiformis]
Length=745

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 70/153 (46%), Positives = 105/153 (69%), Gaps = 5/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  ++ + T
Sbjct  573  KDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENKKERQT  632

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM   AA
Sbjct  633  SKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEMVFAAA  690

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  691  SNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  723



>gb|KDP40680.1| hypothetical protein JCGZ_24679 [Jatropha curcas]
Length=750

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 73/160 (46%), Positives = 110/160 (69%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L +VLA++QI+ILTA AW ++++ LE++IA+ S+Q G+ SEYT+M    T+  +  
Sbjct  571  KDVQLDRVLARRQIDILTANAWMSESQDLEQQIAKMSIQTGVPSEYTHMILHQTDTGEKA  630

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAA  399
            TE        +K+N  +  + ++QK +I L NLG+GFGDL ATA N PPG+     PEA 
Sbjct  631  TEKILMQEVFNKINSLRQVNSEIQK-VIFLGNLGVGFGDLAATASNIPPGTDEIKSPEAT  689

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V AASNCC  + D+ CCMC IQ CS++N+QC++ ++Q
Sbjct  690  EVLVDAASNCCSKLLDRFCCMCFIQTCSRMNNQCSIALSQ  729



>ref|XP_004235553.1| PREDICTED: uncharacterized protein LOC101253877 isoform X1 [Solanum 
lycopersicum]
Length=744

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 103/153 (67%), Gaps = 4/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   + K T
Sbjct  571  KDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENLKEKQT  630

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++   V++K  D    K II LR LG+GFG+L ATA+N P    ++P   E +EM   AA
Sbjct  631  SKLETVDEKASDQLNVKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEMVFAAA  689

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS+++DQCAV + Q
Sbjct  690  SNLCGKLCDFCCCMCFIQFCSRVSDQCAVTLAQ  722



>gb|KJB07325.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07328.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=585

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   +    
Sbjct  405  KDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKNKIDKA  464

Query  548  TEPSKVNK-KTGDPK-----LQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             E S   K K  DP      L     +L++L +GFGDLTATAEN  PG   +  P+AAE+
Sbjct  465  IESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKLPDAAEV  524

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  525  FLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  562



>ref|XP_006342928.1| PREDICTED: uncharacterized protein LOC102599336 [Solanum tuberosum]
Length=744

 Score =   108 bits (270),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 72/153 (47%), Positives = 103/153 (67%), Gaps = 4/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QIE +TA AWF++N +LEE +A+ S+Q G+ SEYTN+  +   + K T
Sbjct  571  KDFPLERVFARRQIETITANAWFSENNQLEEMVAKLSLQTGVPSEYTNLVLVENLKEKQT  630

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++   V++K  D    K II LR LG+GFG+L ATA+N P    ++P   E +EM   AA
Sbjct  631  SKLETVDEKASDQLNVKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEMVFSAA  689

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS+++D+CAV + Q
Sbjct  690  SNLCGKLCDFCCCMCFIQFCSRVSDRCAVTLAQ  722



>ref|XP_010537666.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Tarenaya hassleriana]
Length=756

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L KVLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +   E    
Sbjct  576  KDMLLDKVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILLENIEGPKP  635

Query  548  TEPSKVNK--KTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  390
             E +++ K  +  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+AAEMF
Sbjct  636  KETARMKKGIQQVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDAAEMF  695

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            V+AAS+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  696  VKAASSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  732



>ref|XP_007024661.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
 gb|EOY27283.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
Length=752

 Score =   107 bits (268),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 71/160 (44%), Positives = 106/160 (66%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  ++L ++QI+I+T  AWF+++++LEEK+A+ S+Q    SEYT +  + T+  K  
Sbjct  573  KDVPFDRMLTRRQIDIVTCHAWFSESQELEEKVAKISLQTSFPSEYTCLILLQTDSEKKV  632

Query  548  TEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAA  399
             E  +V +        K GD   QK ++ L  +G+GFG+LTATA+N PPG      PE A
Sbjct  633  QESIRVQEIFKKINMPKKGDMNGQK-LVFLGCMGVGFGNLTATAKNIPPGIEEPKSPEGA  691

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V+AASNCC  + D+CCCMC IQ CS +N+QC++V TQ
Sbjct  692  EILVRAASNCCSTLLDRCCCMCFIQACSYMNNQCSIVFTQ  731



>emb|CDX96680.1| BnaA08g22230D [Brassica napus]
Length=768

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 106/156 (68%), Gaps = 6/156 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-GTEETKG  552
            K++PL KV AK  I++LTAEAW +++K+L EK+ + S+Q G+ SEYT M  +  TEE   
Sbjct  588  KDMPLDKVFAKNVIDLLTAEAWLSEDKQLIEKVTKLSIQTGVPSEYTRMIQLENTEEASK  647

Query  551  TTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFV  387
             ++     K   + + QK I   I L+   +GFGD+TAT EN PPG   +  P+AAE FV
Sbjct  648  QSDTGGKKKTASNSEKQKLISRTIPLQKFSIGFGDITATRENVPPGYGEQRAPDAAEKFV  707

Query  386  QAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +AAS+CC  +C+KCCCMCC+Q C+K+NDQC +V TQ
Sbjct  708  KAASSCCVSLCNKCCCMCCVQCCTKLNDQCVLVFTQ  743



>ref|XP_010273855.1| PREDICTED: uncharacterized protein LOC104609280 isoform X3 [Nelumbo 
nucifera]
Length=663

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE  K  
Sbjct  488  KDIPLDKVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTEIGKKV  547

Query  548  TE---PSKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSKPEAAE  396
            TE     ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S  E  E
Sbjct  548  TESFGSEEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI-EPVE  606

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +FV+AASNCC  + + CCC+CCI+ CSK+N++CA V+ Q
Sbjct  607  IFVKAASNCCGKLANDCCCLCCIRACSKVNNECATVLLQ  645



>gb|KJB07327.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=756

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 109/158 (69%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   +    
Sbjct  576  KDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKNKIDKA  635

Query  548  TEPSKVNK-KTGDPK-----LQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             E S   K K  DP      L     +L++L +GFGDLTATAEN  PG   +  P+AAE+
Sbjct  636  IESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKLPDAAEV  695

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V+TQ
Sbjct  696  FLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIVLTQ  733



>ref|XP_006369125.1| hypothetical protein POPTR_0001s16700g [Populus trichocarpa]
 gb|ERP65694.1| hypothetical protein POPTR_0001s16700g [Populus trichocarpa]
Length=578

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T   +  
Sbjct  401  KDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQSGVPSEYTLMVLHHTLREEKA  460

Query  548  TEPSKV----NKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEMF  390
            +E   +    NK     K+  +  IML NL +GFG+L+ATAEN PPG+  T   +A EM 
Sbjct  461  SETILIQNVFNKINPLKKMDLQTKIMLGNLCVGFGNLSATAENIPPGTEETKSSDATEML  520

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              AASNCC  V ++CCCMC IQ CS +N+QCA+V++Q
Sbjct  521  FNAASNCCSRVVERCCCMCFIQTCSYMNNQCAIVLSQ  557



>gb|KJB35006.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=763

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 72/160 (45%), Positives = 105/160 (66%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T+  K  
Sbjct  584  KDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQTDSEKKV  643

Query  548  TEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+     PE A
Sbjct  644  PEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEPKSPEGA  702

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V AA+NC  +V D+CCCMCCIQ  S +N+QC +V+TQ
Sbjct  703  EILVNAATNCFSLVLDRCCCMCCIQTLSYMNNQCYIVLTQ  742



>gb|KJB35007.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=745

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 72/160 (45%), Positives = 105/160 (66%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T+  K  
Sbjct  566  KDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQTDSEKKV  625

Query  548  TEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAA  399
             EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+     PE A
Sbjct  626  PEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEPKSPEGA  684

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V AA+NC  +V D+CCCMCCIQ  S +N+QC +V+TQ
Sbjct  685  EILVNAATNCFSLVLDRCCCMCCIQTLSYMNNQCYIVLTQ  724



>ref|XP_007012610.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
 gb|EOY30229.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
Length=758

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 11/160 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L +VLA+QQI++LTA+AW ++NK+LEEK+A+ S+Q   +SEYT M  +   +    
Sbjct  575  KDILLDRVLARQQIDLLTAQAWLSENKQLEEKVAKLSIQTCNISEYTRMVLLEKNKIYQA  634

Query  548  TEPS---KVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAA  399
            +E S   KV  K GDP           ++L++L +GFGDL ATAEN  PGS     PE A
Sbjct  635  SESSGSLKVPYK-GDPHEIGDSGAPKKMLLQSLTVGFGDLIATAENIRPGSQEPKLPEVA  693

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E+ V+A SNCC  +C++CCCM CIQ CSK+N+QCA V+TQ
Sbjct  694  EILVKATSNCCGQICNQCCCMLCIQCCSKMNNQCATVLTQ  733



>gb|AES92187.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=752

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +     
Sbjct  573  KGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILENDHLKKI  632

Query  563  -ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
             E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K E AE+F
Sbjct  633  KESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKIEMAEIF  692

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNC   VC  CCCMCCIQ  S++N+QC   + Q
Sbjct  693  -KAASNCFDTVCGYCCCMCCIQCFSRMNNQCLTALNQ  728



>ref|XP_003608035.1| von Willebrand factor A domain-containing protein 5B1 [Medicago 
truncatula]
Length=639

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +     
Sbjct  460  KGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILENDHLKKI  519

Query  563  -ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
             E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K E AE+F
Sbjct  520  KESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKIEMAEIF  579

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNC   VC  CCCMCCIQ  S++N+QC   + Q
Sbjct  580  -KAASNCFDTVCGYCCCMCCIQCFSRMNNQCLTALNQ  615



>ref|XP_008373868.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Malus domestica]
Length=745

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +VLA++ I++LTA AW + +K+LEEK+++ S Q G+ SEYT M  + T E K  
Sbjct  567  KDFPLDRVLARRHIDMLTAHAWLSGSKELEEKVSKLSKQTGVPSEYTCMILLQTNEAKKA  626

Query  548  TEPSKV----NKKTGDPKLQKA---IIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
             E   +    NK T   K Q +   +I L NLG+GFG+LTATA+N   GS  +   +A E
Sbjct  627  PESVMIQEVYNKITKWKKTQSSSQKMITLGNLGIGFGNLTATAQNKALGSEEEKAADATE  686

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + V+AASNCC    D+ CCMC I  CS +N+QCA+V+TQ
Sbjct  687  LLVKAASNCCSRALDRVCCMCFITTCSHMNNQCAIVLTQ  725



>ref|XP_009344471.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
 ref|XP_009344474.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
Length=745

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VLA++ I++LTA AW   +++LE+K+++ S Q G+ SEYT M  + T E K  
Sbjct  567  KDIPLDQVLARRHIDMLTAHAWLLGSRELEDKVSKLSKQTGVPSEYTCMILLLTNEEKKA  626

Query  548  TEPSKV----NKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGS-TSKP-EAAE  396
             E   +    NK T   K +   + +I+L NLG GFG+LTAT +N  PGS   KP +A E
Sbjct  627  PESVMIQEVYNKITQWKKPESNSQKVIILGNLGFGFGNLTATVQNKAPGSEEEKPADATE  686

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            M V AASNCC  V D+ CCMC I+ CS +N+QCA+V+TQ
Sbjct  687  MLVNAASNCCSRVLDRVCCMCFIRTCSHMNNQCAIVLTQ  725



>gb|KEH32426.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=602

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE-----  564
            K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +     
Sbjct  423  KGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILENDHLKKI  482

Query  563  -ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
             E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K E AE+F
Sbjct  483  KESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKIEMAEIF  542

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNC   VC  CCCMCCIQ  S++N+QC   + Q
Sbjct  543  -KAASNCFDTVCGYCCCMCCIQCFSRMNNQCLTALNQ  578



>ref|XP_004287649.1| PREDICTED: uncharacterized protein LOC101300180 [Fragaria vesca 
subsp. vesca]
Length=752

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 70/152 (46%), Positives = 101/152 (66%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +V AK++IE+LTA+AW ++NK+LE+K+A+ SV  G VSEYT M     EE    
Sbjct  577  KDIPLHRVCAKEEIELLTAQAWLSENKQLEDKVAKMSVHTGAVSEYTRMVICQKEEVVQK  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAAS  375
                   KK     L+  +I+  +L +GFG++TAT++N  PG+     PEAAE+F++A S
Sbjct  637  ASKKSQGKKKDIETLK--MILPHSLCVGFGNVTATSDNLFPGTEEPKLPEAAEIFIKATS  694

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            NCC  +C+ CCC+  I+ CS +N QCA V+TQ
Sbjct  695  NCCGSMCNNCCCLAFIKCCSHVNPQCANVLTQ  726



>gb|KJB65321.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=565

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 9/157 (6%)
 Frame = -2

Query  722  IPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---GTEETKG  552
            I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +     E    
Sbjct  387  ISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKGKIERDTD  446

Query  551  TTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  390
            TTE  KV KK    KL  +     I+L+ L +GFGDL ATAEN  PGS  +  PE AEM 
Sbjct  447  TTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEILPEVAEML  506

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  507  NKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  543



>ref|XP_010537667.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Tarenaya hassleriana]
Length=756

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 104/151 (69%), Gaps = 7/151 (5%)
 Frame = -2

Query  716  LXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTEPS  537
            L +VLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +  E  +G     
Sbjct  584  LKQVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILL--ENIEGPKPKE  641

Query  536  KVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASN  372
                K  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+AAEMFV+AAS+
Sbjct  642  TARMKKVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDAAEMFVKAASS  701

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  702  CCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  732



>ref|XP_011036460.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Populus euphratica]
Length=650

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 15/161 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T   +  
Sbjct  473  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLTDEKA  532

Query  548  TEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEA  402
             E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  T   EA
Sbjct  533  PETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEETKSSEA  588

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              M V+AASNCC  V D+CCCMC IQ CS +N+QC++V++Q
Sbjct  589  TGMLVKAASNCCGRVVDRCCCMCFIQTCSYMNNQCSIVLSQ  629



>ref|XP_009764208.1| PREDICTED: uncharacterized protein LOC104215964 isoform X1 [Nicotiana 
sylvestris]
Length=745

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 71/153 (46%), Positives = 103/153 (67%), Gaps = 5/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QI+ILTA AW + +K+LEEK+ + S+Q G+ SEYTN+  +  ++ + T
Sbjct  573  KDFPLERVFARRQIKILTANAWCSGSKQLEEKVVKMSLQTGVPSEYTNLILVENKKERQT  632

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++    ++KT D  ++K II LR LG GFG+L AT  N P    ++P   E +EM   AA
Sbjct  633  SKLEVADEKTSDLNVKK-IIYLRALGFGFGNLKATMNNLPV-EAAEPKLHETSEMVFAAA  690

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            S+ C  +CD CCCMC IQ CS++NDQCAV + Q
Sbjct  691  SSLCGKLCDCCCCMCFIQFCSRVNDQCAVTLAQ  723



>ref|XP_010537665.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Tarenaya hassleriana]
Length=760

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = -2

Query  716  LXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTEPS  537
            L +VLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +   E     E +
Sbjct  584  LKQVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILLENIEGPKPKETA  643

Query  536  KVNK--KTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAA  378
            ++ K  +  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+AAEMFV+AA
Sbjct  644  RMKKGIQQVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDAAEMFVKAA  703

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            S+CC  +C+KCCC+CCIQ CSK+NDQC +V+TQ
Sbjct  704  SSCCSSMCNKCCCVCCIQCCSKLNDQCVIVLTQ  736



>ref|XP_011035744.1| PREDICTED: uncharacterized protein LOC105133437 isoform X2 [Populus 
euphratica]
Length=717

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T   +  
Sbjct  541  KDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQTGVPSEYTLMVLHHTLREEKA  600

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPEAAE  396
            +E        +K+N  K  D +++   IML N  +GFG+L+ATAEN PPG+ T   +A E
Sbjct  601  SETILIRDVFNKINPLKKMDLQMK---IMLGNQCVGFGNLSATAENIPPGTETRSSDATE  657

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            M   AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  658  MLFNAASNCCSRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  696



>gb|KJB65318.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=754

 Score =   104 bits (260),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 9/157 (6%)
 Frame = -2

Query  722  IPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---GTEETKG  552
            I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +     E    
Sbjct  576  ISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKGKIERDTD  635

Query  551  TTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  390
            TTE  KV KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  +  PE AEM 
Sbjct  636  TTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEILPEVAEML  695

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  696  NKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  732



>ref|XP_009625882.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X2 [Nicotiana tomentosiformis]
Length=744

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 70/153 (46%), Positives = 105/153 (69%), Gaps = 6/153 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  ++ + T
Sbjct  573  KDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVENKKERQT  632

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++  +V  +T D  ++K +I LR LG GFG+L AT +N P    ++P   E +EM   AA
Sbjct  633  SK-LEVTDETSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSEMVFAAA  689

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS++ND+CAV + Q
Sbjct  690  SNFCGKLCDCCCCMCFIQFCSRVNDRCAVTLAQ  722



>ref|XP_010531895.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Tarenaya hassleriana]
Length=756

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 106/155 (68%), Gaps = 5/155 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL K+LAK  I++LT EAW  ++++L+EKIA+ S+Q G+ SEYT M  +   E    
Sbjct  578  KDMPLDKILAKNVIDMLTEEAWLLEDRQLQEKIAKISIQTGVPSEYTQMILLENIEGPKP  637

Query  548  TEPS---KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQ  384
             E     K ++ +   KL    I L+++G GFGD+ AT++N  PG  ++  P+AAE+  +
Sbjct  638  KEAGGKKKASRNSEKQKLASRKIPLQSIGTGFGDVAATSDNVSPGFEAQKPPDAAEVLAK  697

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AASNCC  VC+KCCCMCCIQ CSK+NDQC +V+TQ
Sbjct  698  AASNCCTSVCNKCCCMCCIQCCSKLNDQCVIVLTQ  732



>ref|XP_002304123.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|EEE79102.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=757

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 13/160 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T + +  
Sbjct  580  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLQDEKA  639

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAA  399
             E        +K+N  K  D  LQK  IML NL +GFG+LTATAEN PPG+  T   EA 
Sbjct  640  PETILIQDVFNKINPLKKMD--LQKT-IMLGNLCVGFGNLTATAENIPPGTEETKSSEAT  696

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  697  EMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  736



>ref|XP_006385521.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63318.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=758

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 13/160 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T + +  
Sbjct  581  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLQDEKA  640

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAA  399
             E        +K+N  K  D  LQK  IML NL +GFG+LTATAEN PPG+  T   EA 
Sbjct  641  PETILIQDVFNKINPLKKMD--LQKT-IMLGNLCVGFGNLTATAENIPPGTEETKSSEAT  697

Query  398  EMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            EM  +AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  698  EMLFKAASNCCGRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  737



>gb|KJB65322.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=728

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 9/157 (6%)
 Frame = -2

Query  722  IPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---GTEETKG  552
            I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +     E    
Sbjct  550  ISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKGKIERDTD  609

Query  551  TTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMF  390
            TTE  KV KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  +  PE AEM 
Sbjct  610  TTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEILPEVAEML  669

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  670  NKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  706



>ref|XP_011036459.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Populus euphratica]
Length=757

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 15/161 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T   +  
Sbjct  580  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLTDEKA  639

Query  548  TEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEA  402
             E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  T   EA
Sbjct  640  PETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEETKSSEA  695

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              M V+AASNCC  V D+CCCMC IQ CS +N+QC++V++Q
Sbjct  696  TGMLVKAASNCCGRVVDRCCCMCFIQTCSYMNNQCSIVLSQ  736



>ref|XP_008450941.1| PREDICTED: uncharacterized protein LOC103492379 [Cucumis melo]
Length=755

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 10/157 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL K+ AK QIE LTAEAW ++N++L E + + S + G++SEYT M     +     
Sbjct  577  KDIPLDKLFAKNQIEQLTAEAWCSENQQLVETVKKMSTKAGVMSEYTQMVIF--QNADKV  634

Query  548  TEPSKVNKKTG------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPEAAEMF  390
             E  KV +K         PK  K +++L   G+GFG+L AT++NTP G+   KPEAAE+F
Sbjct  635  NESIKVQQKKNAYEKMVPPKGDK-MMLLPFCGVGFGNLEATSDNTPLGTGERKPEAAEIF  693

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            V+AASNCC  +C  CCC CCI+ CS++N+QCA+++TQ
Sbjct  694  VKAASNCCGNLCSFCCCPCCIETCSRMNNQCAILLTQ  730



>ref|XP_010318474.1| PREDICTED: uncharacterized protein LOC101253877 isoform X2 [Solanum 
lycopersicum]
Length=743

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 71/153 (46%), Positives = 104/153 (68%), Gaps = 5/153 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   + K T
Sbjct  571  KDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENLKEKQT  630

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++   V++ +    ++K II LR LG+GFG+L ATA+N P    ++P   E +EM   AA
Sbjct  631  SKLETVDEASDQLNVKK-IIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEMVFAAA  688

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS+++DQCAV + Q
Sbjct  689  SNLCGKLCDFCCCMCFIQFCSRVSDQCAVTLAQ  721



>ref|XP_011036458.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=758

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 15/161 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T   +  
Sbjct  581  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQTLTDEKA  640

Query  548  TEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEA  402
             E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  T   EA
Sbjct  641  PETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEETKSSEA  696

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              M V+AASNCC  V D+CCCMC IQ CS +N+QC++V++Q
Sbjct  697  TGMLVKAASNCCGRVVDRCCCMCFIQTCSYMNNQCSIVLSQ  737



>ref|XP_004144038.1| PREDICTED: uncharacterized protein LOC101210279 [Cucumis sativus]
 ref|XP_004170362.1| PREDICTED: uncharacterized protein LOC101231061 [Cucumis sativus]
 gb|KGN66313.1| hypothetical protein Csa_1G597110 [Cucumis sativus]
Length=755

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 10/157 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IP+ K+ AK QIE LTAEAW ++NK+L E + + S + G++SEYT M     +     
Sbjct  577  KDIPIDKLFAKDQIEQLTAEAWCSENKQLVEMVKKMSTKMGVLSEYTQMIIF--QNVDKV  634

Query  548  TEPSKVNKKTG------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPEAAEMF  390
             E  KV +K         PK  K +++L   G+GFG+L AT++NTP G+   KPEAAE+F
Sbjct  635  IESIKVQQKKNAYEKMVAPKGDK-MLLLPLFGVGFGNLEATSDNTPLGNGERKPEAAEIF  693

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  +C  CCC CCI+ CS++N+QCA+++TQ
Sbjct  694  AKAASNCCGKLCSFCCCPCCIEACSRMNNQCAILLTQ  730



>ref|XP_011035743.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=756

 Score =   102 bits (255),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 73/159 (46%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++P+ +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T   +  
Sbjct  580  KDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQTGVPSEYTLMVLHHTLREEKA  639

Query  548  TEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPEAAE  396
            +E        +K+N  K  D +++   IML N  +GFG+L+ATAEN PPG+ T   +A E
Sbjct  640  SETILIRDVFNKINPLKKMDLQMK---IMLGNQCVGFGNLSATAENIPPGTETRSSDATE  696

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            M   AASNCC  V D+CCCMC IQ CS +N+QCA+V++Q
Sbjct  697  MLFNAASNCCSRVVDRCCCMCFIQTCSYMNNQCAIVLSQ  735



>gb|KHG11270.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=754

 Score =   102 bits (254),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 107/158 (68%), Gaps = 9/158 (6%)
 Frame = -2

Query  725  EIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI---GTEETK  555
            +I L K+ A+QQI++LT++AWF++NK+LEEK+A+ S++   +SEYT M  +     E   
Sbjct  575  DISLDKISARQQIDLLTSQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKGKIERDT  634

Query  554  GTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  393
             TT   KV+KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  +  PE AEM
Sbjct  635  DTTGARKVSKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEILPEVAEM  694

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              +A SNCC  +C  CCC+CCI+ CSK+++QC++++TQ
Sbjct  695  LNKATSNCCGRLCRHCCCLCCIRCCSKMSNQCSILLTQ  732



>ref|XP_007012611.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
 gb|EOY30230.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
Length=759

 Score =   102 bits (254),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 79/161 (49%), Positives = 108/161 (67%), Gaps = 12/161 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEK-IARASVQHGIVSEYTNMAFIGTEETKG  552
            K+I L +VLA+QQI++LTA+AW ++NK+LEEK +A+ S+Q   +SEYT M  +   +   
Sbjct  575  KDILLDRVLARQQIDLLTAQAWLSENKQLEEKVVAKLSIQTCNISEYTRMVLLEKNKIYQ  634

Query  551  TTEPS---KVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  402
             +E S   KV  K GDP           ++L++L +GFGDL ATAEN  PGS     PE 
Sbjct  635  ASESSGSLKVPYK-GDPHEIGDSGAPKKMLLQSLTVGFGDLIATAENIRPGSQEPKLPEV  693

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            AE+ V+A SNCC  +C++CCCM CIQ CSK+N+QCA V+TQ
Sbjct  694  AEILVKATSNCCGQICNQCCCMLCIQCCSKMNNQCATVLTQ  734



>ref|XP_004303707.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0286969 [Fragaria vesca subsp. vesca]
Length=756

 Score =   102 bits (253),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 70/159 (44%), Positives = 105/159 (66%), Gaps = 9/159 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +VLAK+ I++LTA AW   +K L+EK+++ S+Q G+ SEYT+M  + T++ K  
Sbjct  579  KDFPLDRVLAKRHIDMLTAHAWLLGSKDLQEKVSKMSIQTGVPSEYTSMTLVRTDKGKKA  638

Query  548  TEPS-------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-KP-EAAE  396
             E +       KV ++T     ++  I+L +LG+GFG+L AT EN  P S   KP + AE
Sbjct  639  LELTRTQEVYIKVIQRTKSESCRQKDIILGSLGVGFGNLVATVENKAPESEEPKPSDVAE  698

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            + V+AAS CC  V D+ CCMC I+ C+ +N+QCA+V+TQ
Sbjct  699  VLVKAASTCCCRVLDRICCMCFIRTCTHVNNQCAIVLTQ  737



>ref|XP_002532724.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF29655.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=752

 Score =   101 bits (252),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 71/161 (44%), Positives = 103/161 (64%), Gaps = 13/161 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L KV+A++QI++LTA AW +++K LE+K+A+ S+Q  + SEYT+M    T    G 
Sbjct  573  KDVQLDKVIARRQIDVLTANAWMSESKDLEQKVAKMSIQTRVPSEYTHMILHRT--YTGD  630

Query  548  TEP---------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEA  402
             EP         +K+N        +   +ML NLG+GFG+L ATA N PPG+ +   P+A
Sbjct  631  KEPETILMQEVLNKINPLKQVKSERDKTVMLGNLGVGFGNLKATAANIPPGTDAIKSPDA  690

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             E  V+AAS CC  + D+ CCMC IQ CS +NDQCA+V++Q
Sbjct  691  TEKIVKAASGCCSRLLDRFCCMCFIQTCSSMNDQCAIVLSQ  731



>ref|XP_009764209.1| PREDICTED: uncharacterized protein LOC104215964 isoform X2 [Nicotiana 
sylvestris]
Length=744

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 71/153 (46%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +V A++QI+ILTA AW + +K+LEEK+ + S+Q G+ SEYTN+  +  ++ + T
Sbjct  573  KDFPLERVFARRQIKILTANAWCSGSKQLEEKVVKMSLQTGVPSEYTNLILVENKKERQT  632

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++  +V  +T D  ++K II LR LG GFG+L AT  N P    ++P   E +EM   AA
Sbjct  633  SK-LEVADETSDLNVKK-IIYLRALGFGFGNLKATMNNLPV-EAAEPKLHETSEMVFAAA  689

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            S+ C  +CD CCCMC IQ CS++NDQCAV + Q
Sbjct  690  SSLCGKLCDCCCCMCFIQFCSRVNDQCAVTLAQ  722



>ref|XP_010318475.1| PREDICTED: uncharacterized protein LOC101253877 isoform X3 [Solanum 
lycopersicum]
Length=739

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 71/153 (46%), Positives = 101/153 (66%), Gaps = 9/153 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   + K T
Sbjct  571  KDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENLKEKQT  630

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            ++   V++        K II LR LG+GFG+L ATA+N P    ++P   E +EM   AA
Sbjct  631  SKLETVDELN-----VKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSEMVFAAA  684

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  +CD CCCMC IQ CS+++DQCAV + Q
Sbjct  685  SNLCGKLCDFCCCMCFIQFCSRVSDQCAVTLAQ  717



>ref|XP_006306812.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
 gb|EOA39710.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
Length=780

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 113/185 (61%), Gaps = 39/185 (21%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEK--------------------------IA  627
            K++PL KV AK  I++LTAEAWF+++K+L+EK                          IA
Sbjct  576  KDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKVCLHFTHPQLSFSGVAPSFCFTFFSQIA  635

Query  626  RASVQHGIVSEYTNMAFI-GTEETKGTTEPSKVN---KKTGDPKLQKAI---IMLRNLGL  468
            + S+Q  + SEYT M  +  TEE K    PS +    K + + + QK I   I L++LG+
Sbjct  636  KLSIQTSVPSEYTRMIQLEHTEELK----PSDITGKKKTSSNGEKQKMISRTIPLQSLGI  691

Query  467  GFGDLTATAENTPPGSTSK--PEAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCA  294
            GFGD TAT EN PPG   +  P+AAE FV+AAS+CC  +C+KCCCMCC+Q C+K+NDQC 
Sbjct  692  GFGDQTATRENVPPGFGEQRLPDAAEKFVKAASSCCVSLCNKCCCMCCVQCCTKLNDQCV  751

Query  293  VVMTQ  279
            +V TQ
Sbjct  752  IVFTQ  756



>dbj|BAJ95100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 99/152 (65%), Gaps = 4/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLAKQQ+++LTA+AW ++NK+LE+ +A+ S+Q+GI SEYT    + T   K  
Sbjct  578  KDIPLDKVLAKQQMDLLTAKAWLSENKQLEQMVAKMSIQNGIPSEYTRTVLLQTIMEK--  635

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAAS  375
             +P++  K+      + + + L+ L LGFG++ AT EN     G T  P+  +MF +A  
Sbjct  636  IDPAQQGKQKPKKPEEPSAMPLQGLTLGFGNVPATTENLTSGFGDTRAPDKFDMFGKAVG  695

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  V D CCCMC I  CSK+NDQCA+VM Q
Sbjct  696  GCCGRVADCCCCMCFINCCSKMNDQCAIVMVQ  727



>gb|KJB07323.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=781

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 76/183 (42%), Positives = 109/183 (60%), Gaps = 33/183 (18%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +   +    
Sbjct  576  KDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEKNKIDKA  635

Query  548  TEPSKVNK--------------------------KTGDPK-----LQKAIIMLRNLGLGF  462
             E S   K                          K  DP      L     +L++L +GF
Sbjct  636  IESSGAQKVCLSLIRNSIITVNLNSQKLGFSIQVKKTDPHKIKDPLAPRKTLLQSLSVGF  695

Query  461  GDLTATAENTPPGSTSK--PEAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVV  288
            GDLTATAEN  PG   +  P+AAE+F++A S+CC  +C++CCCMCCIQ CSK+NDQCA+V
Sbjct  696  GDLTATAENIRPGFEQQKLPDAAEVFLKATSDCCGRMCNRCCCMCCIQCCSKMNDQCAIV  755

Query  287  MTQ  279
            +TQ
Sbjct  756  LTQ  758



>ref|XP_010273854.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Nelumbo nucifera]
Length=696

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 103/153 (67%), Gaps = 10/153 (7%)
 Frame = -2

Query  710  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE---P  540
            +V AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE  K  TE    
Sbjct  527  EVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTEIGKKVTESFGS  586

Query  539  SKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSKPEAAEMFVQAA  378
             ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S  E  E+FV+AA
Sbjct  587  EEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI-EPVEIFVKAA  645

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SNCC  + + CCC+CCI+ CSK+N++CA V+ Q
Sbjct  646  SNCCGKLANDCCCLCCIRACSKVNNECATVLLQ  678



>ref|XP_004141711.1| PREDICTED: uncharacterized protein LOC101206287 [Cucumis sativus]
 ref|XP_004155911.1| PREDICTED: uncharacterized LOC101206287 [Cucumis sativus]
 gb|KGN45475.1| hypothetical protein Csa_7G448860 [Cucumis sativus]
Length=754

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 67/161 (42%), Positives = 102/161 (63%), Gaps = 13/161 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +E  G 
Sbjct  573  KELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFSSEYTRLILVLAKE--GK  630

Query  548  TEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSKP-EA  402
              PS +++K       T   K++   + II+L N G+GFG+LTATAEN  PG   K  +A
Sbjct  631  KAPSIISQKMRKRFDLTKSKKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEIKATQA  690

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             ++ V+AA+NC   + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  691  TDLLVKAATNCFGRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  731



>gb|EYU21307.1| hypothetical protein MIMGU_mgv1a001939mg [Erythranthe guttata]
Length=736

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 99/153 (65%), Gaps = 6/153 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL K+ A++QI  LT  AWF+ +K+LEEK  + S+  G+ SEYT +  + T + K  
Sbjct  580  KDIPLDKIFARRQINALTTNAWFSGSKELEEKATKLSLLTGVPSEYTTIILVETIKNKSL  639

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEMFVQAA  378
            +    + +KT   K QK +I +R LG+G+G+  AT EN  P + ++P   E+ E+  +AA
Sbjct  640  SNRKTLQEKT--VKEQKNMIYMRRLGIGYGNTEATVENRAPAN-AEPKLYESTEIIFKAA  696

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            SN C  + D CCCMC IQ C+++NDQCA+ +TQ
Sbjct  697  SNLCGRLVDCCCCMCFIQFCNRLNDQCAIALTQ  729



>ref|XP_003557739.1| PREDICTED: uncharacterized protein LOC100836064 [Brachypodium 
distachyon]
Length=754

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT--EETK  555
            K+IPL KVLAKQQ+++LT++AW ++NK+LE+K+A+ S+Q+ I SEYT    + T  E+  
Sbjct  577  KDIPLGKVLAKQQVDLLTSKAWLSENKQLEQKVAKLSIQNSIPSEYTRTVLLQTILEKVD  636

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQA  381
               +  +  KK G    + +   L  L LGFG++ AT EN     G T  P+  EMF ++
Sbjct  637  PAQQGKQKPKKHGSAD-ESSATPLNGLTLGFGNVAATMENLTSGFGDTKAPDKFEMFGKS  695

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
               CC  V D CCCMC I  CSK+NDQCA+VM Q
Sbjct  696  VGGCCSRVADCCCCMCFINACSKMNDQCAIVMVQ  729



>ref|XP_008462288.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1 isoform 
X3 [Cucumis melo]
Length=609

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 103/161 (64%), Gaps = 12/161 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +E K  
Sbjct  427  KELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLAKEGK-K  485

Query  548  TEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSKP-EA  402
              PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG   K  +A
Sbjct  486  APPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEIKATQA  545

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             ++ V+AA+NCC  + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  546  TDLLVKAATNCCSRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  586



>ref|XP_008228173.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Prunus 
mume]
Length=749

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 72/162 (44%), Positives = 102/162 (63%), Gaps = 12/162 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEET-KG  552
            KE PL +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEY+ M  + + +T  G
Sbjct  568  KEFPLDRVLARRHIDMLTAHAWLLGSKELEEKVSKMSKQTGVPSEYSCMILVQSLQTDNG  627

Query  551  TTEPSKV------NKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTS-KP-E  405
               P  V      NK T   K +   + +I+L NLG+GFG+L AT EN  P S   KP +
Sbjct  628  KRVPESVTIQGVYNKFTQLNKTESNRQKVIVLGNLGVGFGNLKATVENKAPASEEVKPAD  687

Query  404  AAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              E+   AASNCC  V D+ CCMC I+ CS +N+QCA+++TQ
Sbjct  688  PTELLFNAASNCCSQVLDRVCCMCFIRTCSHMNNQCAILLTQ  729



>ref|XP_006390650.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
 gb|ESQ27936.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
Length=756

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 68/163 (42%), Positives = 97/163 (60%), Gaps = 17/163 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTN--MAFIGTEETK  555
            K+IPL KVLA++QI+ LTA+AWF   K+L+EK+ R S+Q G  SEYT   ++    EE K
Sbjct  575  KDIPLDKVLARRQIDELTAQAWFEDKKELQEKVTRLSIQTGFPSEYTQIVLSLQQNEEEK  634

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRN---------LGLGFGDLTATAENTPP--GSTSKP  408
                P  + +   +P  Q    M RN          G GFG++TAT +N PP      +P
Sbjct  635  TMERPVSIKEILRNPSYQIHKQMQRNSEKTSLLGKQGFGFGNVTATLKNVPPWMEEPKEP  694

Query  407  EAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E AE+ ++AAS     V D+ CCMCC++  SK++DQC +V++Q
Sbjct  695  EGAEILIRAASG----VVDRVCCMCCLRCVSKVSDQCTIVLSQ  733



>ref|XP_010685291.1| PREDICTED: uncharacterized protein LOC104899734 [Beta vulgaris 
subsp. vulgaris]
Length=756

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 64/158 (41%), Positives = 102/158 (65%), Gaps = 8/158 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKG-  552
            K+IPL KV A+ +++ LTA+AWFT++K++E+++A  S+Q G+ SEYT M    T+     
Sbjct  577  KDIPLDKVFAQTRVDTLTAKAWFTRSKEVEKQVADISMQTGVPSEYTRMILFQTDSWNHG  636

Query  551  ----TTEPSKVNKKTGDPKLQKA--IIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEM  393
                T +  +   K+   K+ ++  I++L++LG GFGDL  TAEN PPG   K P+  ++
Sbjct  637  PDAITIQGKEAYDKSSTLKMVRSQKIMVLQSLGFGFGDLIKTAENLPPGVIIKAPDTTDL  696

Query  392  FVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             V AA+ CC  + D+ CCMC IQ  SK++D+C + ++Q
Sbjct  697  LVNAAAGCCGRLLDRFCCMCFIQGISKLSDRCVITLSQ  734



>ref|NP_001141509.1| hypothetical protein [Zea mays]
 gb|ACF86519.1| unknown [Zea mays]
 tpg|DAA45736.1| TPA: hypothetical protein ZEAMMB73_410449 [Zea mays]
Length=357

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 11/157 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T   K  
Sbjct  182  KDIPLDKVLAKQQMDLLTAKAWLMENKELERKVVKLSIQNSLPSEYTRMVLLQTSLDK--  239

Query  548  TEPS-----KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMFV-  387
             +P+     K  K++  P    A+  L  L +GFGD+ AT EN   G     +AAE FV 
Sbjct  240  IDPAQQAKNKPTKQSSSPDELPAMP-LGGLAVGFGDVAATTENLTTG-FGDMKAAEKFVM  297

Query  386  -QAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             + A+ CC  + D CCCMC I+ CSK+NDQCA+VM Q
Sbjct  298  LEKAAGCCSRMADCCCCMCFIKACSKMNDQCAIVMAQ  334



>ref|XP_010111991.1| von Willebrand factor A domain-containing protein [Morus notabilis]
 gb|EXC32302.1| von Willebrand factor A domain-containing protein [Morus notabilis]
Length=745

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 69/161 (43%), Positives = 100/161 (62%), Gaps = 13/161 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +VLA++QI++LT+ AW T +K+LEEK+A+ S Q G+ SEYT M  + ++  KG 
Sbjct  568  KDFPLNRVLARRQIDMLTSHAWLTGSKELEEKVAKMSKQTGVPSEYTLMILVNSD--KGK  625

Query  548  TEPSKVNKKTGDPKL---------QKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEA  402
              P  V  +  D KL         ++ I+ L +LG+GFGDL ATA N  +        E 
Sbjct  626  ILPDSVPAQEADNKLKLWKKSESSKEKILFLGSLGMGFGDLAATAANKLSIIEELKASEP  685

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A   V+AASNCC  + ++ CCMC IQ CS +ND+CA+++ Q
Sbjct  686  ANFLVKAASNCCSHLLNRFCCMCFIQTCSYMNDRCAILLAQ  726



>ref|XP_008462286.1| PREDICTED: uncharacterized protein LOC103500681 isoform X2 [Cucumis 
melo]
Length=755

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 67/161 (42%), Positives = 103/161 (64%), Gaps = 12/161 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +E K  
Sbjct  573  KELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLAKEGK-K  631

Query  548  TEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSKP-EA  402
              PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG   K  +A
Sbjct  632  APPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEIKATQA  691

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             ++ V+AA+NCC  + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  692  TDLLVKAATNCCSRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  732



>ref|XP_008462285.1| PREDICTED: uncharacterized protein LOC103500681 isoform X1 [Cucumis 
melo]
Length=758

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 67/161 (42%), Positives = 103/161 (64%), Gaps = 12/161 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  +E K  
Sbjct  576  KELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLAKEGK-K  634

Query  548  TEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSKP-EA  402
              PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG   K  +A
Sbjct  635  APPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKEIKATQA  694

Query  401  AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             ++ V+AA+NCC  + D+ CC+C I+ C  +ND+C V  TQ
Sbjct  695  TDLLVKAATNCCSRLIDRFCCLCFIKSCMYMNDRCVVAFTQ  735



>ref|XP_009105911.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Brassica 
rapa]
 emb|CDX96412.1| BnaA07g30230D [Brassica napus]
Length=756

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 17/163 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI+ LTA+AWF   K+L++K+ R S+Q G  SEYT M  +    +E K
Sbjct  575  KDIPLDKVLARRQIDELTAQAWFEDKKELQDKVMRLSIQTGFPSEYTQMVLSLKDNDEEK  634

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRNL---------GLGFGDLTATAENTPP--GSTSKP  408
                P  + +   +P  Q    M RN+         G GFG+L AT +N PP      +P
Sbjct  635  TIERPVSIKEILRNPSYQIQKQMSRNIERTSLLGKQGFGFGNLAATLKNIPPWMEEPKEP  694

Query  407  EAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E AE+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  695  EGAEILIRAASG----VVDRVCCMCCLQCLSRVSDQCTIVFSQ  733



>emb|CDX72920.1| BnaC06g33680D [Brassica napus]
Length=756

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 17/163 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI+ LTA+AWF   K+L++K+ R S+Q G  SEYT M  +    +E K
Sbjct  575  KDIPLDKVLARRQIDELTAQAWFEDKKELQDKVTRLSIQTGFPSEYTQMILSLKDNDEEK  634

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRNL---------GLGFGDLTATAENTPP--GSTSKP  408
                P  + +   +P  Q    M RN+         G GFG+L AT +N PP      +P
Sbjct  635  TIERPVSIKEILRNPSYQIHKQMSRNIERTSLLGKQGFGFGNLAATLKNLPPWMEEPKEP  694

Query  407  EAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E AE+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  695  EGAEILIRAASG----VVDRVCCMCCLQCLSRVSDQCTIVFSQ  733



>ref|XP_004984065.1| PREDICTED: uncharacterized protein LOC101774989 isoform X2 [Setaria 
italica]
Length=632

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T   K  
Sbjct  458  KDIPLDKVLAKQQMDLLTAKAWLLENKELERKVVKLSIQNSLPSEYTRMVLLQTNLDKID  517

Query  548  TEPSKVNK--KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQA  381
                  NK  K   P  +++ + LR L LGFGD+ AT EN     G     E  E+F +A
Sbjct  518  PAQQAKNKPTKQSSPD-ERSAMPLRGLTLGFGDVVATRENLTAGFGDIEVHERFEIFDKA  576

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
               CC  + D  CCMC I+ CSK+NDQCA+VM Q
Sbjct  577  V-GCCSRMADCFCCMCFIKACSKMNDQCAIVMAQ  609



>dbj|BAC80088.1| unknown protein [Oryza sativa Japonica Group]
Length=342

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T E    
Sbjct  169  KDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTLEKVDA  228

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQAASN  372
             +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +  A+ 
Sbjct  229  AQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEILNKAAG  288

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  289  CCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  319



>ref|NP_001060262.2| Os07g0614300 [Oryza sativa Japonica Group]
 dbj|BAF22176.2| Os07g0614300, partial [Oryza sativa Japonica Group]
Length=352

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T E    
Sbjct  179  KDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTLEKVDA  238

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQAASN  372
             +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +  A+ 
Sbjct  239  AQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEILNKAAG  298

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  299  CCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  329



>ref|XP_006598837.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1-like 
[Glycine max]
Length=665

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIGTEETK  555
            K++ L  VL+K+ I+ +TA+AW  K+++LEEK+ + S+Q+ + SEYT  NM  + ++E K
Sbjct  485  KDMQLSNVLSKRHIDQVTAQAWLLKSEELEEKVTKMSIQNKVPSEYTCMNMVLVQSDEGK  544

Query  554  GTTEPSKVNKKTGDPKLQKA-----IIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
             T E   + K       QK       + L  L LGFGDL ATAEN PP          + 
Sbjct  545  KTPEQFLLQKAYNKLSFQKLELNNQNLFLGGLSLGFGDLKATAENLPPAIKEAKPPEGLL  604

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  605  GRAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  641



>gb|KHN39616.1| Inter-alpha-trypsin inhibitor heavy chain H5 [Glycine soja]
Length=742

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIGTEETK  555
            K++ L  VL+K+ I+ +TA+AW  K+++LEEK+ + S+Q+ + SEYT  NM  + ++E K
Sbjct  562  KDMQLSNVLSKRHIDQVTAQAWLLKSEELEEKVTKMSIQNKVPSEYTCMNMVLVQSDEGK  621

Query  554  GTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
             T E   + K       QK       + L  L LGFGDL ATAEN PP          + 
Sbjct  622  KTPEQFLLQKAYNKLSFQKLELNNQNLFLGGLSLGFGDLKATAENLPPAIKEAKPPEGLL  681

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  682  GRAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  718



>ref|XP_004984064.1| PREDICTED: uncharacterized protein LOC101774989 isoform X1 [Setaria 
italica]
Length=760

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 70/154 (45%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T   K  
Sbjct  586  KDIPLDKVLAKQQMDLLTAKAWLLENKELERKVVKLSIQNSLPSEYTRMVLLQTNLDKID  645

Query  548  TEPSKVNK--KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQA  381
                  NK  K   P  +++ + LR L LGFGD+ AT EN     G     E  E+F +A
Sbjct  646  PAQQAKNKPTKQSSPD-ERSAMPLRGLTLGFGDVVATRENLTAGFGDIEVHERFEIFDKA  704

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
               CC  + D  CCMC I+ CSK+NDQCA+VM Q
Sbjct  705  VG-CCSRMADCFCCMCFIKACSKMNDQCAIVMAQ  737



>ref|XP_008667805.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=756

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 71/155 (46%), Positives = 97/155 (63%), Gaps = 7/155 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETK--  555
            K+IPL KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T   K  
Sbjct  581  KDIPLDKVLAKQQMDLLTAKAWLMENKELERKVVKLSIQNSLPSEYTRMVLLQTSLDKID  640

Query  554  -GTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMFV--Q  384
                  +K  K++  P    A + L  L +GFGD+ AT EN   G     +AAE FV  +
Sbjct  641  PAQQAKNKPTKQSSSPDELPA-MPLGGLAVGFGDVAATTENLTTG-FGDMKAAEKFVMLE  698

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             A+ CC  + D CCCMC I+ CSK+NDQCA+VM Q
Sbjct  699  KAAGCCSRMADCCCCMCFIKACSKMNDQCAIVMAQ  733



>ref|XP_004958289.1| PREDICTED: uncharacterized protein LOC101756562 [Setaria italica]
Length=751

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 67/151 (44%), Positives = 88/151 (58%), Gaps = 1/151 (1%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KEIPL KVLA QQI +LT++AW + +K+LE K+ + S+Q+ I SEYT M  + T   K  
Sbjct  577  KEIPLDKVLATQQISLLTSKAWLSADKQLERKVIKLSIQNSIPSEYTEMVLLQTNLDKVD  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQAASN  372
                   K  G     +  I L  L LGFGD  AT EN   G    +P    + +Q AS 
Sbjct  637  ATQKVKQKLKGQKGPDEIRIPLDGLKLGFGDKGATRENLITGYGDVRPPEKSVIMQKASG  696

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D  CCMCCI+ C+++NDQCA+VM Q
Sbjct  697  CCSRLADCICCMCCIKACNRMNDQCAIVMAQ  727



>gb|KFK41669.1| hypothetical protein AALP_AA2G157400 [Arabis alpina]
Length=761

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 13/163 (8%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE---ET  558
            K+IPL KVLA++QI+ LT+ AWF    +L+EK+ R S++ G   EYT +     +   E 
Sbjct  576  KDIPLDKVLARRQIDELTSRAWFEDKIELQEKVTRLSIETGFPCEYTQLVLSLKDEEGEE  635

Query  557  KGTTEPSKVNKKTGDPKLQKAIIMLRN---------LGLGFGDLTATAENTPPGSTSK-P  408
            K  T P+ + +   +P  Q    M RN          G GFG++ AT +N PP    K P
Sbjct  636  KTITRPASIKEILRNPPYQIHKQMTRNSERTSLLGKQGFGFGNVAATLKNIPPWMEEKEP  695

Query  407  EAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            E AE+ ++AAS   + V D+ CCMCC+   S+++DQC VV +Q
Sbjct  696  EGAEILIKAASGVVEGVVDRVCCMCCLSCVSRMSDQCTVVFSQ  738



>ref|NP_001050335.2| Os03g0407000 [Oryza sativa Japonica Group]
 dbj|BAF12249.2| Os03g0407000, partial [Oryza sativa Japonica Group]
Length=360

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 5/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +     K  
Sbjct  190  KDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNFVEK--  247

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAAS  375
             E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF +A  
Sbjct  248  IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKAV-  306

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  307  GCCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  338



>ref|XP_006650182.1| PREDICTED: uncharacterized protein LOC102717967 [Oryza brachyantha]
Length=750

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 70/154 (45%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT--EETK  555
            K+IPL KVLAKQQ+++LTA+AW  +N +L+ K+A+ S+Q+ I SEYT+   + T  E+  
Sbjct  577  KDIPLDKVLAKQQMDLLTAKAWLYENDQLKRKVAKLSIQNSIPSEYTHTVLLQTILEKID  636

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQA  381
               +  +  KK   P  Q A   L  L LGFGD+ AT EN     G T  PE  EMF + 
Sbjct  637  QAQQGKQKPKKNTSPNEQLA-TSLNGLSLGFGDVAATRENLSAGFGDTKPPERFEMF-EK  694

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  CC  + D CCCMC I  CSK+ND+CA+ + Q
Sbjct  695  AVGCCSRLADCCCCMCFINACSKMNDRCAIALAQ  728



>gb|KHN01425.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Glycine soja]
Length=753

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L  VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +  +G 
Sbjct  573  KDMQLSNVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQSDEGK  632

Query  548  TEPSKVNKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPEAAEMF  390
              P +   +    KL    + L N       L LGFGDL ATAEN PP          + 
Sbjct  633  KAPEQFLLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKPPEGLL  692

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  693  GKAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  729



>ref|XP_003528576.1| PREDICTED: uncharacterized protein LOC100807956 isoform X1 [Glycine 
max]
Length=756

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L  VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +  +G 
Sbjct  576  KDMQLSNVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQSDEGK  635

Query  548  TEPSKVNKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPEAAEMF  390
              P +   +    KL    + L N       L LGFGDL ATAEN PP          + 
Sbjct  636  KAPEQFLLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKPPEGLL  695

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AASNCC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  696  GKAASNCCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  732



>ref|XP_003627335.1| hypothetical protein MTR_8g021260 [Medicago truncatula]
Length=260

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 91/162 (56%), Gaps = 17/162 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIGTEETK  555
            K++ L  V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  +   + K
Sbjct  79   KDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVNKNDVK  138

Query  554  GTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  405
               EP  + K  G           PKL      L  L  GFGDL ATAENTPP +     
Sbjct  139  KEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPATKEAKP  193

Query  404  AAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +  +  +AAS CC  V D CC MC ++ CS +NDQC +V TQ
Sbjct  194  SEGLLGKAASTCCGRVADTCCGMCLLKTCSFVNDQCTIVCTQ  235



>ref|XP_010416000.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=759

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 68/164 (41%), Positives = 93/164 (57%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    +E K
Sbjct  577  KDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQQDDEEK  636

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTSKPE  405
                P  + +   +P  Q    M RN           G GFG++ AT +N PP      E
Sbjct  637  TMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNIVATLKNVPPWMEEPKE  696

Query  404  A--AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  697  ADGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  736



>gb|EEE67586.1| hypothetical protein OsJ_25118 [Oryza sativa Japonica Group]
Length=755

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T E    
Sbjct  582  KDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTLEKVDA  641

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQAASN  372
             +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +  A+ 
Sbjct  642  AQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEILNKAAG  701

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  702  CCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  732



>ref|XP_010471276.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=758

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 68/164 (41%), Positives = 93/164 (57%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    +E K
Sbjct  576  KDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQQDDEEK  635

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTSKPE  405
                P  + +   +P  Q    M RN           G GFG++ AT +N PP      E
Sbjct  636  TMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNIVATLKNVPPWMEEPKE  695

Query  404  A--AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  696  ADGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  735



>gb|ABF96528.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=477

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 5/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +     K  
Sbjct  307  KDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNFVEK--  364

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAAS  375
             E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF +A  
Sbjct  365  IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKAVG  424

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  425  -CCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  455



>ref|XP_010428136.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Camelina sativa]
 ref|XP_010428137.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Camelina sativa]
Length=758

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 68/164 (41%), Positives = 93/164 (57%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    +E K
Sbjct  576  KDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQQDDEEK  635

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTSKPE  405
                P  + +   +P  Q    M RN           G GFG++ AT +N PP      E
Sbjct  636  TMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNVVATLKNVPPWMEEPKE  695

Query  404  A--AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  696  ADGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  735



>ref|XP_009414822.1| PREDICTED: uncharacterized protein LOC103995835 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=754

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 63/155 (41%), Positives = 95/155 (61%), Gaps = 7/155 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL K  +KQ I++LTA+AWF+++K L+EK+ + S+Q  I SEYT M F+ T+  K  
Sbjct  579  KDFPLEKAFSKQHIDLLTAQAWFSESKLLQEKVTKLSIQSSIPSEYTCMVFLQTDTGKQE  638

Query  548  T---EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQ  384
                   K ++K  +PK +   +++R   +GFGD+ AT EN P   G   +PE  +++ +
Sbjct  639  AIKQVKKKDSRKHANPK-ENLSVLVRRTAIGFGDIIATTENHPTGFGGLKEPETFDVYNK  697

Query  383  AASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A   CC  +   CCC C I+ CSK+NDQ  +VMTQ
Sbjct  698  AVG-CCNGIAYCCCCPCFIKTCSKVNDQLVIVMTQ  731



>gb|EEC82439.1| hypothetical protein OsI_26857 [Oryza sativa Indica Group]
Length=863

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T E    
Sbjct  690  KDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQTLEKVDA  749

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQAASN  372
             +  K   K      +   I L+ L LGFGD  AT EN   G    KP      +  A+ 
Sbjct  750  AQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEILNKAAG  809

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D  CCMCCI+ C+K+NDQCA+VMTQ
Sbjct  810  CCSRLADCLCCMCCIKACNKMNDQCAIVMTQ  840



>gb|AAG52586.1|AC016529_17 hypothetical protein; 14673-17893 [Arabidopsis thaliana]
Length=758

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 66/164 (40%), Positives = 95/164 (58%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--GTEETK  555
            K+IPL KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M       EE K
Sbjct  577  KDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSVKHDEEEK  636

Query  554  GTTEPSKVNKKTGDP------KLQKAIIMLRNL----GLGFGDLTATAENTPP--GSTSK  411
                P  + +   +P      ++Q++  M R+L    G GFG++ AT +N PP      +
Sbjct  637  TMARPVSIKEILRNPPYQIHKQMQRSNSMRRSLLGKQGYGFGNVAATLKNVPPWMEEPKE  696

Query  410  PEAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             E  E+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  697  VEGTELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTIVFSQ  736



>ref|NP_177394.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35331.1| uncharacterized protein AT1G72500 [Arabidopsis thaliana]
Length=756

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 66/164 (40%), Positives = 95/164 (58%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--GTEETK  555
            K+IPL KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M       EE K
Sbjct  575  KDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSVKHDEEEK  634

Query  554  GTTEPSKVNKKTGDP------KLQKAIIMLRNL----GLGFGDLTATAENTPP--GSTSK  411
                P  + +   +P      ++Q++  M R+L    G GFG++ AT +N PP      +
Sbjct  635  TMARPVSIKEILRNPPYQIHKQMQRSNSMRRSLLGKQGYGFGNVAATLKNVPPWMEEPKE  694

Query  410  PEAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             E  E+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  695  VEGTELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTIVFSQ  734



>ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-trypsin inhibitor, 
heavy chain 4-like [Phoenix dactylifera]
Length=746

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 8/122 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AKQ I++LTAEAWF+++K+LEEKI + S++  + SEYT M  + T+  K  
Sbjct  575  KDIPLEKVFAKQHIDLLTAEAWFSESKQLEEKIIKLSMRSSVPSEYTYMILLQTDTEK--  632

Query  548  TEPSKVNKKTGDPK----LQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFV  387
             +  K  KK G  K      +  I++  L +GFG++ AT+EN P   G    PE  ++  
Sbjct  633  QDAVKQAKKHGSQKHAGPKNRLSILVHGLTIGFGNIVATSENLPTGFGEPKLPETNDVLE  692

Query  386  QA  381
            +A
Sbjct  693  KA  694



>ref|XP_002465153.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
 gb|EER92151.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
Length=756

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 4/151 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLAKQQ+++LTA++W  +NK+LE K+ + S+Q+ + SEYT M  + T   K  
Sbjct  582  KDIPLDKVLAKQQMDLLTAKSWLMENKELERKVVKLSIQNSLPSEYTRMVLLQTSLDKID  641

Query  548  TEPSKVNKKTGDPKLQKAIIM-LRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMFVQAA  378
                  NK T      +   M L  L LGFGD+ AT EN  T  G    PE   +F + A
Sbjct  642  PAQQAKNKPTKQSSPDELPAMPLGGLALGFGDVAATRENLTTGFGDMKAPEKFVIF-EKA  700

Query  377  SNcckmvcdkcccmcciqmcsKINDQCAVVM  285
              CC  V D CCCMC I+ CSK+NDQCA+VM
Sbjct  701  VGCCSRVADCCCCMCFIKACSKMNDQCAIVM  731



>gb|EEE59232.1| hypothetical protein OsJ_11214 [Oryza sativa Japonica Group]
Length=718

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 5/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +     K  
Sbjct  548  KDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNFVEK--  605

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAAS  375
             E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF +A  
Sbjct  606  IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKAV-  664

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  665  GCCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  696



>ref|XP_002888881.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65140.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 66/164 (40%), Positives = 92/164 (56%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M  +    EE K
Sbjct  575  KDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSLKHDEEEK  634

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPP--GSTSK  411
                P  + +   +P  Q    M R+           G GFG++TAT +N PP      +
Sbjct  635  TMARPVSIKEILRNPPYQIHKQMQRSNSVRTSLLGKQGYGFGNVTATLKNVPPWIEEPKE  694

Query  410  PEAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             E  E+ ++AAS     V D+ CCMCC+Q  S+++DQC +V +Q
Sbjct  695  TEGTELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTIVFSQ  734



>gb|KEH18484.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=596

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 91/162 (56%), Gaps = 17/162 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIGTEETK  555
            K++ L  V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  +   + K
Sbjct  415  KDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVNKNDVK  474

Query  554  GTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  405
               EP  + K  G           PKL      L  L  GFGDL ATAENTPP +     
Sbjct  475  KEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPATKEAKP  529

Query  404  AAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +  +  +AAS CC  V D CC MC ++ CS +NDQC +V TQ
Sbjct  530  SEGLLGKAASTCCGRVADTCCGMCLLKTCSFVNDQCTIVCTQ  571



>gb|AET01809.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=753

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 63/162 (39%), Positives = 91/162 (56%), Gaps = 17/162 (10%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIGTEETK  555
            K++ L  V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  +   + K
Sbjct  572  KDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVNKNDVK  631

Query  554  GTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  405
               EP  + K  G           PKL      L  L  GFGDL ATAENTPP +     
Sbjct  632  KEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPATKEAKP  686

Query  404  AAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +  +  +AAS CC  V D CC MC ++ CS +NDQC +V TQ
Sbjct  687  SEGLLGKAASTCCGRVADTCCGMCLLKTCSFVNDQCTIVCTQ  728



>gb|ABF96527.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EEC75447.1| hypothetical protein OsI_11983 [Oryza sativa Indica Group]
Length=751

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 5/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +     K  
Sbjct  581  KDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQNFVEK--  638

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAAS  375
             E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EMF +A  
Sbjct  639  IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKAVG  698

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  + D CCCMC I  CSK+ND+CA+VM Q
Sbjct  699  -CCSRLTDCCCCMCFINTCSKMNDRCAIVMVQ  729



>ref|XP_009404352.1| PREDICTED: uncharacterized protein LOC103987694 [Musa acuminata 
subsp. malaccensis]
Length=750

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 5/154 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIG--TEETK  555
            K+ PL K    Q I++LTA+AWF+++K+L+EK+ + S+Q  I SEYT M F+   TE+ +
Sbjct  576  KDFPLEKAFVNQHIDLLTAQAWFSESKQLKEKVTKLSIQSSIPSEYTCMVFLQKETEKDE  635

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQA  381
               +  K + +         +I++R++ +GFGD+TAT EN P   G   +P A  +    
Sbjct  636  SLKKVKKRDSRKHAGSKDNLLILVRDMAIGFGDITATIENHPTVLGEPKEP-ATSLVYNK  694

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  CC  +   CCC C I+ CS++NDQ  +VMTQ
Sbjct  695  AIGCCNRIAYCCCCPCFIKTCSRLNDQLVIVMTQ  728



>ref|XP_006583165.1| PREDICTED: uncharacterized protein LOC100807956 isoform X2 [Glycine 
max]
Length=699

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 87/151 (58%), Gaps = 7/151 (5%)
 Frame = -2

Query  710  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTEPSKV  531
            +VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +  +G   P + 
Sbjct  525  EVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQSDEGKKAPEQF  584

Query  530  NKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPEAAEMFVQAASN  372
              +    KL    + L N       L LGFGDL ATAEN PP          +  +AASN
Sbjct  585  LLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKPPEGLLGKAASN  644

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  645  CCGRLADTCCGMCLLQTCTFVNDQCTIVCTQ  675



>ref|XP_008653341.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Zea mays]
Length=521

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 9/154 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT--EETK  555
            KEIPL KVL  QQI+ +T++AW + +K++E K+ + S Q+G+ SEYT+M F+ T  ++ +
Sbjct  349  KEIPLDKVLVIQQIDFMTSKAWMSADKQVERKVIKLSTQNGVPSEYTDMIFLQTNLDKVE  408

Query  554  GTTE-PSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQA  381
            GT +   K+    G  + Q     +  L LGFG+  AT EN   G     P    + +Q 
Sbjct  409  GTQKVKQKLKGHKGRDEQQ-----IYGLKLGFGNKDATRENLITGFGDMNPAEKSVMLQK  463

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             S CC  V D  CCMCCI+ C+++NDQCAV+M Q
Sbjct  464  GSGCCSRVADCLCCMCCIKACNRMNDQCAVLMAQ  497



>ref|XP_007135423.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07417.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=752

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 60/157 (38%), Positives = 90/157 (57%), Gaps = 7/157 (4%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFIGTEETK  555
            K+I L  VLAK+ I+++TA+AW  K++++EEK+ + S+Q+ ++SEYT  NM  + ++E K
Sbjct  573  KDIQLSNVLAKRHIDMVTAQAWLLKSEEVEEKVTKMSIQNKVLSEYTCMNMVLVQSDEGK  632

Query  554  GTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
               E   + K       Q+       + L  L +GFGD  ATAEN  P          + 
Sbjct  633  KPPEQFLLKKAYNKLSFQQLEFDMKKLFLGGLSVGFGDSKATAENLAPSIKEAKPPEGLL  692

Query  389  VQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             +AAS CC  + D CC MC +Q C+ +NDQC +V TQ
Sbjct  693  GKAASTCCGRLADSCCGMCLLQACTLVNDQCTIVCTQ  729



>ref|XP_006658810.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like, 
partial [Oryza brachyantha]
Length=703

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KVLA QQI +LTA+AW + +K LE ++ + S+Q+ I SEYT+M  + T E    
Sbjct  531  KDIPLDKVLAAQQIGLLTAKAWLSSDKHLEREVVKLSIQNSIPSEYTSMVLLQTLEKVVE  590

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMFVQAAS  375
                K+    G  + Q+  I L  L LGFG+  AT +N  T       PE  E+  +AA 
Sbjct  591  QVKQKLKGHKGADEPQR--IPLHGLKLGFGNKAATRDNLITAFDDVKPPETFEILNKAA-  647

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
                      CCMCCI+ C+K+NDQCA+VM Q
Sbjct  648  GRLPRPPPCLCCMCCIKACNKMNDQCAIVMAQ  679



>ref|XP_002461009.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
 gb|EER97530.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
Length=751

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 1/151 (1%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            KEIPL KVL  +QI+++TA+AW + +K+LE K+ + S+Q+G+ SEYT M  + T   K  
Sbjct  577  KEIPLDKVLVTKQIDLMTAKAWLSADKQLERKVIKLSIQNGVPSEYTEMTLLQTNLDKVD  636

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMFVQAASN  372
                   K  G     +  I++  L LGFG+  AT EN   G   + P    + +     
Sbjct  637  GTQKVKQKLKGQKGRDEQRILMHGLKLGFGNKDATRENLITGFGDRNPAEKLVMLHKGKG  696

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  V D  CCMCCI+ C+++NDQCA++M Q
Sbjct  697  CCSSVADCLCCMCCIKACNRMNDQCAILMAQ  727



>ref|XP_010235662.1| PREDICTED: uncharacterized protein LOC100843408 [Brachypodium 
distachyon]
Length=746

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 5/152 (3%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+ PL +VLA QQI +LTA+AWF+ +K+LE K+   S+Q+ ++SEYT M  + T    G 
Sbjct  574  KDTPLDEVLAAQQIALLTAKAWFSADKQLERKVMDLSIQNSVLSEYTRMVVLQT--NLGA  631

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMFVQAAS  375
             +  K   K      +   I L  L LGFGD  AT +N  T  G    PE  ++F + A 
Sbjct  632  AQKGKQKTKGHKGSNEPLRIPLHGLKLGFGDKAATRDNLLTGFGEEKPPETLKIF-KKAG  690

Query  374  NcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             CC  + D  CCMCCI+ C+++NDQCA++M Q
Sbjct  691  GCCGRLADCLCCMCCIKACNRMNDQCAIMMAQ  722



>tpg|DAA63586.1| TPA: hypothetical protein ZEAMMB73_270893 [Zea mays]
Length=750

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 9/154 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT--EETK  555
            KEIPL KVL  QQI+ +T++AW + +K++E K+ + S Q+G+ SEYT+M F+ T  ++ +
Sbjct  578  KEIPLDKVLVIQQIDFMTSKAWMSADKQVERKVIKLSTQNGVPSEYTDMIFLQTNLDKVE  637

Query  554  GTTE-PSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQA  381
            GT +   K+    G  + Q     +  L LGFG+  AT EN   G     P    + +Q 
Sbjct  638  GTQKVKQKLKGHKGRDEQQ-----IYGLKLGFGNKDATRENLITGFGDMNPAEKSVMLQK  692

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
             S CC  V D  CCMCCI+ C+++NDQCAV+M Q
Sbjct  693  GSGCCSRVADCLCCMCCIKACNRMNDQCAVLMAQ  726



>ref|XP_006301970.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
 gb|EOA34868.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
Length=757

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 94/164 (57%), Gaps = 18/164 (11%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFIGTEETK  555
            K+IPL KVLA++QI  LTA AWF + K+LEEK+ R S+Q G  SEYT M  +    EE K
Sbjct  575  KDIPLDKVLARRQINELTARAWFEEKKELEEKVMRLSIQTGFPSEYTQMVLSLKQDEEEK  634

Query  554  GTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPGSTSKPE  405
              T P  + +   +P  Q    M RN           G GFG++ AT +N PP      E
Sbjct  635  TITRPVSIKEILRNPPYQIHKQMQRNNSMRTSLLGKQGYGFGNVVATLKNVPPWMEEPKE  694

Query  404  A--AEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  AE+ ++AAS     V D+ CCMCC+Q  S+++DQC VV +Q
Sbjct  695  AEGAELLIRAASG----VVDRVCCMCCLQCMSRVSDQCTVVFSQ  734



>dbj|BAK07105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 90/154 (58%), Gaps = 9/154 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT--EETK  555
            K++PL  V A QQI +LTA+AW + +K+LE K+ + S+++ ++SEYT+M  + T  +  +
Sbjct  238  KDMPLDNVFAPQQIALLTAKAWLSADKQLERKVIKLSIENSVLSEYTSMVVLQTNLDAAQ  297

Query  554  GTTEPSKVNKKTGDP-KLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMFVQA  381
               +  K +K   +P + Q     L  L LGFGD  AT EN   G    KP       + 
Sbjct  298  KVKQKPKGHKGANEPLRFQ-----LHGLKLGFGDKAATKENLLTGFGEEKPLETLKIFKK  352

Query  380  ASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            A  CC  V D  CCMCCI+ C+++NDQCA++M Q
Sbjct  353  AGGCCSRVADCLCCMCCIKACNRMNDQCAIMMAQ  386



>ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Elaeis 
guineensis]
Length=747

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 6/106 (6%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL KV AKQ I++LTAEAWF+++K+L+EK  + S++  + SEYT M  + T+  K  
Sbjct  575  KDIPLEKVFAKQHIDLLTAEAWFSESKQLKEKAIKISMRSSVPSEYTYMILLQTDTEK--  632

Query  548  TEPSKVNKKTGDPKLQKAIIMLR----NLGLGFGDLTATAENTPPG  423
             +  K  KK G  K       LR     L +GFG++ AT EN P G
Sbjct  633  QDAVKQVKKHGSQKDAGPKNCLRIRVHGLAIGFGNVNATLENLPTG  678



>ref|XP_009389548.1| PREDICTED: uncharacterized protein LOC103976087 [Musa acuminata 
subsp. malaccensis]
Length=747

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE----E  561
            K++ L K LAKQ I++LT++AWF+++K+LEEK+ + S+Q  I SEYT M  + TE    E
Sbjct  576  KDLSLEKALAKQHIDLLTSQAWFSESKQLEEKVIKLSIQSSIPSEYTCMVLLQTETEKQE  635

Query  560  TKGTTEPSKVNKKTG-DPKLQKAIIMLRNLGLGFGDLTATAENTPPG  423
                 +  +  K +G D  L    I +R++  GFG++ AT EN P G
Sbjct  636  AVKKVKKRESRKHSGPDDNLS---ISVRSMVNGFGNVIATKENRPTG  679



>gb|KJB83726.1| hypothetical protein B456_013G261400 [Gossypium raimondii]
Length=644

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 88/159 (55%), Gaps = 21/159 (13%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+IPL  VLA++QI+          N  L   +A+ S+Q   +SEYT M  +   +    
Sbjct  497  KDIPLDSVLARRQIDA-------ANNSGL---VAKLSIQTCNISEYTRMTLLEKNKMLKA  546

Query  548  TEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK--PEAAE  396
             +     KK GDP  QK +       I+L+ L +GFGDL ATAEN  PGS     PE A+
Sbjct  547  LKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDLIATAENIRPGSQEPELPEVAK  604

Query  395  MFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            +F++  SN    + ++ CCM CI+ CSK+N+QCA  +TQ
Sbjct  605  IFIKTTSNYFGGIRNRWCCMGCIRCCSKMNNQCATTLTQ  643



>gb|EMT10977.1| hypothetical protein F775_14225 [Aegilops tauschii]
Length=584

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 88/151 (58%), Gaps = 5/151 (3%)
 Frame = -2

Query  725  EIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTT  546
            ++PL  + A QQI +LTA+AW + +K+LE K+ + S+++ ++SEYT+M  + T       
Sbjct  413  DMPLDNIFAAQQIALLTAKAWLSADKQLERKVIKLSIENSVLSEYTSMVVLQTNLDAAQK  472

Query  545  EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEMFVQAASN  372
               K   +TG  +  +    L  L LGFGD  AT EN  T  G     E  ++F + A  
Sbjct  473  VKQKPKGRTGANEPLR--FQLHGLKLGFGDKAATRENLLTAFGDEKPLEMLKIF-KKAGG  529

Query  371  cckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
            CC  V D  CCMCCI+ C+++NDQCA+++ Q
Sbjct  530  CCSRVADCLCCMCCIKACNRMNDQCAILLAQ  560



>ref|XP_006836596.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
 gb|ERM99449.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
Length=761

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 6/119 (5%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            + IP  K+LAKQ I++LTA+AWF ++K LEE++ + S+  GI SE+T+M    TE  K +
Sbjct  578  ENIPFVKMLAKQHIDLLTAQAWFHEDKHLEEQVVKMSMHTGIPSEFTHMVLFQTEREKHS  637

Query  548  T------EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMF  390
            +        +KV+           I  +  L +GFG + AT  N P  S+    +  +F
Sbjct  638  SLVHELKLGNKVDFSEYTTSKASKITFVHGLTVGFGSIEATENNIPIESSELNVSKSIF  696



>ref|XP_010537629.1| PREDICTED: uncharacterized protein LOC104812256 [Tarenaya hassleriana]
Length=763

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 11/108 (10%)
 Frame = -2

Query  722  IPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE  543
            +PL KVLA++QI+ LTA AWF   K+++EK+ + S++ G   EYT M     E+ K  ++
Sbjct  586  MPLDKVLARRQIDELTARAWFEDRKEIQEKVKKLSIETGFPCEYTPMVLFKQEDEKIISK  645

Query  542  PSKVNKKTGDP----------KLQKAIIMLRNLGLGFGDLTATAENTP  429
            P  + +   +P          K +K+++M      GFG+  ATA+N P
Sbjct  646  PLSIKEILRNPPYEIQKHMQKKSEKSMVM-GTQSRGFGNADATAKNVP  692



>ref|XP_004510514.1| PREDICTED: uncharacterized protein LOC101499440 [Cicer arietinum]
Length=757

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 95/168 (57%), Gaps = 25/168 (15%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L  V +K+ ++++TA+AW  ++++LEEK+++ S+Q+ + SEYT M  +  ++  G 
Sbjct  572  KDMQLTNVFSKRHVDLVTAQAWLLESEELEEKVSKMSIQNNVPSEYTCMEMVLVKKDDG-  630

Query  548  TEPSKVNKKTGDPKLQKAIIMLRNLGL-----------------GFGDLTATAENTPPGS  420
                   K +G+  L+KA   +  L L                 GFGDL AT+EN PP +
Sbjct  631  ------KKASGEFMLKKAYSQVSKLSLQGLEIERPKLFLGGLRHGFGDLKATSENIPPAT  684

Query  419  T-SKPEAAEMFVQAASNcckmvcdkcccmcciqmcsKINDQCAVVMTQ  279
              +KP    +  +AAS CC MV + CC MC ++ CS +ND C +V TQ
Sbjct  685  KEAKPSDPGLLEKAASTCCGMVANTCCGMCLLKTCSLVNDSCTIVCTQ  732



>ref|XP_010318476.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028 isoform X4 [Solanum lycopersicum]
Length=641

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++PL +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +   + K T
Sbjct  571  KDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVENLKEKQT  630

Query  548  TEPSKVNK  525
            ++   V++
Sbjct  631  SKLETVDE  638



>gb|KJB65319.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=646

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  722  IPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE  543
            I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +   + +  T+
Sbjct  576  ISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEKGKIERDTD  635

Query  542  PSKVNKKTG  516
             ++  KK G
Sbjct  636  TTEARKKLG  644



>gb|AAU89244.1| von Willebrand factor type A domain containing protein [Oryza 
sativa Japonica Group]
Length=801

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 72/200 (36%), Positives = 93/200 (47%), Gaps = 51/200 (26%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEK-----------------------IARAS  618
            K+I L KVLAKQQ+++LTA+AWF +N +LE K                       + + S
Sbjct  581  KDISLDKVLAKQQMDLLTAKAWFYENNQLEMKSGMRFTTVHCIMSYKVMLNLHYEVVKLS  640

Query  617  VQHGIVSEYTN----MAFIGTEETKGTTEPS------KVNKKTGDPKL------------  504
            +Q+ I SEYT       F+   E    TE            +T D  L            
Sbjct  641  IQNSIPSEYTRTILLQNFVEKIEQVFVTEGGVLYMFFSYGNRTLDETLKLKGKQKPKKNS  700

Query  503  ---QKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAASNcckmvcdkccc  339
               +++   L  L LGFGD  AT EN     G T  PE  EMF +A   CC  + D CCC
Sbjct  701  TQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKAVG-CCSRLTDCCCC  759

Query  338  mcciqmcsKINDQCAVVMTQ  279
            MC I  CSK+ND+CA+VM Q
Sbjct  760  MCFINTCSKMNDRCAIVMVQ  779



>ref|XP_010477112.1| PREDICTED: uncharacterized protein LOC104756252 [Camelina sativa]
Length=131

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = -2

Query  509  KLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASNcckmvcdkcccm  336
            K+    I L++LG+GFGD TAT EN PPG   +  P+AAE FV+AAS+CC  +C+KCCCM
Sbjct  29   KMISRTIPLQSLGIGFGDKTATRENVPPGFGEQRAPDAAEKFVKAASSCCVSLCNKCCCM  88

Query  335  cciqmcsKINDQCAVVMTQ  279
            CC+Q C+K+NDQC +V TQ
Sbjct  89   CCVQCCTKLNDQCVLVFTQ  107



>ref|XP_003609990.1| von Willebrand factor A domain-containing protein [Medicago truncatula]
Length=844

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K IP+ +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  +  K  
Sbjct  598  KGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILENDHLKKI  657

Query  548  TE  543
             E
Sbjct  658  KE  659


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = -2

Query  494  IIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMFVQAASNcckmvcdkcccmcciqmcs  315
            +I+L NLG+GFG+L ATAENTPPG  +K E AE+F +AASNC   VC  CCCMCCIQ  S
Sbjct  750  MILLPNLGVGFGNLKATAENTPPGYEAKIEMAEIF-KAASNCFDTVCGYCCCMCCIQCFS  808

Query  314  KINDQCAVVMTQ  279
            ++N+QC   + Q
Sbjct  809  RMNNQCLTALNQ  820



>gb|KCW71308.1| hypothetical protein EUGRSUZ_F04395 [Eucalyptus grandis]
Length=105

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -2

Query  515  DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPE-AAEMFVQAASNcckmvcdkccc  339
            D K Q+ +I+L +LG GFG+LTAT +N PPG   K   AA++ V+AASNCC  + D+ CC
Sbjct  3    DLKGQR-VILLGSLGKGFGNLTATVKNIPPGLEEKTSYAADVLVKAASNCCGKLMDRICC  61

Query  338  mcciqmcsKINDQCAVVMTQ  279
            MC IQ CS +ND+CAV +TQ
Sbjct  62   MCFIQTCSYVNDRCAVALTQ  81



>gb|ABF96529.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=680

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT  588
            K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT
Sbjct  581  KDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYT  627



>gb|KHN06057.1| hypothetical protein glysoja_035963 [Glycine soja]
Length=178

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSE  594
            K+IP+ ++ A+ QIE LTA+AW +K++KLE+K+A+ S+Q+  +SE
Sbjct  134  KDIPVQRICARDQIEYLTAQAWLSKDEKLEQKVAKLSLQNDFISE  178



>ref|XP_007216978.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
 gb|EMJ18177.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
Length=624

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT  588
            KE PL +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEYT
Sbjct  568  KEFPLDRVLARRHIDMLTAHAWLLGSKELEEKVSKMSKQTGVPSEYT  614



>ref|XP_007135424.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07418.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=650

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K+I L  VLAK+ I+++TA+AW  K++++EEK+ + S+Q+ ++SEYT M  +  +  +G 
Sbjct  573  KDIQLSNVLAKRHIDMVTAQAWLLKSEEVEEKVTKMSIQNKVLSEYTCMNMVLVQSDEGK  632

Query  548  TEP  540
              P
Sbjct  633  KPP  635



>tpg|DAA41433.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=1295

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 8/91 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIA----RASVQHGIVSEYTNMAFIGT--  567
            KE+ L KVL  Q I+++TA+AW +  K+LE K+     + S+Q+G+ SEYT+M  + T  
Sbjct  579  KEVTLDKVLVTQHIDLMTAKAWLSAAKQLERKVGYLVIKLSIQNGVPSEYTDMVLLQTNL  638

Query  566  EETKGTTEPSKVNKKTG--DPKLQKAIIMLR  480
            + T    + ++ N  TG  D    + I+ML+
Sbjct  639  DNTGTQKDATRENLVTGFWDVNSAEKIVMLQ  669



>ref|XP_006385522.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63319.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=690

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAF  576
            K++P  +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M  
Sbjct  581  KDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVL  631



>tpg|DAA41434.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=758

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 8/91 (9%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIA----RASVQHGIVSEYTNMAFIGT--  567
            KE+ L KVL  Q I+++TA+AW +  K+LE K+     + S+Q+G+ SEYT+M  + T  
Sbjct  579  KEVTLDKVLVTQHIDLMTAKAWLSAAKQLERKVGYLVIKLSIQNGVPSEYTDMVLLQTNL  638

Query  566  EETKGTTEPSKVNKKTG--DPKLQKAIIMLR  480
            + T    + ++ N  TG  D    + I+ML+
Sbjct  639  DNTGTQKDATRENLVTGFWDVNSAEKIVMLQ  669



>gb|ETO27230.1| hypothetical protein RFI_09901, partial [Reticulomyxa filosa]
Length=191

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  725  EIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETK  555
             +P+ K+L KQ+I++LTA+AWF+++K +  K+ ++S++H + S YT++    T + K
Sbjct  105  HLPVDKILIKQKIDLLTAQAWFSQDKAVIRKVVQSSIEHCVPSHYTSLIAFETRKEK  161



>gb|EPS65940.1| hypothetical protein M569_08838, partial [Genlisea aurea]
Length=637

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = -2

Query  725  EIPLXKVLAKQQIEILTAEAWFTK--NKKLEEKIARASVQHGIVSEYTNMAFIGT  567
            +I + ++ AK +IE+LT++AW++   N +L+ K+A  S+Q+G+VSEYTNM  I T
Sbjct  580  DIVIPQITAKLRIELLTSQAWYSSSGNGELKHKVANLSIQNGVVSEYTNMVLIET  634



>gb|ETO32114.1| hypothetical protein RFI_05003 [Reticulomyxa filosa]
Length=278

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  725  EIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM  582
             +P+ K+  K++I++LTA+AWF+ +KK+E ++ + SV H I S+YT++
Sbjct  102  HLPVDKIFVKEKIDLLTAQAWFSDDKKIENQVIQESVTHSIPSQYTSL  149



>gb|KDO73865.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=613

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASV  615
            K+IPL ++ AKQQI++LTA+AWF+++K+LEEK+  +++
Sbjct  576  KDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVRCSAI  613



>ref|XP_006452826.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66066.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=613

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASV  615
            K++PL ++ AKQQI++LTA+AWF+++K+LEEK+  +++
Sbjct  576  KDLPLDRICAKQQIDLLTAQAWFSEDKRLEEKVRCSAI  613



>gb|KEH18487.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=491

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L  V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT M  I   +    
Sbjct  415  KDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVNKNDVK  474

Query  548  TEP  540
             EP
Sbjct  475  KEP  477



>gb|KEH18485.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=648

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  728  KEIPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGT  549
            K++ L  V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT M  I   +    
Sbjct  572  KDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILVNKNDVK  631

Query  548  TEP  540
             EP
Sbjct  632  KEP  634



>ref|XP_002503574.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64832.1| predicted protein [Micromonas sp. RCC299]
Length=753

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 9/105 (9%)
 Frame = -2

Query  722  IPLXKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE  543
            IPL KV  K++I++LTA AW T NK  E  +   S+++G+   +T +     +  K + E
Sbjct  560  IPLDKVFIKERIDMLTANAWLTNNKSAEADVTALSLEYGVPCPHTKLCAFEVDPKK-SAE  618

Query  542  PSKVNKKTGDPKLQK-------AIIMLRNL-GLGFGDLTATAENT  432
                 KK G  K+ K        +++L  L G  FG++ A+  N 
Sbjct  619  VEAAKKKGGAMKIAKYAVGGAAGVMVLGALAGADFGNVGASLANV  663



>ref|XP_010462785.1| PREDICTED: uncharacterized protein LOC104743395 [Camelina sativa]
Length=273

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = -2

Query  509  KLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAASN  372
            K+    I L++LG+GFGD TAT EN PP  G    P+AAE FV+AAS+
Sbjct  29   KMVSRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFVKAASS  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470