BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025N04

Length=696
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011093846.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    137   5e-33   Sesamum indicum [beniseed]
ref|XP_011093845.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    135   2e-32   Sesamum indicum [beniseed]
ref|XP_002277641.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    133   6e-32   Vitis vinifera
ref|XP_009597215.1|  PREDICTED: uncharacterized protein LOC104093199    133   9e-32   Nicotiana tomentosiformis
gb|KDO73864.1|  hypothetical protein CISIN_1g004349mg                   131   3e-31   Citrus sinensis [apfelsine]
emb|CDP03063.1|  unnamed protein product                                131   5e-31   Coffea canephora [robusta coffee]
ref|XP_006474710.1|  PREDICTED: uncharacterized protein LOC102609180    130   6e-31   Citrus sinensis [apfelsine]
ref|XP_006452827.1|  hypothetical protein CICLE_v10007546mg             130   9e-31   Citrus clementina [clementine]
ref|XP_009796968.1|  PREDICTED: uncharacterized protein LOC104243478    127   8e-30   Nicotiana sylvestris
ref|XP_010047465.1|  PREDICTED: uncharacterized protein LOC104436401    125   5e-29   Eucalyptus grandis [rose gum]
ref|XP_011007767.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    125   7e-29   Populus euphratica
ref|XP_007204639.1|  hypothetical protein PRUPE_ppa001864mg             124   2e-28   Prunus persica
ref|XP_008242260.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    121   5e-28   
ref|XP_002324729.2|  inter-alpha-trypsin inhibitor heavy chain-re...    122   5e-28   
ref|XP_008242259.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    122   5e-28   Prunus mume [ume]
ref|XP_006342396.1|  PREDICTED: poly [ADP-ribose] polymerase 4-like     122   6e-28   Solanum tuberosum [potatoes]
ref|XP_011078109.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    120   1e-27   
ref|XP_011078108.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    120   1e-27   
ref|XP_011078107.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    120   1e-27   
ref|XP_011078106.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    120   2e-27   Sesamum indicum [beniseed]
ref|XP_003595328.1|  Inter-alpha-trypsin inhibitor heavy chain H3       118   1e-26   Medicago truncatula
ref|XP_006587053.1|  PREDICTED: uncharacterized protein LOC100820133    117   2e-26   Glycine max [soybeans]
ref|XP_009337232.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    117   2e-26   
ref|XP_010261798.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    117   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_006345262.1|  PREDICTED: uncharacterized protein LOC102582049    117   4e-26   Solanum tuberosum [potatoes]
ref|XP_006426697.1|  hypothetical protein CICLE_v10024980mg             116   7e-26   
ref|XP_007154569.1|  hypothetical protein PHAVU_003G129800g             115   1e-25   Phaseolus vulgaris [French bean]
ref|XP_007138646.1|  hypothetical protein PHAVU_009G226200g             115   2e-25   Phaseolus vulgaris [French bean]
ref|XP_002516254.1|  inter-alpha-trypsin inhibitor heavy chain, p...    115   2e-25   Ricinus communis
ref|XP_004251694.1|  PREDICTED: uncharacterized protein LOC101250962    114   3e-25   Solanum lycopersicum
ref|XP_007138645.1|  hypothetical protein PHAVU_009G226200g             113   4e-25   Phaseolus vulgaris [French bean]
ref|XP_007154568.1|  hypothetical protein PHAVU_003G129800g             113   5e-25   Phaseolus vulgaris [French bean]
gb|KHN17734.1|  von Willebrand factor A domain-containing protein       114   5e-25   Glycine soja [wild soybean]
ref|XP_003551107.1|  PREDICTED: von Willebrand factor A domain-co...    114   5e-25   Glycine max [soybeans]
ref|XP_009624355.1|  PREDICTED: uncharacterized protein LOC104115430    113   6e-25   Nicotiana tomentosiformis
gb|KDP33933.1|  hypothetical protein JCGZ_07504                         113   6e-25   Jatropha curcas
ref|XP_006465891.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    113   6e-25   Citrus sinensis [apfelsine]
gb|KDP40680.1|  hypothetical protein JCGZ_24679                         113   6e-25   Jatropha curcas
gb|KDO64972.1|  hypothetical protein CISIN_1g004469mg                   113   7e-25   Citrus sinensis [apfelsine]
ref|XP_009777936.1|  PREDICTED: uncharacterized protein LOC104227395    113   7e-25   Nicotiana sylvestris
ref|XP_010242255.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    113   8e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010064019.1|  PREDICTED: uncharacterized protein LOC104450974    113   8e-25   Eucalyptus grandis [rose gum]
gb|KHN12291.1|  Inter-alpha-trypsin inhibitor heavy chain H1            112   8e-25   Glycine soja [wild soybean]
ref|XP_002271630.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    112   1e-24   Vitis vinifera
gb|KCW71312.1|  hypothetical protein EUGRSUZ_F04397                     111   2e-24   Eucalyptus grandis [rose gum]
ref|XP_004488095.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    112   2e-24   Cicer arietinum [garbanzo]
ref|XP_009359719.1|  PREDICTED: uncharacterized protein LOC103950254    112   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_008388928.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    112   2e-24   
ref|XP_010654418.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    111   3e-24   Vitis vinifera
ref|XP_004488096.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   3e-24   
ref|XP_006416537.1|  hypothetical protein EUTSA_v10006890mg             111   4e-24   Eutrema salsugineum [saltwater cress]
ref|XP_003542365.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   7e-24   Glycine max [soybeans]
gb|KJB35005.1|  hypothetical protein B456_006G094900                    109   9e-24   Gossypium raimondii
ref|XP_008337841.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    110   1e-23   Malus domestica [apple tree]
gb|KJB35006.1|  hypothetical protein B456_006G094900                    110   1e-23   Gossypium raimondii
ref|XP_008337842.1|  PREDICTED: von Willebrand factor A domain-co...    109   1e-23   
gb|KJB35007.1|  hypothetical protein B456_006G094900                    110   1e-23   Gossypium raimondii
gb|AAF79294.1|AC068602_17  F14D16.26                                    109   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04434.1|  von Willebrand factor A domain-containing               109   2e-23   Gossypium arboreum [tree cotton]
ref|XP_004508009.1|  PREDICTED: uncharacterized protein LOC101514299    109   2e-23   Cicer arietinum [garbanzo]
ref|NP_173345.2|  inter-alpha-trypsin inhibitor heavy chain-like ...    109   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342928.1|  PREDICTED: uncharacterized protein LOC102599336    109   2e-23   Solanum tuberosum [potatoes]
gb|KHN07890.1|  von Willebrand factor A domain-containing protein       108   3e-23   Glycine soja [wild soybean]
gb|EYU25841.1|  hypothetical protein MIMGU_mgv1a001817mg                107   7e-23   Erythranthe guttata [common monkey flower]
ref|XP_010654417.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    107   7e-23   Vitis vinifera
ref|XP_009149386.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    107   7e-23   Brassica rapa
emb|CDY26699.1|  BnaA06g13230D                                          107   7e-23   Brassica napus [oilseed rape]
ref|XP_004235553.1|  PREDICTED: uncharacterized protein LOC101253...    107   7e-23   Solanum lycopersicum
gb|KFK44049.1|  hypothetical protein AALP_AA1G209400                    107   1e-22   Arabis alpina [alpine rockcress]
ref|XP_010273853.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    106   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010666845.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    106   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007024661.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    106   2e-22   
ref|XP_011072601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   2e-22   Sesamum indicum [beniseed]
gb|KJB82977.1|  hypothetical protein B456_013G222900                    105   3e-22   Gossypium raimondii
ref|XP_008342579.1|  PREDICTED: uncharacterized protein LOC103405374    103   3e-22   Malus domestica [apple tree]
gb|KJB65321.1|  hypothetical protein B456_010G089800                    105   3e-22   Gossypium raimondii
emb|CDY41019.1|  BnaC05g14770D                                          105   4e-22   Brassica napus [oilseed rape]
ref|XP_009625881.1|  PREDICTED: von Willebrand factor A domain-co...    105   5e-22   Nicotiana tomentosiformis
ref|XP_004287649.1|  PREDICTED: uncharacterized protein LOC101300180    105   5e-22   Fragaria vesca subsp. vesca
gb|AES92187.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    105   6e-22   Medicago truncatula
ref|XP_002890318.1|  hypothetical protein ARALYDRAFT_472131             105   6e-22   
gb|KJB65318.1|  hypothetical protein B456_010G089800                    105   6e-22   Gossypium raimondii
emb|CDX83787.1|  BnaC08g18580D                                          104   6e-22   
ref|XP_010273855.1|  PREDICTED: uncharacterized protein LOC104609...    104   6e-22   Nelumbo nucifera [Indian lotus]
gb|KJB82978.1|  hypothetical protein B456_013G222900                    104   7e-22   Gossypium raimondii
emb|CDX81914.1|  BnaC08g36870D                                          104   7e-22   
ref|XP_010459567.1|  PREDICTED: uncharacterized protein LOC104740606    104   9e-22   Camelina sativa [gold-of-pleasure]
gb|KJB65322.1|  hypothetical protein B456_010G089800                    104   9e-22   Gossypium raimondii
gb|KEH32426.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    103   9e-22   Medicago truncatula
ref|XP_003608035.1|  von Willebrand factor A domain-containing pr...    103   1e-21   
ref|XP_009344471.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    101   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_007012610.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    103   1e-21   
ref|XP_006385524.1|  hypothetical protein POPTR_0003s06600g             100   2e-21   
ref|XP_010498320.1|  PREDICTED: uncharacterized protein LOC104776024    103   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010537666.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    103   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010537668.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    103   3e-21   Tarenaya hassleriana [spider flower]
ref|XP_011036459.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    102   3e-21   Populus euphratica
ref|XP_006385523.1|  hypothetical protein POPTR_0003s06600g             100   3e-21   
ref|XP_002304123.1|  hypothetical protein POPTR_0003s06600g             102   3e-21   
ref|XP_011036458.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    102   3e-21   Populus euphratica
ref|XP_006385521.1|  hypothetical protein POPTR_0003s06600g             102   3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009625888.1|  PREDICTED: von Willebrand factor A domain-co...    102   3e-21   Nicotiana tomentosiformis
ref|XP_009625883.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    102   3e-21   
gb|KHG11270.1|  von Willebrand factor A domain-containing               102   3e-21   Gossypium arboreum [tree cotton]
emb|CDO97834.1|  unnamed protein product                                102   4e-21   Coffea canephora [robusta coffee]
ref|XP_010318474.1|  PREDICTED: uncharacterized protein LOC101253...    102   4e-21   Solanum lycopersicum
ref|XP_004141711.1|  PREDICTED: uncharacterized protein LOC101206287    102   4e-21   Cucumis sativus [cucumbers]
emb|CDY21682.1|  BnaA09g44330D                                          102   5e-21   Brassica napus [oilseed rape]
ref|XP_009117566.1|  PREDICTED: uncharacterized protein LOC103842665    102   5e-21   Brassica rapa
ref|XP_002532724.1|  inter-alpha-trypsin inhibitor heavy chain, p...    102   6e-21   Ricinus communis
ref|XP_010477113.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    102   6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004303707.1|  PREDICTED: von Willebrand factor A domain-co...  96.7    6e-21   Fragaria vesca subsp. vesca
ref|XP_008373868.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    100   6e-21   Malus domestica [apple tree]
ref|XP_008356516.1|  PREDICTED: von Willebrand factor A domain-co...  99.0    6e-21   
ref|XP_011035743.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    101   9e-21   Populus euphratica
ref|XP_011036460.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    100   1e-20   Populus euphratica
ref|XP_009110301.1|  PREDICTED: uncharacterized protein LOC103835866    101   1e-20   Brassica rapa
ref|XP_006369125.1|  hypothetical protein POPTR_0001s16700g             100   1e-20   
ref|XP_009625882.1|  PREDICTED: von Willebrand factor A domain-co...    100   1e-20   Nicotiana tomentosiformis
gb|KCW71310.1|  hypothetical protein EUGRSUZ_F04397                     100   1e-20   Eucalyptus grandis [rose gum]
ref|XP_011035744.1|  PREDICTED: uncharacterized protein LOC105133...    100   2e-20   Populus euphratica
ref|XP_009764208.1|  PREDICTED: uncharacterized protein LOC104215...    100   2e-20   Nicotiana sylvestris
ref|XP_010318475.1|  PREDICTED: uncharacterized protein LOC101253...  99.8    4e-20   Solanum lycopersicum
ref|XP_004144038.1|  PREDICTED: uncharacterized protein LOC101210279  99.4    4e-20   Cucumis sativus [cucumbers]
ref|XP_008450941.1|  PREDICTED: uncharacterized protein LOC103492379  99.4    5e-20   Cucumis melo [Oriental melon]
ref|XP_007012611.1|  Inter-alpha-trypsin inhibitor heavy chain-re...  99.4    5e-20   
emb|CDX96680.1|  BnaA08g22230D                                        99.0    6e-20   
ref|XP_010537667.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  98.2    1e-19   Tarenaya hassleriana [spider flower]
gb|KJB07329.1|  hypothetical protein B456_001G016000                  96.7    1e-19   Gossypium raimondii
gb|KHG29331.1|  von Willebrand factor A domain-containing             97.8    1e-19   Gossypium arboreum [tree cotton]
ref|XP_010537665.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  97.4    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_008462285.1|  PREDICTED: uncharacterized protein LOC103500...  97.4    2e-19   Cucumis melo [Oriental melon]
ref|XP_008462286.1|  PREDICTED: uncharacterized protein LOC103500...  97.4    2e-19   Cucumis melo [Oriental melon]
gb|KJB07325.1|  hypothetical protein B456_001G016000                  96.3    4e-19   Gossypium raimondii
ref|XP_010685291.1|  PREDICTED: uncharacterized protein LOC104899734  96.7    4e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006390650.1|  hypothetical protein EUTSA_v10018177mg           95.9    7e-19   Eutrema salsugineum [saltwater cress]
gb|KJB07327.1|  hypothetical protein B456_001G016000                  95.9    7e-19   Gossypium raimondii
ref|XP_009764209.1|  PREDICTED: uncharacterized protein LOC104215...  95.5    1e-18   Nicotiana sylvestris
ref|XP_009105911.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  94.4    2e-18   Brassica rapa
ref|XP_010111991.1|  von Willebrand factor A domain-containing pr...  94.0    3e-18   
ref|XP_008228173.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  91.3    3e-18   Prunus mume [ume]
emb|CDX72920.1|  BnaC06g33680D                                        94.0    3e-18   
ref|XP_008462288.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  92.8    5e-18   Cucumis melo [Oriental melon]
ref|XP_003557739.1|  PREDICTED: uncharacterized protein LOC100836064  89.7    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_010531895.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  92.4    1e-17   Tarenaya hassleriana [spider flower]
dbj|BAJ95100.1|  predicted protein                                    92.0    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU21307.1|  hypothetical protein MIMGU_mgv1a001939mg              90.9    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_010273854.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  91.3    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006306812.1|  hypothetical protein CARUB_v10008355mg           91.3    3e-17   
ref|XP_006650182.1|  PREDICTED: uncharacterized protein LOC102717967  90.9    4e-17   Oryza brachyantha
ref|XP_009414822.1|  PREDICTED: uncharacterized protein LOC103995...  90.5    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN39616.1|  Inter-alpha-trypsin inhibitor heavy chain H5          89.7    5e-17   Glycine soja [wild soybean]
ref|XP_010416000.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  90.1    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004984064.1|  PREDICTED: uncharacterized protein LOC101774...  89.4    6e-17   Setaria italica
gb|ABF96527.1|  von Willebrand factor type A domain containing pr...  88.6    6e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010471276.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  90.1    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010428136.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  90.1    7e-17   
gb|EEE59232.1|  hypothetical protein OsJ_11214                        87.8    9e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667805.1|  PREDICTED: hypothetical protein isoform X1       85.9    1e-16   
gb|AAG52586.1|AC016529_17  hypothetical protein; 14673-17893          89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177394.2|  uncharacterized protein                             89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KHN01425.1|  Inter-alpha-trypsin inhibitor heavy chain H3          87.8    2e-16   Glycine soja [wild soybean]
ref|XP_003528576.1|  PREDICTED: uncharacterized protein LOC100807...  87.4    2e-16   Glycine max [soybeans]
ref|NP_001050335.2|  Os03g0407000                                     86.3    2e-16   
ref|XP_004984065.1|  PREDICTED: uncharacterized protein LOC101774...  87.4    2e-16   
ref|XP_002888881.1|  hypothetical protein ARALYDRAFT_476383           88.2    2e-16   Arabidopsis lyrata subsp. lyrata
gb|KFK41669.1|  hypothetical protein AALP_AA2G157400                  87.8    4e-16   Arabis alpina [alpine rockcress]
ref|XP_002465153.1|  hypothetical protein SORBIDRAFT_01g032840        85.9    6e-16   Sorghum bicolor [broomcorn]
gb|ABF96528.1|  von Willebrand factor type A domain containing pr...  86.3    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KJB07323.1|  hypothetical protein B456_001G016000                  86.7    7e-16   Gossypium raimondii
ref|XP_009404352.1|  PREDICTED: uncharacterized protein LOC103987694  87.0    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782726.1|  PREDICTED: LOW QUALITY PROTEIN: inter alpha-...  86.3    1e-15   
ref|NP_001141509.1|  hypothetical protein                             84.3    1e-15   
ref|XP_006598837.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  85.5    2e-15   Glycine max [soybeans]
gb|AET01809.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...  83.2    5e-15   Medicago truncatula
ref|XP_004958289.1|  PREDICTED: uncharacterized protein LOC101756562  83.6    1e-14   
ref|XP_002461009.1|  hypothetical protein SORBIDRAFT_02g039160        80.9    1e-14   Sorghum bicolor [broomcorn]
ref|XP_007135423.1|  hypothetical protein PHAVU_010G128200g           80.9    1e-14   Phaseolus vulgaris [French bean]
ref|XP_010235662.1|  PREDICTED: uncharacterized protein LOC100843408  80.5    1e-14   Brachypodium distachyon [annual false brome]
gb|EEE67586.1|  hypothetical protein OsJ_25118                        82.8    2e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC80088.1|  unknown protein                                      80.5    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658810.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  79.3    2e-14   
gb|EEC82439.1|  hypothetical protein OsI_26857                        82.8    2e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001060262.2|  Os07g0614300                                     80.1    3e-14   
ref|XP_006301970.1|  hypothetical protein CARUB_v10022450mg           82.0    3e-14   Capsella rubella
ref|XP_009389548.1|  PREDICTED: uncharacterized protein LOC103976087  81.6    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003627335.1|  hypothetical protein MTR_8g021260                79.0    4e-14   
ref|XP_006583165.1|  PREDICTED: uncharacterized protein LOC100807...  78.6    9e-14   Glycine max [soybeans]
gb|KEH18484.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  79.0    3e-13   Medicago truncatula
ref|XP_010937323.1|  PREDICTED: inter alpha-trypsin inhibitor, he...  78.2    5e-13   Elaeis guineensis
tpg|DAA63586.1|  TPA: hypothetical protein ZEAMMB73_270893            75.5    4e-12   
ref|XP_008653341.1|  PREDICTED: von Willebrand factor A domain-co...  73.6    8e-12   
ref|XP_006836596.1|  hypothetical protein AMTR_s00131p00098870        73.2    2e-11   Amborella trichopoda
dbj|BAK07105.1|  predicted protein                                    72.0    3e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB83726.1|  hypothetical protein B456_013G261400                  70.5    9e-11   Gossypium raimondii
ref|XP_010537629.1|  PREDICTED: uncharacterized protein LOC104812256  70.1    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_004510514.1|  PREDICTED: uncharacterized protein LOC101499440  70.5    1e-10   Cicer arietinum [garbanzo]
tpg|DAA41434.1|  TPA: hypothetical protein ZEAMMB73_769800            64.7    2e-10   
tpg|DAA41433.1|  TPA: hypothetical protein ZEAMMB73_769800            64.7    3e-10   
gb|AAU89244.1|  von Willebrand factor type A domain containing pr...  65.5    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KJB65319.1|  hypothetical protein B456_010G089800                  69.3    3e-10   Gossypium raimondii
gb|EMT10977.1|  hypothetical protein F775_14225                       68.9    4e-10   
ref|XP_010318476.1|  PREDICTED: von Willebrand factor A domain-co...  67.0    2e-09   Solanum lycopersicum
gb|ABF96529.1|  von Willebrand factor type A domain containing pr...  66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135424.1|  hypothetical protein PHAVU_010G128200g           63.9    2e-08   Phaseolus vulgaris [French bean]
ref|XP_003609990.1|  von Willebrand factor A domain-containing pr...  63.9    2e-08   
gb|KHN06057.1|  hypothetical protein glysoja_035963                   59.7    8e-08   Glycine soja [wild soybean]
ref|XP_006385522.1|  hypothetical protein POPTR_0003s06600g           61.6    1e-07   
ref|XP_007216978.1|  hypothetical protein PRUPE_ppa002885mg           60.8    2e-07   
gb|EPS65940.1|  hypothetical protein M569_08838                       57.4    3e-06   Genlisea aurea
gb|KDO73865.1|  hypothetical protein CISIN_1g004349mg                 57.0    4e-06   Citrus sinensis [apfelsine]
gb|KEH18485.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  57.0    4e-06   Medicago truncatula
gb|KEH18487.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...  56.6    5e-06   Medicago truncatula
ref|XP_006452826.1|  hypothetical protein CICLE_v10007546mg           55.8    1e-05   
gb|ETO27230.1|  hypothetical protein RFI_09901                        52.4    4e-05   Reticulomyxa filosa
gb|ETO32114.1|  hypothetical protein RFI_05003                        53.1    6e-05   Reticulomyxa filosa
gb|ABF96530.1|  von Willebrand factor type A domain containing pr...  52.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477112.1|  PREDICTED: uncharacterized protein LOC104756252  49.7    2e-04   Camelina sativa [gold-of-pleasure]
gb|KJB07324.1|  hypothetical protein B456_001G016000                  50.8    4e-04   Gossypium raimondii
ref|XP_010462785.1|  PREDICTED: uncharacterized protein LOC104743395  50.4    4e-04   
gb|EMT04548.1|  hypothetical protein F775_32683                       50.8    5e-04   



>ref|XP_011093846.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Sesamum indicum]
Length=756

 Score =   137 bits (344),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 98/135 (73%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  EAKE+ + K++ K QIE LTA+AW+T+N++L+EKIA+ SVQ+ I+SEYTNM  + T
Sbjct  568  LKVHEAKEMPIDKIVVKHQIEQLTAQAWYTENQELKEKIAKMSVQNAIISEYTNMVLLET  627

Query  516  EETKGTTEPSKVNKKTG--------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  367
            ++ K   + + V K +G        DPK QK IIML N+G+GFG+LTATAEN PPGS  T
Sbjct  628  DKGKINADSAVVKKVSGKGDHHKAEDPKPQK-IIMLPNMGIGFGNLTATAENIPPGSSYT  686

Query  366  SKPEAAEMFVQAASN  322
              P+AAE+F +AAS+
Sbjct  687  RPPDAAEVFAKAASD  701



>ref|XP_011093845.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Sesamum indicum]
Length=758

 Score =   135 bits (339),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 72/137 (53%), Positives = 97/137 (71%), Gaps = 13/137 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  EAKE+ + K++ K QIE LTA+AW+T+N++L+EKIA+ SVQ+ I+SEYTNM  + T
Sbjct  568  LKVHEAKEMPIDKIVVKHQIEQLTAQAWYTENQELKEKIAKMSVQNAIISEYTNMVLLET  627

Query  516  EETKGTTEPSKVNK----------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-  370
            ++ K   + + V K          K  DPK QK IIML N+G+GFG+LTATAEN PPGS 
Sbjct  628  DKGKINADSAVVKKLQVSGKGDHHKAEDPKPQK-IIMLPNMGIGFGNLTATAENIPPGSS  686

Query  369  -TSKPEAAEMFVQAASN  322
             T  P+AAE+F +AAS+
Sbjct  687  YTRPPDAAEVFAKAASD  703



>ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Vitis 
vinifera]
 emb|CBI27786.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   133 bits (335),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 73/136 (54%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AKEI L +VLAKQQI  LTA+AWF++NK+LEEKIA  S+Q G++SEYT M  + T
Sbjct  567  LKVQKAKEIPLDRVLAKQQIGWLTAQAWFSENKQLEEKIAEMSIQTGVISEYTRMILLET  626

Query  516  EETKGTTEPSKV---------NKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--  370
            +     +EP +V          +   D K+QK II+L++LG+GFG++ ATAEN PPGS  
Sbjct  627  QGGAQVSEPGRVQEPPKTMEYQRPVVDSKVQK-IILLQSLGVGFGNVNATAENYPPGSEE  685

Query  369  TSKPEAAEMFVQAASN  322
               PEAAE+FV+AASN
Sbjct  686  VKLPEAAEIFVKAASN  701



>ref|XP_009597215.1| PREDICTED: uncharacterized protein LOC104093199 [Nicotiana tomentosiformis]
Length=753

 Score =   133 bits (334),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKA +AK+I L KVLA+QQ+E+LTA+AW T+NK LE+KIA+ S+QH ++SEYT M  + T
Sbjct  569  LKAVQAKDIPLDKVLARQQVELLTAQAWLTENKDLEQKIAQTSIQHAVISEYTRMILMET  628

Query  516  EETKGTTEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKP  358
            +  K  TE       S   KK  +PKL+K  I+L+NL +GFG+ +AT EN PPG S +KP
Sbjct  629  DRGKVVTESTSKRKVSTAAKKIEEPKLEKK-ILLQNLAVGFGNYSATVENIPPGASETKP  687

Query  357  EAAEMFVQAASN  322
            E AE+  +AASN
Sbjct  688  ETAEILAKAASN  699



>gb|KDO73864.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=759

 Score =   131 bits (330),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 68/134 (51%), Positives = 92/134 (69%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK+I L ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T
Sbjct  570  LKLQLAKDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQTGVLCEYTRMIIVET  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--S  364
            +E    +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS    
Sbjct  630  DERNNASESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPK  689

Query  363  KPEAAEMFVQAASN  322
             PE AE+FV+AASN
Sbjct  690  LPEVAEIFVKAASN  703



>emb|CDP03063.1| unnamed protein product [Coffea canephora]
Length=748

 Score =   131 bits (329),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L KV AKQ+IE+LTAEAWF +NK+LE KIA+ S+Q+ ++SE+T++  + T
Sbjct  568  LKVHHAKDIPLHKVQAKQEIELLTAEAWFAENKELETKIAKLSLQNSVISEFTHLLLLET  627

Query  516  EETKGTTEPSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAE  346
            +       P KV+ ++  DPK QK II+ RNLG+GFG+LTATA+N PPGS  T   EAAE
Sbjct  628  DMVNKKQVPKKVDPQRAEDPKAQK-IIVKRNLGVGFGNLTATADNIPPGSDETKHLEAAE  686

Query  345  MFVQAASN  322
            + V+AASN
Sbjct  687  IIVKAASN  694



>ref|XP_006474710.1| PREDICTED: uncharacterized protein LOC102609180 [Citrus sinensis]
Length=759

 Score =   130 bits (328),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 68/134 (51%), Positives = 92/134 (69%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK+I L ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T
Sbjct  570  LKLQLAKDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQIGVLCEYTRMIIVET  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--S  364
            +E    +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS    
Sbjct  630  DERNNASESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPK  689

Query  363  KPEAAEMFVQAASN  322
             PE AE+FV+AASN
Sbjct  690  LPEVAEIFVKAASN  703



>ref|XP_006452827.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66067.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=758

 Score =   130 bits (327),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 92/134 (69%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK++ L ++ AKQQI++LTA+AWF+++K+LEEK+++ SVQ G++ EYT M  + T
Sbjct  570  LKLQLAKDLPLDRICAKQQIDLLTAQAWFSEDKRLEEKVSKMSVQTGVLCEYTRMIIVET  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGST--S  364
            +E    +E     K +     QK +       IML+NLG+GFGDLTATAEN PPGS    
Sbjct  630  DERNNASESPGTKKGSKKSDHQKILDSEVPKTIMLQNLGIGFGDLTATAENFPPGSEIPK  689

Query  363  KPEAAEMFVQAASN  322
             PE AE+FV+AASN
Sbjct  690  LPEVAEIFVKAASN  703



>ref|XP_009796968.1| PREDICTED: uncharacterized protein LOC104243478 [Nicotiana sylvestris]
Length=753

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKA ++K+I L KVLA+QQ+E++TA+AW T+NK LE+KIA+ S+QH ++SEYT M  + T
Sbjct  569  LKAVQSKDIPLDKVLARQQVELITAQAWLTENKDLEQKIAQTSIQHAVISEYTRMILMET  628

Query  516  EETKGTTEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKP  358
            +  K  TE       S   K   +PKL+K  I+L NL +GFG+ +AT EN PPG S +KP
Sbjct  629  DRGKVVTESTSKRKVSTAAKNIEEPKLEKK-ILLENLAVGFGNYSATVENIPPGASETKP  687

Query  357  EAAEMFVQAASN  322
            E AE+  +AASN
Sbjct  688  ETAEILAKAASN  699



>ref|XP_010047465.1| PREDICTED: uncharacterized protein LOC104436401 [Eucalyptus grandis]
 gb|KCW79379.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=755

 Score =   125 bits (314),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 6/130 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L ++ AKQQI+  TA+AWF+++K+LEEK+A+ S+Q GI SE+T M  I  
Sbjct  573  LKILRAKDILLDRLFAKQQIDHFTAKAWFSEDKQLEEKVAKLSIQSGIASEFTRMILIEA  632

Query  516  EETKGTTEPS---KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEA  352
            +E    TE +   K  +K  DPK+ K  IMLR+L +GFG+LTAT EN PPG+     PEA
Sbjct  633  DEATKATESAGSDKAPRKMPDPKVYKQ-IMLRSLCIGFGNLTATIENIPPGAEQVKLPEA  691

Query  351  AEMFVQAASN  322
            AE+ V+AASN
Sbjct  692  AEILVKAASN  701



>ref|XP_011007767.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Populus 
euphratica]
Length=756

 Score =   125 bits (313),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 68/134 (51%), Positives = 94/134 (70%), Gaps = 10/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L  V AKQQI++LTA+AWF++NK+LEEK+A+ S+Q G++SEYT M+ + T
Sbjct  568  LKVQQAKDIPLHSVSAKQQIDLLTAQAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLET  627

Query  516  -------EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
                   E   G   P +VN +  D + ++  I LRNLG+GFG+LTATAEN  PG+    
Sbjct  628  DRGNQAAESPGGRKLPRQVNPQKVDFQGRRR-IFLRNLGVGFGNLTATAENLRPGAEESK  686

Query  360  -PEAAEMFVQAASN  322
             PEAAE+ ++AASN
Sbjct  687  LPEAAEIIIKAASN  700



>ref|XP_007204639.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
 gb|EMJ05838.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
Length=753

 Score =   124 bits (310),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +G 
Sbjct  571  LKLQDAKDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIILGK  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAEM  343
            E++     P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+
Sbjct  631  EQSGPQEVPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENIPPGSEEPKQPEAAEI  689

Query  342  FVQAASN  322
            F +AASN
Sbjct  690  FARAASN  696



>ref|XP_008242260.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Prunus mume]
Length=592

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 87/127 (69%), Gaps = 3/127 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +  
Sbjct  410  LKLQDAKDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIIVDK  469

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  343
            E++     P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+
Sbjct  470  EQSGPQEAPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENVPPGSEEPKQPEAAEI  528

Query  342  FVQAASN  322
            F +AASN
Sbjct  529  FARAASN  535



>ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
 gb|EEF03294.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
Length=752

 Score =   122 bits (307),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L  V AKQQI++LTA+AWF++NK+LEEK+A+ S+Q G++SEYT M+ + T
Sbjct  568  LKVQKAKDIPLHSVSAKQQIDLLTAQAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLET  627

Query  516  EETKGTTEPSKVNKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  352
            +      E    +K   + K+    +  I LRNLG+GFG+LTATAEN  PG+     PEA
Sbjct  628  DRGNQAAESPGGHKVCANLKVDSQGRRRIFLRNLGVGFGNLTATAENLRPGAEESKLPEA  687

Query  351  AEMFVQAASN  322
            AE+ ++AASN
Sbjct  688  AEIIIKAASN  697



>ref|XP_008242259.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Prunus mume]
Length=753

 Score =   122 bits (306),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 87/127 (69%), Gaps = 3/127 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L +V AK QIE+LTA+AW   NK+LE+K+A+ S+Q  +VSEYT M  +  
Sbjct  571  LKLQDAKDIPLDRVCAKGQIELLTAQAWLADNKQLEDKVAKLSIQSHVVSEYTRMIIVDK  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS--KPEAAEM  343
            E++     P K   K  D + Q+  I+L +L +GFG+L AT+EN PPGS    +PEAAE+
Sbjct  631  EQSGPQEAPKKSRIKMKDSESQRP-ILLPSLSIGFGNLVATSENVPPGSEEPKQPEAAEI  689

Query  342  FVQAASN  322
            F +AASN
Sbjct  690  FARAASN  696



>ref|XP_006342396.1| PREDICTED: poly [ADP-ribose] polymerase 4-like [Solanum tuberosum]
Length=752

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKA + K+I L KVLA+QQIE+LTA+AW T NK LE+KIA+ S+Q+G++SEYT M  I T
Sbjct  568  LKAIQTKDIPLDKVLARQQIELLTAQAWLTDNKDLEQKIAQTSIQNGVISEYTRMILIET  627

Query  516  EETKGTTEP------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-KP  358
            ++ K  TE       S   KK  + KLQK   +L+NLG GFG+ +AT EN  PG T  KP
Sbjct  628  DKGKVITESTSKRKVSTAPKKIEEAKLQKK-TLLQNLGAGFGNYSATIENISPGITEKKP  686

Query  357  EAAEMFVQAASN  322
            E AE+  +AASN
Sbjct  687  ETAEILAKAASN  698



>ref|XP_011078109.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
isoform X4 [Sesamum indicum]
Length=613

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 11/134 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  QEAK+I + K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + T
Sbjct  427  LSVQEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLET  486

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            E  K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++ 
Sbjct  487  ERMKITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAP  545

Query  363  -KPEAAEMFVQAAS  325
              PEA + +++ AS
Sbjct  546  KPPEAGDAYIKGAS  559



>ref|XP_011078108.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Sesamum indicum]
Length=641

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 11/134 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  QEAK+I + K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + T
Sbjct  455  LSVQEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLET  514

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            E  K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++ 
Sbjct  515  ERMKITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAP  573

Query  363  -KPEAAEMFVQAAS  325
              PEA + +++ AS
Sbjct  574  KPPEAGDAYIKGAS  587



>ref|XP_011078107.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Sesamum indicum]
Length=664

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 11/134 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  QEAK+I + K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + T
Sbjct  478  LSVQEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLET  537

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            E  K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++ 
Sbjct  538  ERMKITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAP  596

Query  363  -KPEAAEMFVQAAS  325
              PEA + +++ AS
Sbjct  597  KPPEAGDAYIKGAS  610



>ref|XP_011078106.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Sesamum indicum]
Length=764

 Score =   120 bits (302),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 11/134 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  QEAK+I + K+LAKQ+IE+LTAEAW++  K+L+EKIA  S+++ I+SEYTN+  + T
Sbjct  578  LSVQEAKDIPIGKMLAKQEIELLTAEAWYSDRKELKEKIANMSIEYSIISEYTNVVLLET  637

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            E  K T +P       SKVN  KT +P  +K I++LRN GLGFG+LTAT EN  PG ++ 
Sbjct  638  ERMKITADPAAGRRASSKVNDVKTEEPTPRK-ILVLRNNGLGFGNLTATEENIVPGFSAP  696

Query  363  -KPEAAEMFVQAAS  325
              PEA + +++ AS
Sbjct  697  KPPEAGDAYIKGAS  710



>ref|XP_003595328.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Medicago truncatula]
 gb|AES65579.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=751

 Score =   118 bits (296),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 90/129 (70%), Gaps = 4/129 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK++ L +V A++QIE LTA+AW T NK+LE KIA+ S+Q G +SEYT M+ +  
Sbjct  569  LKIQNAKDMPLERVFAREQIEYLTAQAWLTNNKQLEHKIAKLSLQTGFLSEYTRMSVLEV  628

Query  516  E--ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAA  349
            +  +T   ++ +K +KK G+    +  ++L  LG+GFG+L ATAENTPPG    S  ++A
Sbjct  629  DHLKTAKQSDGTKASKKKGEKDQGQRTLLLPKLGIGFGNLAATAENTPPGGDEPSLNDSA  688

Query  348  EMFVQAASN  322
            EMFV+AA++
Sbjct  689  EMFVKAATH  697



>ref|XP_006587053.1| PREDICTED: uncharacterized protein LOC100820133 [Glycine max]
Length=759

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 89/133 (67%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LK QEAK I + ++ A+ QIE LTA+AW +K++KLE+ +A+ S+Q G  SEYT+M  +  
Sbjct  572  LKIQEAKGIPVQRICARDQIEYLTAQAWLSKDEKLEQMVAKLSLQTGFTSEYTSMTILEI  631

Query  522  ----GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  361
                  +E+ G     K N ++G  + ++ +I+L  LG+GFG+LTATAEN  PGS  T  
Sbjct  632  DLRKKAKESDGKKVSKKSNPQSGAKEQEQRVILLPPLGIGFGNLTATAENIQPGSEETKG  691

Query  360  PEAAEMFVQAASN  322
            P+ AE+FV+AA+N
Sbjct  692  PDGAEIFVKAATN  704



>ref|XP_009337232.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Pyrus 
x bretschneideri]
Length=757

 Score =   117 bits (294),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L K+  K QIE+LTA+AW+  NK+LE+K+A+ S+Q  +VSEYT M  + T
Sbjct  574  LKLQDAKDIPLDKICTKGQIELLTAQAWYGDNKQLEDKVAKLSMQTNVVSEYTRMVILHT  633

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  343
             E  G+ E SK   +T   +  + +++L  L +GFG+L ATAEN PPGS  +  PEAAE+
Sbjct  634  -ELSGSQEASK-KSRTNITRDSEKLMLLPTLSVGFGNLVATAENIPPGSEEQKLPEAAEI  691

Query  342  FVQAASN  322
            FV+AAS+
Sbjct  692  FVRAASS  698



>ref|XP_010261798.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=753

 Score =   117 bits (292),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK+I L KV AK+ I++LTA+AW ++NK LEEK+A+ S+Q G+ SEYT+M  + T
Sbjct  567  LKVQNAKDIPLDKVFAKRHIDLLTAQAWLSENKTLEEKVAKMSLQTGVPSEYTHMILLQT  626

Query  516  EETKGTTEPSKVNKKTGDPKLQK-------AIIMLRNLGLGFGDLTATAENTPPGSTS--  364
            ++ K T EP K  ++ G+  L K        I  L +LG  FG+LTAT EN PPGS    
Sbjct  627  DKVKQTPEPIKTREELGEIDLAKLVDSKGCKIYSLPSLGTSFGNLTATQENIPPGSGEAY  686

Query  363  KPEAAEMFVQAAS  325
              E+AE FV+A S
Sbjct  687  SLESAETFVKATS  699



>ref|XP_006345262.1| PREDICTED: uncharacterized protein LOC102582049 [Solanum tuberosum]
Length=754

 Score =   117 bits (292),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  ++K I L K   KQQIEILTA+AWFT+NK LE+KIA+ S+Q  ++SEYT MA + T
Sbjct  570  LKGFKSKAIPLDKARVKQQIEILTAQAWFTQNKDLEQKIAKMSIQDAVISEYTRMALVET  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTS-KPEA  352
            E+ K     +K    + D K+++ +    I+L  LG GFG+LTAT EN PPG+   + EA
Sbjct  630  EKVKIIKPTTKRKVHSDDEKIEERLVQKTILLHYLGFGFGNLTATIENIPPGAIDIEDEA  689

Query  351  AEMFVQAASN  322
            AE+  +A SN
Sbjct  690  AEIIAKATSN  699



>ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
 gb|ESR39937.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
Length=742

 Score =   116 bits (290),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ AK+I L ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M    +
Sbjct  568  LKAQNAKDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPS  627

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSKPEAAEM  343
                 T+EP  + ++  D   QK  I+L +LG+GFG+L ATAEN PPG+  T   +A EM
Sbjct  628  GSK--TSEPVFLKERV-DSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKSSDATEM  683

Query  342  FVQAAS  325
             V AAS
Sbjct  684  LVNAAS  689



>ref|XP_007154569.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26563.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=753

 Score =   115 bits (288),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 62/132 (47%), Positives = 89/132 (67%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK++ + +V A+ QI  LTA+AWF +NK+LE+K+A+ S+Q G +SEYT M  + T
Sbjct  568  MKIQNAKDMPVQRVSARDQIHHLTAQAWFLENKQLEQKVAKLSLQTGFISEYTRMVLLET  627

Query  516  E------ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  358
            +      E+ GT    K N +   P   + +I+L +LG+GFG+LTATAENTPPG  SK P
Sbjct  628  DHIKKVKESAGTKASEKSNGQFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGYESKLP  687

Query  357  EAAEMFVQAASN  322
            E  E+F +AA+N
Sbjct  688  EVPEIF-KAATN  698



>ref|XP_007138646.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10640.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=761

 Score =   115 bits (288),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 57/134 (43%), Positives = 94/134 (70%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            +K QEAK+I + ++ A+ QIE LTA+AW +K+++LE+++A+ S+Q G +SEYT+MA++  
Sbjct  572  MKIQEAKDIPIQRICARDQIEYLTAQAWLSKDERLEQQVAKLSLQTGFISEYTSMAYLEN  631

Query  522  ----GTEETKGTTEPS-KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
                  +E+ G  E S K ++KTG  +  + + +L +LG+GFG+L ATAEN  PGS    
Sbjct  632  DHRKNVKESDGKKEVSKKSHQKTGAKEQGQQMFLLPHLGIGFGNLIATAENIQPGSQEAK  691

Query  360  -PEAAEMFVQAASN  322
             P+ A++F++AA+N
Sbjct  692  GPDGADIFIKAATN  705



>ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF46256.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=755

 Score =   115 bits (288),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K++   K+ AKQQI++LTA+AW+++NK+LEEK+A+ S+Q G+ SEYT +  +  
Sbjct  568  LKIQKTKDVPFDKIFAKQQIDLLTAQAWYSENKQLEEKVAKMSIQTGVASEYTRLTLLEM  627

Query  516  EETKGTTEPSKVNK---KTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPG--STSK  361
            E      E  + +K   KT   K+    +  I+L+N G+GFG+L ATA+N PPG      
Sbjct  628  ERGNQAIESPRAHKFSNKTDSLKVDYKGRRRILLQNFGVGFGNLAATADNIPPGVEELKL  687

Query  360  PEAAEMFVQAASN  322
            PEAAE+ ++AASN
Sbjct  688  PEAAELIMKAASN  700



>ref|XP_004251694.1| PREDICTED: uncharacterized protein LOC101250962 [Solanum lycopersicum]
Length=753

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  ++K I L K   KQQIEILTA+AWFT+NK LE+KIA+ S+Q  ++SEYT MA +  
Sbjct  570  LKGFKSKAIPLDKARVKQQIEILTAQAWFTQNKDLEKKIAKMSIQDAVISEYTRMALVEA  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSKPEAA  349
            E+ K     +K      D K+++ +    I+L+  G GFG+LTAT EN PPG+  K + A
Sbjct  630  EKVKIIKSTTKRKVHCDDEKIEERLIQKTILLQYPGFGFGNLTATIENIPPGAIDKEDEA  689

Query  348  EMFVQAASN  322
            E+  +A SN
Sbjct  690  EIIAKATSN  698



>ref|XP_007138645.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10639.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=600

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 91/134 (68%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K QEAK+I + ++ A+ QIE LTA+AW +K+++LE+++A+ S+Q G +SEYT+MA++  
Sbjct  411  MKIQEAKDIPIQRICARDQIEYLTAQAWLSKDERLEQQVAKLSLQTGFISEYTSMAYLEN  470

Query  516  EETKGTTEPS-------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TS  364
            +  K   E         K ++KTG  +  + + +L +LG+GFG+L ATAEN  PGS    
Sbjct  471  DHRKNVKESDGKKEVSKKSHQKTGAKEQGQQMFLLPHLGIGFGNLIATAENIQPGSQEAK  530

Query  363  KPEAAEMFVQAASN  322
             P+ A++F++AA+N
Sbjct  531  GPDGADIFIKAATN  544



>ref|XP_007154568.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26562.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=602

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 89/132 (67%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK++ + +V A+ QI  LTA+AWF +NK+LE+K+A+ S+Q G +SEYT M  + T
Sbjct  417  MKIQNAKDMPVQRVSARDQIHHLTAQAWFLENKQLEQKVAKLSLQTGFISEYTRMVLLET  476

Query  516  E------ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  358
            +      E+ GT    K N +   P   + +I+L +LG+GFG+LTATAENTPPG  SK P
Sbjct  477  DHIKKVKESAGTKASEKSNGQFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGYESKLP  536

Query  357  EAAEMFVQAASN  322
            E  E+F +AA+N
Sbjct  537  EVPEIF-KAATN  547



>gb|KHN17734.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=754

 Score =   114 bits (284),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK+I + K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G +SEYT M  + T
Sbjct  568  MKIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFMSEYTRMIILET  627

Query  516  E------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
            +      E+ GT E SK +    +  +Q + +I+L +LG+GFG+LTATAENTPPG  SK 
Sbjct  628  DHLKKVKESAGTKEASKKSHPQYEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKF  687

Query  360  PEAAEMFVQAASN  322
            PE  E+F +AA+N
Sbjct  688  PEVPEIF-KAATN  699



>ref|XP_003551107.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Glycine max]
Length=754

 Score =   114 bits (284),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK+I + K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G +SEYT M  + T
Sbjct  568  MKIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFMSEYTRMIILET  627

Query  516  E------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
            +      E+ GT E SK +    +  +Q + +I+L +LG+GFG+LTATAENTPPG  SK 
Sbjct  628  DHLKKVKESAGTKEASKKSHPQYEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKF  687

Query  360  PEAAEMFVQAASN  322
            PE  E+F +AA+N
Sbjct  688  PEVPEIF-KAATN  699



>ref|XP_009624355.1| PREDICTED: uncharacterized protein LOC104115430 [Nicotiana tomentosiformis]
Length=757

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 87/130 (67%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  ++K+I L K++ KQQ++ILTA+AWFT+NK L +KIA+ S Q+ +VSEY  MA + T
Sbjct  573  LKGIKSKDIPLDKIMVKQQVDILTAQAWFTENKDLAQKIAKMSAQNAVVSEYARMALVST  632

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGST-SKPEA  352
            E  +     +K    +   K+++ I    I+L  LG+GFG+LTAT EN PPG+  ++ EA
Sbjct  633  ERVRVIKPTTKRKVHSDAEKIEERIVEKAILLHYLGIGFGNLTATIENIPPGAIETEDEA  692

Query  351  AEMFVQAASN  322
            AE+  +A SN
Sbjct  693  AEIIAKATSN  702



>gb|KDP33933.1| hypothetical protein JCGZ_07504 [Jatropha curcas]
Length=756

 Score =   113 bits (283),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 60/134 (45%), Positives = 89/134 (66%), Gaps = 10/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  + K++   ++ AKQQI++LTA+AWF++NK+LEEK+ + S+Q G+ SEYT +  + T
Sbjct  568  LKIHKEKDMPFERIFAKQQIDLLTAQAWFSENKRLEEKVVKMSIQTGVFSEYTRLTLLET  627

Query  516  EE-TKGTTEPS------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STS  364
            +   + T  PS      K +    D + +K  I+L+NLG+GFG+L ATAEN PPG     
Sbjct  628  QRGNQATDSPSTRTLLHKGDSSKVDSQGRKR-ILLQNLGVGFGNLAATAENIPPGIEEPK  686

Query  363  KPEAAEMFVQAASN  322
             PEAAE+ ++AASN
Sbjct  687  LPEAAEIIIKAASN  700



>ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Citrus sinensis]
Length=751

 Score =   113 bits (283),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 9/132 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LKAQ AK+I L ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M     
Sbjct  568  LKAQNAKDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPS  627

Query  522  GTEETKGTTEPSKVNK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  361
            G++ ++       +NK    K  D   QK  I+L +LG+GFG+L ATAEN PPG+  T  
Sbjct  628  GSKTSEPVFLKELLNKVDLLKRVDSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKS  686

Query  360  PEAAEMFVQAAS  325
             +A EM V AAS
Sbjct  687  SDATEMLVNAAS  698



>gb|KDP40680.1| hypothetical protein JCGZ_24679 [Jatropha curcas]
Length=750

 Score =   113 bits (283),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK+Q+AK++ L +VLA++QI+ILTA AW ++++ LE++IA+ S+Q G+ SEYT+M    T
Sbjct  565  LKSQKAKDVQLDRVLARRQIDILTANAWMSESQDLEQQIAKMSIQTGVPSEYTHMILHQT  624

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  367
            +  +  TE        +K+N  +  + ++QK +I L NLG+GFGDL ATA N PPG+   
Sbjct  625  DTGEKATEKILMQEVFNKINSLRQVNSEIQK-VIFLGNLGVGFGDLAATASNIPPGTDEI  683

Query  366  SKPEAAEMFVQAASN  322
              PEA E+ V AASN
Sbjct  684  KSPEATEVLVDAASN  698



>gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=751

 Score =   113 bits (283),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 9/132 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LKAQ AK+I L ++LA++QIEILTA+AWF+++K+LEEK+A+ S+Q G+ SEYT M     
Sbjct  568  LKAQNAKDIPLDRLLARRQIEILTAQAWFSESKELEEKVAKMSIQTGVPSEYTCMILFPS  627

Query  522  GTEETKGTTEPSKVNK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  361
            G++ ++       +NK    K  D   QK  I+L +LG+GFG+L ATAEN PPG+  T  
Sbjct  628  GSKTSEPVFLKELLNKVDLLKRVDSTSQKN-ILLGSLGVGFGNLKATAENVPPGTEETKS  686

Query  360  PEAAEMFVQAAS  325
             +A EM V AAS
Sbjct  687  SDATEMLVNAAS  698



>ref|XP_009777936.1| PREDICTED: uncharacterized protein LOC104227395 [Nicotiana sylvestris]
Length=757

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  E+K+I L K++ KQQ+EILTA+AWFT+NK L +KIA+ S Q+ ++SEY  M  + T
Sbjct  573  LKGIESKDIPLDKIMVKQQVEILTAQAWFTENKDLAQKIAKMSAQNAVISEYARMTLVST  632

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGST-SKPEA  352
            E  +     +K    +   K+++ I    I+L  LG+GFG++TAT EN PPG+  S+ EA
Sbjct  633  ERVRVVKPTTKRKVHSDAEKIEERIVETTILLLYLGIGFGNITATIENIPPGAIESEDEA  692

Query  351  AEMFVQAASN  322
            AE+  +A SN
Sbjct  693  AEIIAKATSN  702



>ref|XP_010242255.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=750

 Score =   113 bits (282),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 65/133 (49%), Positives = 87/133 (65%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK I L KV AKQQI +LTA+AWF+++K LE+K+A+ S+Q GI SEYT M  + T
Sbjct  567  LKVQKAKGIPLDKVFAKQQIGMLTAQAWFSESKPLEDKVAKMSLQTGIPSEYTCMVLLQT  626

Query  516  EETKGTTEP---SKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTPPGSTS-K  361
            E  K T+EP    +V  K    KL  +    I +L + G+GFG+L ATA+N PPGS    
Sbjct  627  ERGKHTSEPLGTGEVWYKIDLAKLMASKDCKINLLPSFGIGFGNLAATADNIPPGSAEVS  686

Query  360  PEAAEMFVQAASN  322
             E  ++ V+AASN
Sbjct  687  LEPVDILVKAASN  699



>ref|XP_010064019.1| PREDICTED: uncharacterized protein LOC104450974 [Eucalyptus grandis]
 gb|KCW71311.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=751

 Score =   113 bits (282),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K++ + ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T
Sbjct  566  LKVQHVKDVPIDRLLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLET  625

Query  516  EETKGTTE-----PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  358
               K T++     P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  
Sbjct  626  VREKITSDVTLEVPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTS  684

Query  357  EAAEMFVQAASN  322
            +AA + V+AASN
Sbjct  685  DAANVLVKAASN  696



>gb|KHN12291.1| Inter-alpha-trypsin inhibitor heavy chain H1, partial [Glycine 
soja]
Length=640

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 89/133 (67%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK QEAK I + ++ A+ QIE LTA+AW +K++KLE+ +A+ S+Q G  SEYT+M  +  
Sbjct  453  LKIQEAKGIPVQRICARDQIEYLTAQAWLSKDEKLEQMVAKLSLQTGFTSEYTSMTILEI  512

Query  516  E------ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  361
            +      E+ G     K N ++G  + ++ +I+L  LG+GFG+LTATAEN  PGS  T  
Sbjct  513  DLRKKAKESDGKKVSKKSNPQSGAKEQEQRVILLPPLGIGFGNLTATAENIQPGSEETKG  572

Query  360  PEAAEMFVQAASN  322
            P+ AE+FV+AA+N
Sbjct  573  PDGAEIFVKAATN  585



>ref|XP_002271630.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Vitis vinifera]
 emb|CBI35850.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   112 bits (281),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AKEI L +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T
Sbjct  569  LKIQKAKEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVT  628

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEM  343
            ++ K  +E   + +K  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++
Sbjct  629  DKGKQASESVMLQEKMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDV  687

Query  342  FVQAASN  322
              +AA+N
Sbjct  688  IFKAATN  694



>gb|KCW71312.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=596

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K++ + ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T
Sbjct  411  LKVQHVKDVPIDRLLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLET  470

Query  516  EETKGTTE-----PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-P  358
               K T++     P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  
Sbjct  471  VREKITSDVTLEVPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTS  529

Query  357  EAAEMFVQAASN  322
            +AA + V+AASN
Sbjct  530  DAANVLVKAASN  541



>ref|XP_004488095.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Cicer arietinum]
Length=752

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 57/127 (45%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ + +V A++QIE LTA+AW +K+K+LE+K+A+ S+Q G +SEYT+MA +  
Sbjct  568  LNIQNAKDMPIERVFAREQIEYLTAQAWLSKDKQLEQKVAKISLQTGFLSEYTHMAILEN  627

Query  516  EETKGT--TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAA  349
            +  K    ++ +KV+K  G     + +I+L  LG+GFG+LTAT+EN PPG   TS  + A
Sbjct  628  DHLKKAKQSDGTKVSKGKGGNVQGQRMILLPKLGIGFGNLTATSENIPPGVEDTSLSDGA  687

Query  348  EMFVQAA  328
            E+FV+ A
Sbjct  688  EIFVKKA  694



>ref|XP_009359719.1| PREDICTED: uncharacterized protein LOC103950254 [Pyrus x bretschneideri]
Length=755

 Score =   112 bits (280),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L +V AK QIE+LTA AW+  NK+LE+K+A+ S+Q  +VSEYT M  +  
Sbjct  572  LKLQDAKDIPLDRVCAKGQIELLTARAWYGDNKELEDKVAKLSMQTNVVSEYTRMVIL-H  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  343
            ++  G  E SK N  T + K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+
Sbjct  631  KDLSGPQETSKKN-HTNETKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEI  689

Query  342  FVQAASN  322
            FV+AAS+
Sbjct  690  FVRAASS  696



>ref|XP_008388928.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Malus 
domestica]
Length=755

 Score =   112 bits (279),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK   L K+  K QIE+LTA+AW+  NKKLE+K+A+ S+Q  +VSEYT M  +  
Sbjct  572  LKLQDAKXJPLDKLCTKGQIELLTAQAWYGDNKKLEDKVAKLSLQTNVVSEYTRMVIL-H  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  343
            +E  G+ E SK    T   K  +  ++L  L +GFG+L ATAEN PPGS  +  PEAAE+
Sbjct  631  KELSGSQEASK-KSCTNITKDSEKPMLLPTLSVGFGNLVATAENIPPGSEEQKLPEAAEI  689

Query  342  FVQAASN  322
            FV+AAS+
Sbjct  690  FVRAASS  696



>ref|XP_010654418.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 isoform 
X3 [Vitis vinifera]
Length=624

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AKEI L +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T
Sbjct  446  LKIQKAKEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVT  505

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEM  343
            ++ K  +E   + +K  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++
Sbjct  506  DKGKQASESVMLQEKMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDV  564

Query  342  FVQAASN  322
              +AA+N
Sbjct  565  IFKAATN  571



>ref|XP_004488096.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Cicer arietinum]
Length=600

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ + +V A++QIE LTA+AW +K+K+LE+K+A+ S+Q G +SEYT+MA +  
Sbjct  416  LNIQNAKDMPIERVFAREQIEYLTAQAWLSKDKQLEQKVAKISLQTGFLSEYTHMAILEN  475

Query  516  EETKGT--TEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAA  349
            +  K    ++ +KV+K  G     + +I+L  LG+GFG+LTAT+EN PPG   TS  + A
Sbjct  476  DHLKKAKQSDGTKVSKGKGGNVQGQRMILLPKLGIGFGNLTATSENIPPGVEDTSLSDGA  535

Query  348  EMFVQAA  328
            E+FV+ A
Sbjct  536  EIFVKKA  542



>ref|XP_006416537.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
 gb|ESQ34890.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
Length=755

 Score =   111 bits (277),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 66/133 (50%), Positives = 87/133 (65%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G+ SEYT M  I  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVPSEYTRM--IQL  627

Query  516  EETKGTTEPSKV---NKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSK  361
            E T+   +PS      K   + + QK I   I L+NLG+GFGD TAT EN PP  G    
Sbjct  628  EHTEEALKPSDTGGKKKTASNGEKQKMISRTIPLQNLGIGFGDRTATTENVPPGFGEQRA  687

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  688  PDAAEKFVKAASS  700



>ref|XP_003542365.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Glycine max]
Length=754

 Score =   110 bits (275),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK+I + K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G  SEYT M    T
Sbjct  568  MKIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFTSEYTRMMIHET  627

Query  516  EETKGTTE---PSKVNKKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
            +  K   E   P + +KK+      P   + +I+L +LG+GFG+LTATAENTPPG  SK 
Sbjct  628  DHLKKVKESSGPKEASKKSNPLFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKL  687

Query  360  PEAAEMFVQAASN  322
            PE  E+F +AA+N
Sbjct  688  PEVPEIF-KAATN  699



>gb|KJB35005.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=597

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 86/135 (64%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T
Sbjct  412  LKVQNAKDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQT  471

Query  516  EETKGTTEPSKV----NK----KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            +  K   EP  +    NK    K GD K QK ++ L  LG+GFG+LTATA+N PPG+   
Sbjct  472  DSEKKVPEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEP  530

Query  363  -KPEAAEMFVQAASN  322
              PE AE+ V AA+N
Sbjct  531  KSPEGAEILVNAATN  545



>ref|XP_008337841.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Malus domestica]
Length=751

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L +V AK QIE+LTA AW+  NK+L++K+A  S+Q  +VSEYT M  +  
Sbjct  572  LKLQDAKDIPLDRVCAKGQIELLTAWAWYGDNKELQDKVAELSMQTNVVSEYTCMVIL-H  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  343
            +E  G  E SK   +T   K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+
Sbjct  631  KELSGPQETSK-KSRTNKTKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEI  689

Query  342  FVQAASN  322
            FV+AAS+
Sbjct  690  FVRAASS  696



>gb|KJB35006.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=763

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T
Sbjct  578  LKVQNAKDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQT  637

Query  516  EETKGTTEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            +  K   EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+   
Sbjct  638  DSEKKVPEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEP  696

Query  363  -KPEAAEMFVQAASN  322
              PE AE+ V AA+N
Sbjct  697  KSPEGAEILVNAATN  711



>ref|XP_008337842.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like isoform X2 [Malus domestica]
Length=593

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+I L +V AK QIE+LTA AW+  NK+L++K+A  S+Q  +VSEYT M  +  
Sbjct  414  LKLQDAKDIPLDRVCAKGQIELLTAWAWYGDNKELQDKVAELSMQTNVVSEYTCMVIL-H  472

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  343
            +E  G  E SK   +T   K  +   +L  L +GFG+L ATAEN PPGS     PEAAE+
Sbjct  473  KELSGPQETSK-KSRTNKTKDSEKPTLLPTLSVGFGNLVATAENIPPGSEEPKLPEAAEI  531

Query  342  FVQAASN  322
            FV+AAS+
Sbjct  532  FVRAASS  538



>gb|KJB35007.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=745

 Score =   110 bits (274),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 58/135 (43%), Positives = 85/135 (63%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK++   ++L ++QI+ILT  AW +K+K+LE+K+A+ S+Q    SEYT +  + T
Sbjct  560  LKVQNAKDMSFDRILTRRQIDILTCHAWLSKSKELEDKVAKISLQTSFPSEYTCLILLQT  619

Query  516  EETKGTTEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            +  K   EP  + +        K GD K QK ++ L  LG+GFG+LTATA+N PPG+   
Sbjct  620  DSEKKVPEPMLLQEIFNKISLPKKGDSKTQK-LVSLGCLGVGFGNLTATAKNIPPGANEP  678

Query  363  -KPEAAEMFVQAASN  322
              PE AE+ V AA+N
Sbjct  679  KSPEGAEILVNAATN  693



>gb|AAF79294.1|AC068602_17 F14D16.26 [Arabidopsis thaliana]
Length=736

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 87/130 (67%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G++SEYT M  +  
Sbjct  552  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVLSEYTRMIQLEN  611

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEA  352
             E    +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+A
Sbjct  612  TEELKPSETGGKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDA  671

Query  351  AEMFVQAASN  322
            AE FV+AAS+
Sbjct  672  AEKFVKAASS  681



>gb|KHG04434.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=735

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 58/132 (44%), Positives = 84/132 (64%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK+I L  VLA++QI++LTA+AWF++NK+ EE++A+ S+Q   +SEYT M  +  
Sbjct  549  LKIQRAKDIPLDSVLARRQIDLLTAQAWFSENKRFEEEVAKLSIQTCNISEYTRMTLLEK  608

Query  516  EETKGTTEPSKVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK--P  358
             +   T +     KK GDP +        +I+L+ L +GFGDL ATAEN  PGS     P
Sbjct  609  NKMLKTLKHFGAWKKKGDPHIVVESELPEMILLQRLSVGFGDLIATAENIRPGSQEPELP  668

Query  357  EAAEMFVQAASN  322
            E A++F++  SN
Sbjct  669  EVAKIFIKTTSN  680



>ref|XP_004508009.1| PREDICTED: uncharacterized protein LOC101514299 [Cicer arietinum]
Length=751

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 89/132 (67%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K I + +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  
Sbjct  567  LKIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEN  626

Query  516  E------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKP  358
            +      E+ G  E SK      D  ++ + +I+L +LG+GFG+LTATAENTPPG  + P
Sbjct  627  DHLKKVKESPGAKEVSKKKHSKYDVNVKGQRMILLPHLGIGFGNLTATAENTPPGYETVP  686

Query  357  EAAEMFVQAASN  322
            E AE+F +AASN
Sbjct  687  EMAEIF-KAASN  697



>ref|NP_173345.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
 gb|AAM97055.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15507.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29803.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
Length=754

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 87/130 (67%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q G++SEYT M  +  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTGVLSEYTRMIQLEN  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEA  352
             E    +E     K T + + QK I   I L++LG+GFGD TAT EN PPG   +  P+A
Sbjct  630  TEELKPSETGGKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDA  689

Query  351  AEMFVQAASN  322
            AE FV+AAS+
Sbjct  690  AEKFVKAASS  699



>ref|XP_006342928.1| PREDICTED: uncharacterized protein LOC102599336 [Solanum tuberosum]
Length=744

 Score =   109 bits (272),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 57/128 (45%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QIE +TA AWF++N +LEE +A+ S+Q G+ SEYTN+  +  
Sbjct  565  VKVQKAKDFPLERVFARRQIETITANAWFSENNQLEEMVAKLSLQTGVPSEYTNLVLVEN  624

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
             + K T++   V++K  D    K II LR LG+GFG+L ATA+N P    ++P   E +E
Sbjct  625  LKEKQTSKLETVDEKASDQLNVKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSE  683

Query  345  MFVQAASN  322
            M   AASN
Sbjct  684  MVFSAASN  691



>gb|KHN07890.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=669

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK+I + K+ A+ QIE LTA+AW  +NK+LE+K+A+ S+Q G  SEYT M    T
Sbjct  483  MKIQNAKDIPVQKISARDQIEHLTAQAWLMENKQLEQKVAKLSLQTGFTSEYTRMMIHET  542

Query  516  EETKGTTE---PSKVNKKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
            +  K   E   P + +KK+      P   + +I+L +LG+GFG+LTATAENTPPG  SK 
Sbjct  543  DHLKKVKESSGPKEASKKSNPLFEAPVQGQRMILLPHLGIGFGNLTATAENTPPGFESKL  602

Query  360  PEAAEMFVQAASN  322
            PE  E+F +AA+N
Sbjct  603  PEVPEIF-KAATN  614



>gb|EYU25841.1| hypothetical protein MIMGU_mgv1a001817mg [Erythranthe guttata]
Length=755

 Score =   107 bits (268),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 91/136 (67%), Gaps = 12/136 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK ++A EI ++K++AK QIE LTA+AWF+ N++L++KIA+ SV +GI+SE+T+M  + T
Sbjct  569  LKVEQASEIPIAKIVAKHQIEQLTAQAWFSDNQELQDKIAKMSVLNGIISEHTSMVLLET  628

Query  516  EETK---GTTEPSKVNKKTGDPKLQKA-------IIMLRNLGLGFGDLTATAENTPPG--  373
            E  K    +T   +V+ K+   +  KA       I +L N+GLGFG+  AT +N PPG  
Sbjct  629  ERGKTKVDSTTKQQVSSKSKADQHNKAEDSKPKRISVLHNVGLGFGNPIATGDNIPPGCK  688

Query  372  STSKPEAAEMFVQAAS  325
             T   +AAE+FV+AAS
Sbjct  689  DTKPADAAEVFVKAAS  704



>ref|XP_010654417.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Vitis vinifera]
Length=746

 Score =   107 bits (268),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AKEI L +V A++QI +LT +AW +++K+LEE+IAR S+Q G  SEYT M  + T
Sbjct  569  LKIQKAKEIPLDRVFARRQINLLTVQAWLSESKQLEERIARMSMQTGFPSEYTCMILLVT  628

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--STSKPEAAEM  343
            ++ K  +E S + ++  D   QK II+L  LG+GFGDLTAT+EN P G      PE  ++
Sbjct  629  DKGKQASE-SVMLQEMVDSIGQK-IILLGTLGIGFGDLTATSENLPSGVEEPKPPEGTDV  686

Query  342  FVQAASN  322
              +AA+N
Sbjct  687  IFKAATN  693



>ref|XP_009149386.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Brassica rapa]
Length=757

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK+I L KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  
Sbjct  571  LSVQSAKDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQL  628

Query  516  EETKGTTEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  361
            E T+   +PS     K+TG      KL    I L+N G+GFGD TAT EN PPG   +  
Sbjct  629  ENTEEALKPSDTGGKKQTGSNGEKQKLISRTIPLQNFGIGFGDTTATRENVPPGFGEQRA  688

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  689  PDAAEKFVKAASS  701



>emb|CDY26699.1| BnaA06g13230D [Brassica napus]
Length=757

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK+I L KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  
Sbjct  571  LSVQSAKDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQL  628

Query  516  EETKGTTEPSKVN--KKTGD----PKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  361
            E T+   +PS     K+TG      KL    I L+N G+GFGD TAT EN PPG   +  
Sbjct  629  ENTEEALKPSDTGGKKQTGSNGEKQKLISRTIPLQNFGIGFGDTTATRENVPPGFGEQRA  688

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  689  PDAAEKFVKAASS  701



>ref|XP_004235553.1| PREDICTED: uncharacterized protein LOC101253877 isoform X1 [Solanum 
lycopersicum]
Length=744

 Score =   107 bits (267),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 57/128 (45%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK++ L +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +  
Sbjct  565  VKVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVEN  624

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
             + K T++   V++K  D    K II LR LG+GFG+L ATA+N P    ++P   E +E
Sbjct  625  LKEKQTSKLETVDEKASDQLNVKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSE  683

Query  345  MFVQAASN  322
            M   AASN
Sbjct  684  MVFAAASN  691



>gb|KFK44049.1| hypothetical protein AALP_AA1G209400 [Arabis alpina]
Length=761

 Score =   107 bits (266),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 66/133 (50%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  IE+LTAEAWF+++K+L EKIA+ S+Q  + SEYT M  I  
Sbjct  576  LTVQSAKDMPLDKVFAKNVIELLTAEAWFSEDKQLIEKIAKLSIQTSVPSEYTRM--IQL  633

Query  516  EETKGTTEPSKV---NKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSK  361
            E T+   +PS     NK   + + QK I   I L +LG+GFGD TAT EN PP  G    
Sbjct  634  ENTEEALKPSDTGGKNKPASNGEKQKLISRTIPLLSLGIGFGDKTATRENVPPGFGEPKA  693

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  694  PDAAEKFVKAASS  706



>ref|XP_010273853.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Nelumbo nucifera]
Length=753

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 88/134 (66%), Gaps = 10/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q++K+I L KV AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + T
Sbjct  572  LKVQKSKDIPLDKVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQT  631

Query  516  EETKGTTE---PSKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTS  364
            E  K  TE     ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S
Sbjct  632  EIGKKVTESFGSEEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEIS  691

Query  363  KPEAAEMFVQAASN  322
              E  E+FV+AASN
Sbjct  692  I-EPVEIFVKAASN  704



>ref|XP_010666845.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Beta 
vulgaris subsp. vulgaris]
Length=758

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  ++K   L K+LA Q I + T++AW   +K+LEEK+A+ SV  GIVSEYT+MA   T
Sbjct  570  LKVHKSKAFPLGKILAMQHIIMCTSQAWLLDDKQLEEKVAKMSVHSGIVSEYTSMALFVT  629

Query  516  EETKGTTEPSKVNKKTG--------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-  364
            E  K   E +   KKT         DPK QK + + +N+G+GFG++ ATAEN  PG T  
Sbjct  630  ETLKKEAEVAVKQKKTSSKSGAEKPDPKPQK-LKVSKNIGIGFGNVKATAENIAPGFTEP  688

Query  363  -KPEAAEMFVQAASN  322
              PEAAE+ V+AAS+
Sbjct  689  KPPEAAEIIVKAASD  703



>ref|XP_007024661.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
 gb|EOY27283.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
Length=752

 Score =   106 bits (264),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 85/135 (63%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q AK++   ++L ++QI+I+T  AWF+++++LEEK+A+ S+Q    SEYT +  + T
Sbjct  567  LKVQNAKDVPFDRMLTRRQIDIVTCHAWFSESQELEEKVAKISLQTSFPSEYTCLILLQT  626

Query  516  EETKGTTEPSKVNK--------KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG--ST  367
            +  K   E  +V +        K GD   QK ++ L  +G+GFG+LTATA+N PPG    
Sbjct  627  DSEKKVQESIRVQEIFKKINMPKKGDMNGQK-LVFLGCMGVGFGNLTATAKNIPPGIEEP  685

Query  366  SKPEAAEMFVQAASN  322
              PE AE+ V+AASN
Sbjct  686  KSPEGAEILVRAASN  700



>ref|XP_011072601.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157816 
[Sesamum indicum]
Length=745

 Score =   105 bits (261),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK I + +VLA++QI  LTA AWF+ +K+LEEK  + S+  G+ SEYT M  I T
Sbjct  568  VKVQSAKNIPIDRVLARRQINALTAHAWFSGSKQLEEKATKLSLLTGVPSEYTIMILIET  627

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++TK +++     +KT D K QK I+ LR LG+GFG + ATAEN PP   ++P   E +E
Sbjct  628  DKTKLSSKSKTAEEKTPDLKGQK-IVFLRGLGIGFGSVQATAENRPP-EHAEPKLYETSE  685

Query  345  MFVQAASN  322
               +AAS+
Sbjct  686  KIFKAASD  693


 Score = 27.7 bits (60),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 2/27 (7%)
 Frame = -2

Query  305  VISAVACVAF--RCVQINDQCAVVMTQ  231
            V+    C+ F   C ++NDQCAV +TQ
Sbjct  698  VVDCCCCMCFIQFCNRLNDQCAVALTQ  724



>gb|KJB82977.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=552

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 15/134 (11%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK + AK+I L  VLA++QI++LTA+AWF++NK+LEEK+A+ S+Q   +SEYT M  +  
Sbjct  370  LKIRRAKDIPLDSVLARRQIDLLTAQAWFSENKRLEEKVAKLSIQSCNISEYTRMTLL--  427

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK-  361
               K   +     KK GDP  QK +       I+L+ L +GFGD  ATAEN  PGS    
Sbjct  428  --EKNIMKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDPIATAENIRPGSQEPE  483

Query  360  -PEAAEMFVQAASN  322
             PE A++F++  SN
Sbjct  484  LPEVAKIFIKTTSN  497



>ref|XP_008342579.1| PREDICTED: uncharacterized protein LOC103405374 [Malus domestica]
Length=745

 Score =   103 bits (257),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 58/134 (43%), Positives = 83/134 (62%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q +K+I L +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEYT +  + T
Sbjct  561  LKVQRSKDIPLDQVLARRHIDMLTAHAWLLGSKELEEKVSKLSKQTGVPSEYTCLILLLT  620

Query  516  EETKGTTEP-------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSK  361
             E K   E        +K+ ++       + +I+L NLG GFG+LTAT +N  PGS   K
Sbjct  621  NEGKKAPESVMIQEVYNKITQRKKPESNNQKVIILGNLGFGFGNLTATVQNKAPGSEEEK  680

Query  360  P-EAAEMFVQAASN  322
            P +A EM V AASN
Sbjct  681  PADATEMLVNAASN  694


 Score = 29.3 bits (64),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 2/27 (7%)
 Frame = -2

Query  305  VISAVACVAF--RCVQINDQCAVVMTQ  231
            V+  V C+ F   C  +N+QCA+V+TQ
Sbjct  699  VLDRVCCMCFIRTCSHMNNQCAIVLTQ  725



>gb|KJB65321.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=565

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LK ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +  
Sbjct  379  LKIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEK  438

Query  522  -GTEETKGTTEPSKVNKKTGDPKLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSK-  361
               E    TTE  KV KK    KL  +     I+L+ L +GFGDL ATAEN  PGS  + 
Sbjct  439  GKIERDTDTTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEI  498

Query  360  -PEAAEMFVQAASN  322
             PE AEM  +A SN
Sbjct  499  LPEVAEMLNKATSN  512



>emb|CDY41019.1| BnaC05g14770D [Brassica napus]
Length=757

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK+I L KV AK  I++LTA+AWF+++K+L EKI + S+Q G+ SEYT M  I  
Sbjct  571  LTVQSAKDIPLDKVFAKNVIDLLTAKAWFSEDKQLIEKITKLSIQTGVPSEYTRM--IQL  628

Query  516  EETKGTTEPSKVN--KKTG----DPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  361
            E T+   +PS     K+TG      KL    I L+N G+GFGD T T EN PPG   +  
Sbjct  629  ENTEEALKPSDTGGKKQTGRNGEKQKLISRTIPLQNFGIGFGDTTVTRENVPPGFGEQRA  688

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  689  PDAAEKFVKAASS  701



>ref|XP_009625881.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X1 [Nicotiana tomentosiformis]
Length=745

 Score =   105 bits (261),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  
Sbjct  567  VKVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVEN  626

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++ + T++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +E
Sbjct  627  KKERQTSKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSE  684

Query  345  MFVQAASN  322
            M   AASN
Sbjct  685  MVFAAASN  692



>ref|XP_004287649.1| PREDICTED: uncharacterized protein LOC101300180 [Fragaria vesca 
subsp. vesca]
Length=752

 Score =   105 bits (261),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+I L +V AK++IE+LTA+AW ++NK+LE+K+A+ SV  G VSEYT M     
Sbjct  571  MKFQDAKDIPLHRVCAKEEIELLTAQAWLSENKQLEDKVAKMSVHTGAVSEYTRMVICQK  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEM  343
            EE           KK     L+  +I+  +L +GFG++TAT++N  PG+     PEAAE+
Sbjct  631  EEVVQKASKKSQGKKKDIETLK--MILPHSLCVGFGNVTATSDNLFPGTEEPKLPEAAEI  688

Query  342  FVQAASN  322
            F++A SN
Sbjct  689  FIKATSN  695



>gb|AES92187.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=752

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 60/132 (45%), Positives = 87/132 (66%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K I + +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  
Sbjct  567  LKIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEN  626

Query  516  E------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKP  358
            +      E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K 
Sbjct  627  DHLKKIKESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKI  686

Query  357  EAAEMFVQAASN  322
            E AE+F +AASN
Sbjct  687  EMAEIF-KAASN  697



>ref|XP_002890318.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66577.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  + AK++ L KV AK  I++LTAE W +++K+L+EKIA+ S+Q G+ SEYT M  +  
Sbjct  571  LTVRSAKDMPLDKVFAKNVIDLLTAEVWLSEDKQLKEKIAKLSIQTGVPSEYTRMIQLEN  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSKPEA  352
             E    +E     K T + + QK I   I L++LG+GFGD TAT EN PP  G    P+A
Sbjct  631  TEELKPSETGVKKKTTSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDA  690

Query  351  AEMFVQAASN  322
            AE FV+AAS+
Sbjct  691  AEKFVKAASS  700



>gb|KJB65318.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=754

 Score =   105 bits (261),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LK ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +  
Sbjct  568  LKIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEK  627

Query  522  -GTEETKGTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
               E    TTE  KV KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  + 
Sbjct  628  GKIERDTDTTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEI  687

Query  360  -PEAAEMFVQAASN  322
             PE AEM  +A SN
Sbjct  688  LPEVAEMLNKATSN  701



>emb|CDX83787.1| BnaC08g18580D [Brassica napus]
Length=756

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 86/136 (63%), Gaps = 16/136 (12%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF ++K+L+EK+ + S+Q G+ SEYT M     
Sbjct  570  LTVQNAKDMPLDKVFAKNLIDLLTAEAWFLEDKQLKEKVTKLSIQTGVPSEYTRMI----  625

Query  516  EETKGTTEPSKVNKKTGDPKL------QKAI---IMLRNLGLGFGDLTATAENTPPGSTS  364
             + + T E SK +   G+ K+      QK I   I L+N  +GFGD+TAT EN PPG   
Sbjct  626  -QLENTEEASKQSDTGGNKKIASNGEKQKMISRTIPLQNFSIGFGDITATRENVPPGYGE  684

Query  363  K--PEAAEMFVQAASN  322
            +  P+AAE FV+AAS+
Sbjct  685  QRAPDAAEKFVKAASS  700



>ref|XP_010273855.1| PREDICTED: uncharacterized protein LOC104609280 isoform X3 [Nelumbo 
nucifera]
Length=663

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 88/134 (66%), Gaps = 10/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q++K+I L KV AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + T
Sbjct  482  LKVQKSKDIPLDKVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQT  541

Query  516  EETKGTTE---PSKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTS  364
            E  K  TE     ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S
Sbjct  542  EIGKKVTESFGSEEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEIS  601

Query  363  KPEAAEMFVQAASN  322
              E  E+FV+AASN
Sbjct  602  I-EPVEIFVKAASN  614



>gb|KJB82978.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=749

 Score =   104 bits (260),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 15/134 (11%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK + AK+I L  VLA++QI++LTA+AWF++NK+LEEK+A+ S+Q   +SEYT M  +  
Sbjct  567  LKIRRAKDIPLDSVLARRQIDLLTAQAWFSENKRLEEKVAKLSIQSCNISEYTRMTLL--  624

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK-  361
               K   +     KK GDP  QK +       I+L+ L +GFGD  ATAEN  PGS    
Sbjct  625  --EKNIMKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDPIATAENIRPGSQEPE  680

Query  360  -PEAAEMFVQAASN  322
             PE A++F++  SN
Sbjct  681  LPEVAKIFIKTTSN  694



>emb|CDX81914.1| BnaC08g36870D [Brassica napus]
Length=754

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF+++ +L+EKI R S+Q G+ SEYT M  I  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDNQLKEKITRLSIQTGVPSEYTRM--IQL  627

Query  516  EETKGTTEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSK  361
            E T+  ++P      KKT  + + QK +   I L+N G+GFGD TAT EN PP  G    
Sbjct  628  ENTEEASKPINTGGKKKTETNGEKQKVVSRTIPLQNFGIGFGDTTATKENVPPGFGEARA  687

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  688  PDAAEKFVKAASS  700



>ref|XP_010459567.1| PREDICTED: uncharacterized protein LOC104740606 [Camelina sativa]
Length=754

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 7/131 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-G  520
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q  + SEYT M  +  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTSVPSEYTRMIQLEH  629

Query  519  TEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PE  355
            TEE K +    K  K + + + QK I   I L++LG+GFGD TAT EN PPG   +  P+
Sbjct  630  TEELKPSDTAGK-KKTSSNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPD  688

Query  354  AAEMFVQAASN  322
            AAE FV+AAS+
Sbjct  689  AAEKFVKAASS  699



>gb|KJB65322.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=728

 Score =   104 bits (259),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 85/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LK ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +  
Sbjct  542  LKIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEK  601

Query  522  -GTEETKGTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
               E    TTE  KV KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  + 
Sbjct  602  GKIERDTDTTEARKVPKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEI  661

Query  360  -PEAAEMFVQAASN  322
             PE AEM  +A SN
Sbjct  662  LPEVAEMLNKATSN  675



>gb|KEH32426.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=602

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 87/132 (66%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K I + +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  
Sbjct  417  LKIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEN  476

Query  516  E------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKP  358
            +      E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K 
Sbjct  477  DHLKKIKESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKI  536

Query  357  EAAEMFVQAASN  322
            E AE+F +AASN
Sbjct  537  EMAEIF-KAASN  547



>ref|XP_003608035.1| von Willebrand factor A domain-containing protein 5B1 [Medicago 
truncatula]
Length=639

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 87/132 (66%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K I + +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  
Sbjct  454  LKIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEN  513

Query  516  E------ETKGTTEPSKVNKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGSTSKP  358
            +      E+ G    SK      +  +Q + +I+L NLG+GFG+L ATAENTPPG  +K 
Sbjct  514  DHLKKIKESPGEKTVSKKKHSRYEANVQGQRMILLPNLGVGFGNLKATAENTPPGYEAKI  573

Query  357  EAAEMFVQAASN  322
            E AE+F +AASN
Sbjct  574  EMAEIF-KAASN  584



>ref|XP_009344471.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
 ref|XP_009344474.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
Length=745

 Score =   101 bits (251),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q +K+I L +VLA++ I++LTA AW   +++LE+K+++ S Q G+ SEYT M  + T
Sbjct  561  LKVQRSKDIPLDQVLARRHIDMLTAHAWLLGSRELEDKVSKLSKQTGVPSEYTCMILLLT  620

Query  516  EETKGTTEPSKV----NKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGS-TSK  361
             E K   E   +    NK T   K +   + +I+L NLG GFG+LTAT +N  PGS   K
Sbjct  621  NEEKKAPESVMIQEVYNKITQWKKPESNSQKVIILGNLGFGFGNLTATVQNKAPGSEEEK  680

Query  360  P-EAAEMFVQAASN  322
            P +A EM V AASN
Sbjct  681  PADATEMLVNAASN  694


 Score = 29.3 bits (64),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 2/27 (7%)
 Frame = -2

Query  305  VISAVACVAF--RCVQINDQCAVVMTQ  231
            V+  V C+ F   C  +N+QCA+V+TQ
Sbjct  699  VLDRVCCMCFIRTCSHMNNQCAIVLTQ  725



>ref|XP_007012610.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
 gb|EOY30229.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
Length=758

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 11/135 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK + AK+I L +VLA+QQI++LTA+AW ++NK+LEEK+A+ S+Q   +SEYT M  +  
Sbjct  569  LKIERAKDILLDRVLARQQIDLLTAQAWLSENKQLEEKVAKLSIQTCNISEYTRMVLLEK  628

Query  516  EETKGTTEPS---KVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK  361
             +    +E S   KV  K GDP           ++L++L +GFGDL ATAEN  PGS   
Sbjct  629  NKIYQASESSGSLKVPYK-GDPHEIGDSGAPKKMLLQSLTVGFGDLIATAENIRPGSQEP  687

Query  360  --PEAAEMFVQAASN  322
              PE AE+ V+A SN
Sbjct  688  KLPEVAEILVKATSN  702



>ref|XP_006385524.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63321.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=416

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 83/133 (62%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  233  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  292

Query  516  ---EETKGTTEPSKVNKKTGDPK---LQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  361
               E+   T     V  K    K   LQK  IML NL +GFG+LTATAEN PPG+  T  
Sbjct  293  LQDEKAPETILIQDVFNKINPLKKMDLQKT-IMLGNLCVGFGNLTATAENIPPGTEETKS  351

Query  360  PEAAEMFVQAASN  322
             EA EM  +AASN
Sbjct  352  SEATEMLFKAASN  364



>ref|XP_010498320.1| PREDICTED: uncharacterized protein LOC104776024 [Camelina sativa]
Length=754

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 7/131 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-G  520
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EKIA+ S+Q  + SEYT M  +  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIQTSVPSEYTIMIQLEH  629

Query  519  TEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PE  355
            TEE K +    K  K + + + QK I   I L++LG+GFGD TAT EN PPG   +  P+
Sbjct  630  TEELKPSDTAGK-KKTSNNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPD  688

Query  354  AAEMFVQAASN  322
            AAE FV+AAS+
Sbjct  689  AAEKFVKAASS  699



>ref|XP_010537666.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Tarenaya hassleriana]
Length=756

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KVLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +  
Sbjct  570  LTVQNAKDMLLDKVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILLEN  629

Query  516  EETKGTTEPSKVNK--KTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--P  358
             E     E +++ K  +  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P
Sbjct  630  IEGPKPKETARMKKGIQQVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPP  689

Query  357  EAAEMFVQAASN  322
            +AAEMFV+AAS+
Sbjct  690  DAAEMFVKAASS  701



>ref|XP_010537668.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Tarenaya hassleriana]
Length=752

 Score =   103 bits (256),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 7/130 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KVLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M  +  
Sbjct  570  LTVQNAKDMLLDKVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMILL--  627

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PEA  352
            E  +G         K  D + QK +   I L+ LG+GFGD TAT+EN  PG   +  P+A
Sbjct  628  ENIEGPKPKETARMKKVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQKPPDA  687

Query  351  AEMFVQAASN  322
            AEMFV+AAS+
Sbjct  688  AEMFVKAASS  697



>ref|XP_011036459.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Populus euphratica]
Length=757

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 15/136 (11%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  574  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  633

Query  516  EETKGTTEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--  370
               +   E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  
Sbjct  634  LTDEKAPETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEE  689

Query  369  TSKPEAAEMFVQAASN  322
            T   EA  M V+AASN
Sbjct  690  TKSSEATGMLVKAASN  705



>ref|XP_006385523.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63320.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=446

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 83/133 (62%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  263  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  322

Query  516  ---EETKGTTEPSKVNKKTGDPK---LQKAIIMLRNLGLGFGDLTATAENTPPGS--TSK  361
               E+   T     V  K    K   LQK  IML NL +GFG+LTATAEN PPG+  T  
Sbjct  323  LQDEKAPETILIQDVFNKINPLKKMDLQKT-IMLGNLCVGFGNLTATAENIPPGTEETKS  381

Query  360  PEAAEMFVQAASN  322
             EA EM  +AASN
Sbjct  382  SEATEMLFKAASN  394



>ref|XP_002304123.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|EEE79102.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=757

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 13/135 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  574  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  633

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  367
             + +   E        +K+N  K  D  LQK  IML NL +GFG+LTATAEN PPG+  T
Sbjct  634  LQDEKAPETILIQDVFNKINPLKKMD--LQKT-IMLGNLCVGFGNLTATAENIPPGTEET  690

Query  366  SKPEAAEMFVQAASN  322
               EA EM  +AASN
Sbjct  691  KSSEATEMLFKAASN  705



>ref|XP_011036458.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=758

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 15/136 (11%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  575  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  634

Query  516  EETKGTTEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--  370
               +   E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  
Sbjct  635  LTDEKAPETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEE  690

Query  369  TSKPEAAEMFVQAASN  322
            T   EA  M V+AASN
Sbjct  691  TKSSEATGMLVKAASN  706



>ref|XP_006385521.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63318.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=758

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 13/135 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  575  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  634

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--T  367
             + +   E        +K+N  K  D  LQK  IML NL +GFG+LTATAEN PPG+  T
Sbjct  635  LQDEKAPETILIQDVFNKINPLKKMD--LQKT-IMLGNLCVGFGNLTATAENIPPGTEET  691

Query  366  SKPEAAEMFVQAASN  322
               EA EM  +AASN
Sbjct  692  KSSEATEMLFKAASN  706



>ref|XP_009625888.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like isoform X4 [Nicotiana tomentosiformis]
Length=628

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  
Sbjct  450  VKVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVEN  509

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++ + T++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +E
Sbjct  510  KKERQTSKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSE  567

Query  345  MFVQAASN  322
            M   AASN
Sbjct  568  MVFAAASN  575



>ref|XP_009625883.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625884.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625885.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009625886.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X3 [Nicotiana tomentosiformis]
Length=632

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  
Sbjct  454  VKVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVEN  513

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++ + T++    ++KT D  ++K +I LR LG GFG+L AT +N P    ++P   E +E
Sbjct  514  KKERQTSKLEVTDEKTSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSE  571

Query  345  MFVQAASN  322
            M   AASN
Sbjct  572  MVFAAASN  579



>gb|KHG11270.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=754

 Score =   102 bits (255),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            LK ++A +I L K+ A+QQI++LT++AWF++NK+LEEK+A+ S++   +SEYT M  +  
Sbjct  568  LKIEKAMDISLDKISARQQIDLLTSQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEK  627

Query  522  -GTEETKGTTEPSKVNKKTGDPKL----QKAIIMLRNLGLGFGDLTATAENTPPGSTSK-  361
               E    TT   KV+KK    KL    +   I+L+ L +GFGDL ATAEN  PGS  + 
Sbjct  628  GKIERDTDTTGARKVSKKGDACKLLDSAEPKKILLQILTVGFGDLLATAENICPGSEEEI  687

Query  360  -PEAAEMFVQAASN  322
             PE AEM  +A SN
Sbjct  688  LPEVAEMLNKATSN  701



>emb|CDO97834.1| unnamed protein product [Coffea canephora]
Length=736

 Score =   102 bits (255),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 54/127 (43%), Positives = 80/127 (63%), Gaps = 15/127 (12%)
 Frame = -1

Query  693  KAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTE  514
            K Q+AK+  + ++ A+ QI+ LTA AW +++K+LEEK+ R S+Q G+ SEYTN+  + T+
Sbjct  566  KVQKAKDFPMERMCARSQIDALTANAWLSEDKQLEEKVERMSLQTGVPSEYTNLVLLETK  625

Query  513  ETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAEM  343
            + K  +E S            K +I+LR +G GFG L ATAEN PP  T++P   E +EM
Sbjct  626  KEKQISESSG-----------KKVIVLRRVGAGFGSLKATAENLPP-ETAEPKLHETSEM  673

Query  342  FVQAASN  322
              +AA N
Sbjct  674  ITKAARN  680



>ref|XP_010318474.1| PREDICTED: uncharacterized protein LOC101253877 isoform X2 [Solanum 
lycopersicum]
Length=743

 Score =   102 bits (254),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 55/128 (43%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK++ L +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +  
Sbjct  565  VKVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVEN  624

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
             + K T++   V++ +    ++K II LR LG+GFG+L ATA+N P    ++P   E +E
Sbjct  625  LKEKQTSKLETVDEASDQLNVKK-IIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSE  682

Query  345  MFVQAASN  322
            M   AASN
Sbjct  683  MVFAAASN  690



>ref|XP_004141711.1| PREDICTED: uncharacterized protein LOC101206287 [Cucumis sativus]
 ref|XP_004155911.1| PREDICTED: uncharacterized LOC101206287 [Cucumis sativus]
 gb|KGN45475.1| hypothetical protein Csa_7G448860 [Cucumis sativus]
Length=754

 Score =   102 bits (254),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 58/136 (43%), Positives = 88/136 (65%), Gaps = 13/136 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+AQ AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  
Sbjct  567  LQAQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFSSEYTRLILVLA  626

Query  516  EETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGST  367
            +E  G   PS +++K       T   K++   + II+L N G+GFG+LTATAEN  PG  
Sbjct  627  KE--GKKAPSIISQKMRKRFDLTKSKKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKE  684

Query  366  SKP-EAAEMFVQAASN  322
             K  +A ++ V+AA+N
Sbjct  685  IKATQATDLLVKAATN  700



>emb|CDY21682.1| BnaA09g44330D [Brassica napus]
Length=754

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF+++ + +EKI R S+Q G+ SEYT M  I  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDNQPKEKITRLSIQTGVPSEYTRM--IQL  627

Query  516  EETKGTTEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSK  361
            E T+  ++P      KKT  + + QK I   I L+N G+GFGD TAT EN PP  G    
Sbjct  628  ENTEEASKPINTGGKKKTETNGEKQKVISRTIPLQNFGIGFGDTTATKENVPPGFGEARA  687

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  688  PDAAEKFVKAASS  700



>ref|XP_009117566.1| PREDICTED: uncharacterized protein LOC103842665 [Brassica rapa]
Length=754

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q AK++ L KV AK  I++LTAEAWF+++ + +EKI R S+Q G+ SEYT M  I  
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDNQPKEKITRLSIQTGVPSEYTRM--IQL  627

Query  516  EETKGTTEPSKVN--KKT-GDPKLQKAI---IMLRNLGLGFGDLTATAENTPP--GSTSK  361
            E T+  ++P      KKT  + + QK I   I L+N G+GFGD TAT EN PP  G    
Sbjct  628  ENTEEASKPINTGGKKKTETNGEKQKVISRTIPLQNFGIGFGDTTATKENVPPGFGEARA  687

Query  360  PEAAEMFVQAASN  322
            P+AAE FV+AAS+
Sbjct  688  PDAAEKFVKAASS  700



>ref|XP_002532724.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF29655.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=752

 Score =   102 bits (253),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 84/135 (62%), Gaps = 13/135 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK++ L KV+A++QI++LTA AW +++K LE+K+A+ S+Q  + SEYT+M    T
Sbjct  567  LKTQKAKDVQLDKVIARRQIDVLTANAWMSESKDLEQKVAKMSIQTRVPSEYTHMILHRT  626

Query  516  EETKGTTEP---------SKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS  364
                G  EP         +K+N        +   +ML NLG+GFG+L ATA N PPG+ +
Sbjct  627  --YTGDKEPETILMQEVLNKINPLKQVKSERDKTVMLGNLGVGFGNLKATAANIPPGTDA  684

Query  363  --KPEAAEMFVQAAS  325
               P+A E  V+AAS
Sbjct  685  IKSPDATEKIVKAAS  699


 Score = 26.2 bits (56),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C  +NDQCA+V++Q
Sbjct  713  CFIQTCSSMNDQCAIVLSQ  731



>ref|XP_010477113.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
[Camelina sativa]
Length=755

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 7/131 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-G  520
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EKIA+ S++  + SEYT M  +  
Sbjct  571  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKIAKLSIETSVPSEYTRMIQLEH  630

Query  519  TEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PE  355
            TEE K +    K  K   + + QK I   I L++LG+GFGD TAT EN PPG   +  P+
Sbjct  631  TEELKPSDTAGK-KKTASNGEKQKMISRTIPLQSLGIGFGDKTATRENVPPGFGEQRAPD  689

Query  354  AAEMFVQAASN  322
            AAE FV+AAS+
Sbjct  690  AAEKFVKAASS  700



>ref|XP_004303707.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0286969 [Fragaria vesca subsp. vesca]
Length=756

 Score = 96.7 bits (239),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 84/133 (63%), Gaps = 9/133 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q +K+  L +VLAK+ I++LTA AW   +K L+EK+++ S+Q G+ SEYT+M  + T
Sbjct  573  LKVQRSKDFPLDRVLAKRHIDMLTAHAWLLGSKDLQEKVSKMSIQTGVPSEYTSMTLVRT  632

Query  516  EETKGTTEPS-------KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTS-K  361
            ++ K   E +       KV ++T     ++  I+L +LG+GFG+L AT EN  P S   K
Sbjct  633  DKGKKALELTRTQEVYIKVIQRTKSESCRQKDIILGSLGVGFGNLVATVENKAPESEEPK  692

Query  360  P-EAAEMFVQAAS  325
            P + AE+ V+AAS
Sbjct  693  PSDVAEVLVKAAS  705


 Score = 31.2 bits (69),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 21/40 (53%), Gaps = 11/40 (28%)
 Frame = -2

Query  344  CLCRQPQTVAKWCVISAVACVAF--RCVQINDQCAVVMTQ  231
            C CR         V+  + C+ F   C  +N+QCA+V+TQ
Sbjct  707  CCCR---------VLDRICCMCFIRTCTHVNNQCAIVLTQ  737



>ref|XP_008373868.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Malus domestica]
Length=745

 Score =   100 bits (249),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q +K+  L +VLA++ I++LTA AW + +K+LEEK+++ S Q G+ SEYT M  + T
Sbjct  561  LKVQRSKDFPLDRVLARRHIDMLTAHAWLSGSKELEEKVSKLSKQTGVPSEYTCMILLQT  620

Query  516  EETKGTTEPSKV----NKKTGDPKLQKA---IIMLRNLGLGFGDLTATAENTPPGSTSK-  361
             E K   E   +    NK T   K Q +   +I L NLG+GFG+LTATA+N   GS  + 
Sbjct  621  NEAKKAPESVMIQEVYNKITKWKKTQSSSQKMITLGNLGIGFGNLTATAQNKALGSEEEK  680

Query  360  -PEAAEMFVQAASN  322
              +A E+ V+AASN
Sbjct  681  AADATELLVKAASN  694


 Score = 27.7 bits (60),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 2/23 (9%)
 Frame = -2

Query  293  VACVAF--RCVQINDQCAVVMTQ  231
            V C+ F   C  +N+QCA+V+TQ
Sbjct  703  VCCMCFITTCSHMNNQCAIVLTQ  725



>ref|XP_008356516.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Malus domestica]
Length=308

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 9/134 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q +K+  L +VLA++ I++LTA AW + +K+LEEK+++ S Q G+ SEYT M  + T
Sbjct  124  LKVQRSKDFPLDRVLARRHIDMLTAHAWLSGSKELEEKVSKLSKQTGVPSEYTCMILLQT  183

Query  516  EETKGTTEPSKV----NKKTGDPKLQKA---IIMLRNLGLGFGDLTATAENTPPGSTSK-  361
             E K   E   +    NK T   K Q +   +I L NLG+GFG+LTATA+N   GS  + 
Sbjct  184  NEAKKAPESVMIQEVYNKITKWKKTQSSSQKMITLGNLGIGFGNLTATAQNKALGSEEEK  243

Query  360  -PEAAEMFVQAASN  322
              +A E+ V+AASN
Sbjct  244  AADATELLVKAASN  257



>ref|XP_011035743.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=756

 Score =   101 bits (252),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 57/134 (43%), Positives = 88/134 (66%), Gaps = 12/134 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +KAQ+AK++ + +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T
Sbjct  574  IKAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQTGVPSEYTLMVLHHT  633

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TS  364
               +  +E        +K+N  K  D +++   IML N  +GFG+L+ATAEN PPG+ T 
Sbjct  634  LREEKASETILIRDVFNKINPLKKMDLQMK---IMLGNQCVGFGNLSATAENIPPGTETR  690

Query  363  KPEAAEMFVQAASN  322
              +A EM   AASN
Sbjct  691  SSDATEMLFNAASN  704



>ref|XP_011036460.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Populus euphratica]
Length=650

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 15/136 (11%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M    T
Sbjct  467  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMVLHQT  526

Query  516  EETKGTTEP-------SKVN--KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS--  370
               +   E        +K+N  KK   PK     I+LRNL +GFG+LTATAEN PPG+  
Sbjct  527  LTDEKAPETILIQDVFNKMNPLKKMDFPK----TIVLRNLCVGFGNLTATAENIPPGTEE  582

Query  369  TSKPEAAEMFVQAASN  322
            T   EA  M V+AASN
Sbjct  583  TKSSEATGMLVKAASN  598



>ref|XP_009110301.1| PREDICTED: uncharacterized protein LOC103835866 [Brassica rapa]
Length=757

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 6/131 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-G  520
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L EK+ + S+Q G+ SEYT M  +  
Sbjct  571  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLIEKVTKLSIQTGVPSEYTRMIQLEN  630

Query  519  TEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PE  355
            TEE    ++     K   + + QK I   I L+   +GFGD+TAT EN PPG   +  P+
Sbjct  631  TEEASKQSDTGGKKKTASNGEKQKLISRTIPLQKFSIGFGDITATRENVPPGYGEQRAPD  690

Query  354  AAEMFVQAASN  322
            AAE FV+AAS+
Sbjct  691  AAEKFVKAASS  701



>ref|XP_006369125.1| hypothetical protein POPTR_0001s16700g [Populus trichocarpa]
 gb|ERP65694.1| hypothetical protein POPTR_0001s16700g [Populus trichocarpa]
Length=578

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +KAQ+AK++ + +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T
Sbjct  395  IKAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQSGVPSEYTLMVLHHT  454

Query  516  EETKGTTEPSKV----NKKTGDPKLQ-KAIIMLRNLGLGFGDLTATAENTPPGS--TSKP  358
               +  +E   +    NK     K+  +  IML NL +GFG+L+ATAEN PPG+  T   
Sbjct  455  LREEKASETILIQNVFNKINPLKKMDLQTKIMLGNLCVGFGNLSATAENIPPGTEETKSS  514

Query  357  EAAEMFVQAASN  322
            +A EM   AASN
Sbjct  515  DATEMLFNAASN  526



>ref|XP_009625882.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X2 [Nicotiana tomentosiformis]
Length=744

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QIE+LTA AWF+ +K+LEEK+ + S+Q G+ SEY+N+  +  
Sbjct  567  VKVQKAKDFPLERVFARRQIEMLTANAWFSGSKQLEEKVVKLSLQTGVPSEYSNLILVEN  626

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++ + T++  +V  +T D  ++K +I LR LG GFG+L AT +N P    ++P   E +E
Sbjct  627  KKERQTSK-LEVTDETSDLNVKK-VIYLRALGFGFGNLKATVDNLPV-EAAEPKLHETSE  683

Query  345  MFVQAASN  322
            M   AASN
Sbjct  684  MVFAAASN  691



>gb|KCW71310.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=694

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 8/120 (7%)
 Frame = -1

Query  660  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE----  493
            ++LAK+QI+ LTA+AWF KN +L EK+AR S+Q  + SEYT M  + T   K T++    
Sbjct  521  ELLAKRQIDDLTAQAWFQKNTQLAEKVARMSIQSRVPSEYTWMILLETVREKITSDVTLE  580

Query  492  -PSKVN-KKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK-PEAAEMFVQAASN  322
             P KVN KK  D K Q+ +I+L NLG GFG+LTAT +N PPG   K  +AA + V+AASN
Sbjct  581  VPEKVNFKKMLDLKGQR-VILLGNLGKGFGNLTATVKNIPPGVEEKTSDAANVLVKAASN  639



>ref|XP_011035744.1| PREDICTED: uncharacterized protein LOC105133437 isoform X2 [Populus 
euphratica]
Length=717

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 57/134 (43%), Positives = 88/134 (66%), Gaps = 12/134 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +KAQ+AK++ + +V+A++QI++LTA AW + +K+LE+K+A+ S+Q G+ SEYT M    T
Sbjct  535  IKAQKAKDLPVDRVVARRQIDLLTANAWLSGSKELEQKVAKMSIQTGVPSEYTLMVLHHT  594

Query  516  EETKGTTEP-------SKVNK-KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TS  364
               +  +E        +K+N  K  D +++   IML N  +GFG+L+ATAEN PPG+ T 
Sbjct  595  LREEKASETILIRDVFNKINPLKKMDLQMK---IMLGNQCVGFGNLSATAENIPPGTETR  651

Query  363  KPEAAEMFVQAASN  322
              +A EM   AASN
Sbjct  652  SSDATEMLFNAASN  665



>ref|XP_009764208.1| PREDICTED: uncharacterized protein LOC104215964 isoform X1 [Nicotiana 
sylvestris]
Length=745

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QI+ILTA AW + +K+LEEK+ + S+Q G+ SEYTN+  +  
Sbjct  567  VKVQKAKDFPLERVFARRQIKILTANAWCSGSKQLEEKVVKMSLQTGVPSEYTNLILVEN  626

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++ + T++    ++KT D  ++K II LR LG GFG+L AT  N P    ++P   E +E
Sbjct  627  KKERQTSKLEVADEKTSDLNVKK-IIYLRALGFGFGNLKATMNNLPV-EAAEPKLHETSE  684

Query  345  MFVQAASN  322
            M   AAS+
Sbjct  685  MVFAAASS  692



>ref|XP_010318475.1| PREDICTED: uncharacterized protein LOC101253877 isoform X3 [Solanum 
lycopersicum]
Length=739

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 55/128 (43%), Positives = 82/128 (64%), Gaps = 9/128 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK++ L +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +  
Sbjct  565  VKVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVEN  624

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
             + K T++   V++        K II LR LG+GFG+L ATA+N P    ++P   E +E
Sbjct  625  LKEKQTSKLETVDELN-----VKKIIYLRALGVGFGNLKATADNLPV-EAAEPKLHETSE  678

Query  345  MFVQAASN  322
            M   AASN
Sbjct  679  MVFAAASN  686



>ref|XP_004144038.1| PREDICTED: uncharacterized protein LOC101210279 [Cucumis sativus]
 ref|XP_004170362.1| PREDICTED: uncharacterized protein LOC101231061 [Cucumis sativus]
 gb|KGN66313.1| hypothetical protein Csa_1G597110 [Cucumis sativus]
Length=755

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 10/132 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  QEAK+I + K+ AK QIE LTAEAW ++NK+L E + + S + G++SEYT M     
Sbjct  571  LNVQEAKDIPIDKLFAKDQIEQLTAEAWCSENKQLVEMVKKMSTKMGVLSEYTQMIIF--  628

Query  516  EETKGTTEPSKVNKKTG------DPKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKP  358
            +      E  KV +K         PK  K +++L   G+GFG+L AT++NTP G+   KP
Sbjct  629  QNVDKVIESIKVQQKKNAYEKMVAPKGDK-MLLLPLFGVGFGNLEATSDNTPLGNGERKP  687

Query  357  EAAEMFVQAASN  322
            EAAE+F +AASN
Sbjct  688  EAAEIFAKAASN  699



>ref|XP_008450941.1| PREDICTED: uncharacterized protein LOC103492379 [Cucumis melo]
Length=755

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q+AK+I L K+ AK QIE LTAEAW ++N++L E + + S + G++SEYT M     
Sbjct  571  LNVQQAKDIPLDKLFAKNQIEQLTAEAWCSENQQLVETVKKMSTKAGVMSEYTQMVIF--  628

Query  516  EETKGTTEPSKVNKKTGD-----PKLQKAIIMLRNLGLGFGDLTATAENTPPGS-TSKPE  355
            +      E  KV +K        P     +++L   G+GFG+L AT++NTP G+   KPE
Sbjct  629  QNADKVNESIKVQQKKNAYEKMVPPKGDKMMLLPFCGVGFGNLEATSDNTPLGTGERKPE  688

Query  354  AAEMFVQAASN  322
            AAE+FV+AASN
Sbjct  689  AAEIFVKAASN  699



>ref|XP_007012611.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
 gb|EOY30230.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
Length=759

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 62/136 (46%), Positives = 86/136 (63%), Gaps = 12/136 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEK-IARASVQHGIVSEYTNMAFIG  520
            LK + AK+I L +VLA+QQI++LTA+AW ++NK+LEEK +A+ S+Q   +SEYT M  + 
Sbjct  569  LKIERAKDILLDRVLARQQIDLLTAQAWLSENKQLEEKVVAKLSIQTCNISEYTRMVLLE  628

Query  519  TEETKGTTEPS---KVNKKTGDPKL-----QKAIIMLRNLGLGFGDLTATAENTPPGSTS  364
              +    +E S   KV  K GDP           ++L++L +GFGDL ATAEN  PGS  
Sbjct  629  KNKIYQASESSGSLKVPYK-GDPHEIGDSGAPKKMLLQSLTVGFGDLIATAENIRPGSQE  687

Query  363  K--PEAAEMFVQAASN  322
               PE AE+ V+A SN
Sbjct  688  PKLPEVAEILVKATSN  703



>emb|CDX96680.1| BnaA08g22230D [Brassica napus]
Length=768

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI-G  520
            L  Q AK++ L KV AK  I++LTAEAW +++K+L EK+ + S+Q G+ SEYT M  +  
Sbjct  582  LTVQSAKDMPLDKVFAKNVIDLLTAEAWLSEDKQLIEKVTKLSIQTGVPSEYTRMIQLEN  641

Query  519  TEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK--PE  355
            TEE    ++     K   + + QK I   I L+   +GFGD+TAT EN PPG   +  P+
Sbjct  642  TEEASKQSDTGGKKKTASNSEKQKLISRTIPLQKFSIGFGDITATRENVPPGYGEQRAPD  701

Query  354  AAEMFVQAASN  322
            AAE FV+AAS+
Sbjct  702  AAEKFVKAASS  712



>ref|XP_010537667.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Tarenaya hassleriana]
Length=756

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 11/134 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSK----VLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMA  529
            L  Q AK++ L K    VLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M 
Sbjct  570  LTVQNAKDMLLDKLLKQVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMI  629

Query  528  FIGTEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTSK-  361
             +  E  +G         K  D + QK +   I L+ LG+GFGD TAT+EN  PG   + 
Sbjct  630  LL--ENIEGPKPKETARMKKVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNGQK  687

Query  360  -PEAAEMFVQAASN  322
             P+AAEMFV+AAS+
Sbjct  688  PPDAAEMFVKAASS  701



>gb|KJB07329.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=467

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +  
Sbjct  281  LKIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEK  340

Query  516  EETKGTTEPSKVNK-KTGDP-KLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSK--  361
             +     E S   K K  DP K++  +     +L++L +GFGDLTATAEN  PG   +  
Sbjct  341  NKIDKAIESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKL  400

Query  360  PEAAEMFVQAASN  322
            P+AAE+F++A S+
Sbjct  401  PDAAEVFLKATSD  413



>gb|KHG29331.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=756

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 58/133 (44%), Positives = 85/133 (64%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L +VLA+Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +  
Sbjct  570  LKIVRAKDIPLDRVLARQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEK  629

Query  516  EETKGTTEPSKVNK-KTGDP-KLQKAI----IMLRNLGLGFGDLTATAENTPPG--STSK  361
             +     E S   K K  DP K++  +     +L++L +GFGDLTATAEN  PG      
Sbjct  630  NKIDKAIESSGAQKVKKTDPHKIEDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEEPKL  689

Query  360  PEAAEMFVQAASN  322
            P+AAE+F++A SN
Sbjct  690  PDAAEIFLKATSN  702



>ref|XP_010537665.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Tarenaya hassleriana]
Length=760

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 11/136 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSK----VLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMA  529
            L  Q AK++ L K    VLAK  I++LT EAW ++++ L+EKIA+ S+Q G+ SEYT M 
Sbjct  570  LTVQNAKDMLLDKLLKQVLAKNVIDMLTTEAWLSEDRGLQEKIAKLSIQTGVPSEYTRMI  629

Query  528  FIGTEETKGTTEPSKVNK--KTGDPKLQKAI---IMLRNLGLGFGDLTATAENTPPGSTS  364
             +   E     E +++ K  +  D + QK +   I L+ LG+GFGD TAT+EN  PG   
Sbjct  630  LLENIEGPKPKETARMKKGIQQVDNETQKMVSRTIPLQPLGIGFGDKTATSENVQPGFNG  689

Query  363  K--PEAAEMFVQAASN  322
            +  P+AAEMFV+AAS+
Sbjct  690  QKPPDAAEMFVKAASS  705



>ref|XP_008462285.1| PREDICTED: uncharacterized protein LOC103500681 isoform X1 [Cucumis 
melo]
Length=758

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  
Sbjct  570  LQPQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLA  629

Query  516  EETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGST  367
            +E K    PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG  
Sbjct  630  KEGK-KAPPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKE  688

Query  366  SKP-EAAEMFVQAASN  322
             K  +A ++ V+AA+N
Sbjct  689  IKATQATDLLVKAATN  704



>ref|XP_008462286.1| PREDICTED: uncharacterized protein LOC103500681 isoform X2 [Cucumis 
melo]
Length=755

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  
Sbjct  567  LQPQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLA  626

Query  516  EETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGST  367
            +E K    PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG  
Sbjct  627  KEGK-KAPPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKE  685

Query  366  SKP-EAAEMFVQAASN  322
             K  +A ++ V+AA+N
Sbjct  686  IKATQATDLLVKAATN  701



>gb|KJB07325.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07328.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=585

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +  
Sbjct  399  LKIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEK  458

Query  516  EETKGTTEPSKVNK-KTGDP-KLQKAI----IMLRNLGLGFGDLTATAENTPPGSTSK--  361
             +     E S   K K  DP K++  +     +L++L +GFGDLTATAEN  PG   +  
Sbjct  459  NKIDKAIESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKL  518

Query  360  PEAAEMFVQAASN  322
            P+AAE+F++A S+
Sbjct  519  PDAAEVFLKATSD  531



>ref|XP_010685291.1| PREDICTED: uncharacterized protein LOC104899734 [Beta vulgaris 
subsp. vulgaris]
Length=756

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 83/132 (63%), Gaps = 8/132 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK  +AK+I L KV A+ +++ LTA+AWFT++K++E+++A  S+Q G+ SEYT M    T
Sbjct  571  LKVSKAKDIPLDKVFAQTRVDTLTAKAWFTRSKEVEKQVADISMQTGVPSEYTRMILFQT  630

Query  516  EETKG-----TTEPSKVNKKTGDPKLQKA--IIMLRNLGLGFGDLTATAENTPPGSTSK-  361
            +         T +  +   K+   K+ ++  I++L++LG GFGDL  TAEN PPG   K 
Sbjct  631  DSWNHGPDAITIQGKEAYDKSSTLKMVRSQKIMVLQSLGFGFGDLIKTAENLPPGVIIKA  690

Query  360  PEAAEMFVQAAS  325
            P+  ++ V AA+
Sbjct  691  PDTTDLLVNAAA  702



>ref|XP_006390650.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
 gb|ESQ27936.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
Length=756

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 56/137 (41%), Positives = 78/137 (57%), Gaps = 13/137 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTN--MAFI  523
            L  Q+AK+I L KVLA++QI+ LTA+AWF   K+L+EK+ R S+Q G  SEYT   ++  
Sbjct  569  LTVQKAKDIPLDKVLARRQIDELTAQAWFEDKKELQEKVTRLSIQTGFPSEYTQIVLSLQ  628

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRN---------LGLGFGDLTATAENTPP--  376
              EE K    P  + +   +P  Q    M RN          G GFG++TAT +N PP  
Sbjct  629  QNEEEKTMERPVSIKEILRNPSYQIHKQMQRNSEKTSLLGKQGFGFGNVTATLKNVPPWM  688

Query  375  GSTSKPEAAEMFVQAAS  325
                +PE AE+ ++AAS
Sbjct  689  EEPKEPEGAEILIRAAS  705



>gb|KJB07327.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=756

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 83/133 (62%), Gaps = 8/133 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +  
Sbjct  570  LKIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEK  629

Query  516  EETKGTTEPSKVNK-KTGDPK-----LQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--  361
             +     E S   K K  DP      L     +L++L +GFGDLTATAEN  PG   +  
Sbjct  630  NKIDKAIESSGAQKVKKTDPHKIKDPLAPRKTLLQSLSVGFGDLTATAENIRPGFEQQKL  689

Query  360  PEAAEMFVQAASN  322
            P+AAE+F++A S+
Sbjct  690  PDAAEVFLKATSD  702



>ref|XP_009764209.1| PREDICTED: uncharacterized protein LOC104215964 isoform X2 [Nicotiana 
sylvestris]
Length=744

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK+  L +V A++QI+ILTA AW + +K+LEEK+ + S+Q G+ SEYTN+  +  
Sbjct  567  VKVQKAKDFPLERVFARRQIKILTANAWCSGSKQLEEKVVKMSLQTGVPSEYTNLILVEN  626

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP---EAAE  346
            ++ + T++  +V  +T D  ++K II LR LG GFG+L AT  N P    ++P   E +E
Sbjct  627  KKERQTSK-LEVADETSDLNVKK-IIYLRALGFGFGNLKATMNNLPV-EAAEPKLHETSE  683

Query  345  MFVQAASN  322
            M   AAS+
Sbjct  684  MVFAAASS  691



>ref|XP_009105911.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Brassica 
rapa]
 emb|CDX96412.1| BnaA07g30230D [Brassica napus]
Length=756

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 13/137 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  ++AK+I L KVLA++QI+ LTA+AWF   K+L++K+ R S+Q G  SEYT M  +  
Sbjct  569  LTVEKAKDIPLDKVLARRQIDELTAQAWFEDKKELQDKVMRLSIQTGFPSEYTQMVLSLK  628

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRNL---------GLGFGDLTATAENTPP--  376
              +E K    P  + +   +P  Q    M RN+         G GFG+L AT +N PP  
Sbjct  629  DNDEEKTIERPVSIKEILRNPSYQIQKQMSRNIERTSLLGKQGFGFGNLAATLKNIPPWM  688

Query  375  GSTSKPEAAEMFVQAAS  325
                +PE AE+ ++AAS
Sbjct  689  EEPKEPEGAEILIRAAS  705



>ref|XP_010111991.1| von Willebrand factor A domain-containing protein [Morus notabilis]
 gb|EXC32302.1| von Willebrand factor A domain-containing protein [Morus notabilis]
Length=745

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 57/136 (42%), Positives = 82/136 (60%), Gaps = 13/136 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+AK+  L++VLA++QI++LT+ AW T +K+LEEK+A+ S Q G+ SEYT M  + +
Sbjct  562  LKVQKAKDFPLNRVLARRQIDMLTSHAWLTGSKELEEKVAKMSKQTGVPSEYTLMILVNS  621

Query  516  EETKGTTEPSKVNKKTGDPKL---------QKAIIMLRNLGLGFGDLTATAEN--TPPGS  370
            +  KG   P  V  +  D KL         ++ I+ L +LG+GFGDL ATA N  +    
Sbjct  622  D--KGKILPDSVPAQEADNKLKLWKKSESSKEKILFLGSLGMGFGDLAATAANKLSIIEE  679

Query  369  TSKPEAAEMFVQAASN  322
                E A   V+AASN
Sbjct  680  LKASEPANFLVKAASN  695



>ref|XP_008228173.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Prunus 
mume]
Length=749

 Score = 91.3 bits (225),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 57/137 (42%), Positives = 81/137 (59%), Gaps = 12/137 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q +KE  L +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEY+ M  + +
Sbjct  562  LKVQRSKEFPLDRVLARRHIDMLTAHAWLLGSKELEEKVSKMSKQTGVPSEYSCMILVQS  621

Query  516  EET-KGTTEPSKV------NKKTGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGST  367
             +T  G   P  V      NK T   K +   + +I+L NLG+GFG+L AT EN  P S 
Sbjct  622  LQTDNGKRVPESVTIQGVYNKFTQLNKTESNRQKVIVLGNLGVGFGNLKATVENKAPASE  681

Query  366  S-KP-EAAEMFVQAASN  322
              KP +  E+   AASN
Sbjct  682  EVKPADPTELLFNAASN  698


 Score = 27.7 bits (60),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 2/27 (7%)
 Frame = -2

Query  305  VISAVACVAF--RCVQINDQCAVVMTQ  231
            V+  V C+ F   C  +N+QCA+++TQ
Sbjct  703  VLDRVCCMCFIRTCSHMNNQCAILLTQ  729



>emb|CDX72920.1| BnaC06g33680D [Brassica napus]
Length=756

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 13/137 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  ++AK+I L KVLA++QI+ LTA+AWF   K+L++K+ R S+Q G  SEYT M  +  
Sbjct  569  LTVEKAKDIPLDKVLARRQIDELTAQAWFEDKKELQDKVTRLSIQTGFPSEYTQMILSLK  628

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRNL---------GLGFGDLTATAENTPP--  376
              +E K    P  + +   +P  Q    M RN+         G GFG+L AT +N PP  
Sbjct  629  DNDEEKTIERPVSIKEILRNPSYQIHKQMSRNIERTSLLGKQGFGFGNLAATLKNLPPWM  688

Query  375  GSTSKPEAAEMFVQAAS  325
                +PE AE+ ++AAS
Sbjct  689  EEPKEPEGAEILIRAAS  705



>ref|XP_008462288.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1 isoform 
X3 [Cucumis melo]
Length=609

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q AKE+ L +VLA++QI+I+T+ AW  ++K L++KIA+ S Q G  SEYT +  +  
Sbjct  421  LQPQRAKELLLDRVLARRQIDIMTSHAWLLESKDLQDKIAKLSKQSGFPSEYTRLILVLA  480

Query  516  EETKGTTEPSKVNKK-------TGDPKLQ---KAIIMLRNLGLGFGDLTATAENTPPGST  367
            +E K    PS ++++       T   K++   + II+L N G+GFG+LTATAEN  PG  
Sbjct  481  KEGK-KAPPSIISQEMRKRFDLTKSNKVEWKGQKIILLGNQGVGFGNLTATAENLQPGKE  539

Query  366  SKP-EAAEMFVQAASN  322
             K  +A ++ V+AA+N
Sbjct  540  IKATQATDLLVKAATN  555



>ref|XP_003557739.1| PREDICTED: uncharacterized protein LOC100836064 [Brachypodium 
distachyon]
Length=754

 Score = 89.7 bits (221),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLAKQQ+++LT++AW ++NK+LE+K+A+ S+Q+ I SEYT    + T
Sbjct  571  LKVQHIKDIPLGKVLAKQQVDLLTSKAWLSENKQLEQKVAKLSIQNSIPSEYTRTVLLQT  630

Query  516  --EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAA  349
              E+     +  +  KK G    + +   L  L LGFG++ AT EN     G T  P+  
Sbjct  631  ILEKVDPAQQGKQKPKKHGSAD-ESSATPLNGLTLGFGNVAATMENLTSGFGDTKAPDKF  689

Query  348  EMF  340
            EMF
Sbjct  690  EMF  692


 Score = 27.7 bits (60),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++NDQCA+VM Q
Sbjct  711  CFINACSKMNDQCAIVMVQ  729



>ref|XP_010531895.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Tarenaya hassleriana]
Length=756

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q  K++ L K+LAK  I++LT EAW  ++++L+EKIA+ S+Q G+ SEYT M  +  
Sbjct  572  LTVQNVKDMPLDKILAKNVIDMLTEEAWLLEDRQLQEKIAKISIQTGVPSEYTQMILLEN  631

Query  516  EETKGTTEPS---KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEA  352
             E     E     K ++ +   KL    I L+++G GFGD+ AT++N  PG  ++  P+A
Sbjct  632  IEGPKPKEAGGKKKASRNSEKQKLASRKIPLQSIGTGFGDVAATSDNVSPGFEAQKPPDA  691

Query  351  AEMFVQAASN  322
            AE+  +AASN
Sbjct  692  AEVLAKAASN  701



>dbj|BAJ95100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score = 92.0 bits (227),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K+I L KVLAKQQ+++LTA+AW ++NK+LE+ +A+ S+Q+GI SEYT    + T
Sbjct  572  LKVQQIKDIPLDKVLAKQQMDLLTAKAWLSENKQLEQMVAKMSIQNGIPSEYTRTVLLQT  631

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  343
               K   +P++  K+      + + + L+ L LGFG++ AT EN     G T  P+  +M
Sbjct  632  IMEK--IDPAQQGKQKPKKPEEPSAMPLQGLTLGFGNVPATTENLTSGFGDTRAPDKFDM  689

Query  342  FVQA  331
            F +A
Sbjct  690  FGKA  693


 Score = 24.6 bits (52),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -2

Query  266  QINDQCAVVMTQ  231
            ++NDQCA+VM Q
Sbjct  716  KMNDQCAIVMVQ  727



>gb|EYU21307.1| hypothetical protein MIMGU_mgv1a001939mg [Erythranthe guttata]
Length=736

 Score = 90.9 bits (224),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q AK+I L K+ A++QI  LT  AWF+ +K+LEEK  + S+  G+ SEYT +  + T
Sbjct  574  MKVQNAKDIPLDKIFARRQINALTTNAWFSGSKELEEKATKLSLLTGVPSEYTTIILVET  633

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKP--EAAEM  343
             + K  +    + +KT   K QK +I +R LG+G+G+  AT EN  P +      E+ E+
Sbjct  634  IKNKSLSNRKTLQEKT--VKEQKNMIYMRRLGIGYGNTEATVENRAPANAEPKLYESTEI  691

Query  342  FVQAASN  322
              +AASN
Sbjct  692  IFKAASN  698


 Score = 25.8 bits (55),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (63%), Gaps = 2/27 (7%)
 Frame = -2

Query  305  VISAVACVAF--RCVQINDQCAVVMTQ  231
            ++    C+ F   C ++NDQCA+ +TQ
Sbjct  703  LVDCCCCMCFIQFCNRLNDQCAIALTQ  729



>ref|XP_010273854.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Nelumbo nucifera]
Length=696

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 79/122 (65%), Gaps = 10/122 (8%)
 Frame = -1

Query  660  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTE---P  490
            +V AK QI++LT +AWF+++K +EEK+A+ S++ G  SEYT M  + TE  K  TE    
Sbjct  527  EVSAKNQIDLLTTQAWFSESKPIEEKVAKMSLRIGFPSEYTRMVLLQTEIGKKVTESFGS  586

Query  489  SKVNKKTGDPKLQKA----IIMLRNLGLGFGDLTATAENTP--PGSTSKPEAAEMFVQAA  328
             ++  K    KL K+    I +L +LG+GFG+L ATA+NTP  PG  S  E  E+FV+AA
Sbjct  587  EEILNKIDLAKLVKSKGYDITLLPSLGMGFGNLAATADNTPLEPGEISI-EPVEIFVKAA  645

Query  327  SN  322
            SN
Sbjct  646  SN  647



>ref|XP_006306812.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
 gb|EOA39710.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
Length=780

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 86/156 (55%), Gaps = 31/156 (20%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEK----------------------  583
            L  Q AK++ L KV AK  I++LTAEAWF+++K+L+EK                      
Sbjct  570  LTVQSAKDMPLDKVFAKNVIDLLTAEAWFSEDKQLKEKVCLHFTHPQLSFSGVAPSFCFT  629

Query  582  ----IARASVQHGIVSEYTNMAFIGTEETKGTTEPSKVNKKTGDPKLQKAI---IMLRNL  424
                IA+ S+Q  + SEYT M  +   E    ++ +   K + + + QK I   I L++L
Sbjct  630  FFSQIAKLSIQTSVPSEYTRMIQLEHTEELKPSDITGKKKTSSNGEKQKMISRTIPLQSL  689

Query  423  GLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASN  322
            G+GFGD TAT EN PPG   +  P+AAE FV+AAS+
Sbjct  690  GIGFGDQTATRENVPPGFGEQRLPDAAEKFVKAASS  725



>ref|XP_006650182.1| PREDICTED: uncharacterized protein LOC102717967 [Oryza brachyantha]
Length=750

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 5/126 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q  K+I L KVLAKQQ+++LTA+AW  +N +L+ K+A+ S+Q+ I SEYT+   + T
Sbjct  571  LRVQHIKDIPLDKVLAKQQMDLLTAKAWLYENDQLKRKVAKLSIQNSIPSEYTHTVLLQT  630

Query  516  --EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAA  349
              E+     +  +  KK   P  Q A   L  L LGFGD+ AT EN     G T  PE  
Sbjct  631  ILEKIDQAQQGKQKPKKNTSPNEQLA-TSLNGLSLGFGDVAATRENLSAGFGDTKPPERF  689

Query  348  EMFVQA  331
            EMF +A
Sbjct  690  EMFEKA  695



>ref|XP_009414822.1| PREDICTED: uncharacterized protein LOC103995835 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=754

 Score = 90.5 bits (223),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 48/127 (38%), Positives = 76/127 (60%), Gaps = 6/127 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+  L K  +KQ I++LTA+AWF+++K L+EK+ + S+Q  I SEYT M F+ T
Sbjct  573  LKVQHTKDFPLEKAFSKQHIDLLTAQAWFSESKLLQEKVTKLSIQSSIPSEYTCMVFLQT  632

Query  516  EETKGTT---EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEA  352
            +  K         K ++K  +PK +   +++R   +GFGD+ AT EN P   G   +PE 
Sbjct  633  DTGKQEAIKQVKKKDSRKHANPK-ENLSVLVRRTAIGFGDIIATTENHPTGFGGLKEPET  691

Query  351  AEMFVQA  331
             +++ +A
Sbjct  692  FDVYNKA  698


 Score = 24.6 bits (52),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++NDQ  +VMTQ
Sbjct  713  CFIKTCSKVNDQLVIVMTQ  731



>gb|KHN39616.1| Inter-alpha-trypsin inhibitor heavy chain H5 [Glycine soja]
Length=742

 Score = 89.7 bits (221),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFI  523
            LK +  K++ LS VL+K+ I+ +TA+AW  K+++LEEK+ + S+Q+ + SEYT  NM  +
Sbjct  556  LKVKREKDMQLSNVLSKRHIDQVTAQAWLLKSEELEEKVTKMSIQNKVPSEYTCMNMVLV  615

Query  522  GTEETKGTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKP  358
             ++E K T E   + K       QK       + L  L LGFGDL ATAEN PP      
Sbjct  616  QSDEGKKTPEQFLLQKAYNKLSFQKLELNNQNLFLGGLSLGFGDLKATAENLPPAIKEAK  675

Query  357  EAAEMFVQAASN  322
                +  +AASN
Sbjct  676  PPEGLLGRAASN  687


 Score = 25.4 bits (54),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +NDQC +V TQ
Sbjct  700  CLLQTCTFVNDQCTIVCTQ  718



>ref|XP_010416000.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=759

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  Q+AK+I L KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +  
Sbjct  571  LTVQKAKDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQ  630

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPG  373
              +E K    P  + +   +P  Q    M RN           G GFG++ AT +N PP 
Sbjct  631  QDDEEKTMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNIVATLKNVPPW  690

Query  372  STSKPEA--AEMFVQAAS  325
                 EA  AE+ ++AAS
Sbjct  691  MEEPKEADGAELLIRAAS  708



>ref|XP_004984064.1| PREDICTED: uncharacterized protein LOC101774989 isoform X1 [Setaria 
italica]
Length=760

 Score = 89.4 bits (220),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T
Sbjct  580  LKVQHVKDIPLDKVLAKQQMDLLTAKAWLLENKELERKVVKLSIQNSLPSEYTRMVLLQT  639

Query  516  EETKGTTEPSKVNK--KTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
               K        NK  K   P  +++ + LR L LGFGD+ AT EN   G
Sbjct  640  NLDKIDPAQQAKNKPTKQSSPD-ERSAMPLRGLTLGFGDVVATRENLTAG  688


 Score = 25.0 bits (53),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  272  CVQINDQCAVVMTQ  231
            C ++NDQCA+VM Q
Sbjct  724  CSKMNDQCAIVMAQ  737



>gb|ABF96527.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EEC75447.1| hypothetical protein OsI_11983 [Oryza sativa Indica Group]
Length=751

 Score = 88.6 bits (218),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 52/124 (42%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +  
Sbjct  575  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQN  634

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  343
               K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EM
Sbjct  635  FVEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEM  692

Query  342  FVQA  331
            F +A
Sbjct  693  FDKA  696


 Score = 25.8 bits (55),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++ND+CA+VM Q
Sbjct  711  CFINTCSKMNDRCAIVMVQ  729



>ref|XP_010471276.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=758

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  Q+AK+I L KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +  
Sbjct  570  LTVQKAKDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQ  629

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPG  373
              +E K    P  + +   +P  Q    M RN           G GFG++ AT +N PP 
Sbjct  630  QDDEEKTMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNIVATLKNVPPW  689

Query  372  STSKPEA--AEMFVQAAS  325
                 EA  AE+ ++AAS
Sbjct  690  MEEPKEADGAELLIRAAS  707



>ref|XP_010428136.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Camelina sativa]
 ref|XP_010428137.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Camelina sativa]
Length=758

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  Q+AK+I L KVLA++QI+ LTA AWF   K+L+EK+ R S+Q G  SEYT M  +  
Sbjct  570  LTVQKAKDIPLDKVLARRQIDELTARAWFEDKKELQEKVMRLSIQTGAPSEYTQMVLSLQ  629

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPG  373
              +E K    P  + +   +P  Q    M RN           G GFG++ AT +N PP 
Sbjct  630  QDDEEKTMARPVSIKEILRNPPYQIHKQMQRNNSFRTSLLGKQGYGFGNVVATLKNVPPW  689

Query  372  STSKPEA--AEMFVQAAS  325
                 EA  AE+ ++AAS
Sbjct  690  MEEPKEADGAELLIRAAS  707



>gb|EEE59232.1| hypothetical protein OsJ_11214 [Oryza sativa Japonica Group]
Length=718

 Score = 87.8 bits (216),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 52/124 (42%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +  
Sbjct  542  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQN  601

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  343
               K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EM
Sbjct  602  FVEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEM  659

Query  342  FVQA  331
            F +A
Sbjct  660  FDKA  663


 Score = 26.2 bits (56),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++ND+CA+VM Q
Sbjct  678  CFINTCSKMNDRCAIVMVQ  696



>ref|XP_008667805.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=756

 Score = 85.9 bits (211),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 5/123 (4%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T
Sbjct  575  LKVQHIKDIPLDKVLAKQQMDLLTAKAWLMENKELERKVVKLSIQNSLPSEYTRMVLLQT  634

Query  516  EETK---GTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAE  346
               K        +K  K++  P    A + L  L +GFGD+ AT EN   G     +AAE
Sbjct  635  SLDKIDPAQQAKNKPTKQSSSPDELPA-MPLGGLAVGFGDVAATTENLTTGFGDM-KAAE  692

Query  345  MFV  337
             FV
Sbjct  693  KFV  695


 Score = 28.1 bits (61),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 19/43 (44%), Gaps = 7/43 (16%)
 Frame = -2

Query  359  QKQQRCLCRQPQTVAKWCVISAVACVAFRCVQINDQCAVVMTQ  231
            +K   C  R        C I A       C ++NDQCA+VM Q
Sbjct  698  EKAAGCCSRMADCCCCMCFIKA-------CSKMNDQCAIVMAQ  733



>gb|AAG52586.1|AC016529_17 hypothetical protein; 14673-17893 [Arabidopsis thaliana]
Length=758

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            L  Q+AK+I L KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M     
Sbjct  571  LTVQKAKDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSVK  630

Query  522  GTEETKGTTEPSKVNKKTGDP------KLQKAIIMLRNL----GLGFGDLTATAENTPP-  376
              EE K    P  + +   +P      ++Q++  M R+L    G GFG++ AT +N PP 
Sbjct  631  HDEEEKTMARPVSIKEILRNPPYQIHKQMQRSNSMRRSLLGKQGYGFGNVAATLKNVPPW  690

Query  375  -GSTSKPEAAEMFVQAAS  325
                 + E  E+ ++AAS
Sbjct  691  MEEPKEVEGTELLIRAAS  708



>ref|NP_177394.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35331.1| uncharacterized protein AT1G72500 [Arabidopsis thaliana]
Length=756

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI--  523
            L  Q+AK+I L KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M     
Sbjct  569  LTVQKAKDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSVK  628

Query  522  GTEETKGTTEPSKVNKKTGDP------KLQKAIIMLRNL----GLGFGDLTATAENTPP-  376
              EE K    P  + +   +P      ++Q++  M R+L    G GFG++ AT +N PP 
Sbjct  629  HDEEEKTMARPVSIKEILRNPPYQIHKQMQRSNSMRRSLLGKQGYGFGNVAATLKNVPPW  688

Query  375  -GSTSKPEAAEMFVQAAS  325
                 + E  E+ ++AAS
Sbjct  689  MEEPKEVEGTELLIRAAS  706



>gb|KHN01425.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Glycine soja]
Length=753

 Score = 87.8 bits (216),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 50/132 (38%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK +  K++ LS VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  
Sbjct  567  LKVKREKDMQLSNVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLV  626

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKP  358
            +  +G   P +   +    KL    + L N       L LGFGDL ATAEN PP      
Sbjct  627  QSDEGKKAPEQFLLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAK  686

Query  357  EAAEMFVQAASN  322
                +  +AASN
Sbjct  687  PPEGLLGKAASN  698


 Score = 25.4 bits (54),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +NDQC +V TQ
Sbjct  711  CLLQTCTFVNDQCTIVCTQ  729



>ref|XP_003528576.1| PREDICTED: uncharacterized protein LOC100807956 isoform X1 [Glycine 
max]
Length=756

 Score = 87.4 bits (215),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 50/132 (38%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK +  K++ LS VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  
Sbjct  570  LKVKREKDMQLSNVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLV  629

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKP  358
            +  +G   P +   +    KL    + L N       L LGFGDL ATAEN PP      
Sbjct  630  QSDEGKKAPEQFLLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAK  689

Query  357  EAAEMFVQAASN  322
                +  +AASN
Sbjct  690  PPEGLLGKAASN  701


 Score = 25.4 bits (54),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +NDQC +V TQ
Sbjct  714  CLLQTCTFVNDQCTIVCTQ  732



>ref|NP_001050335.2| Os03g0407000 [Oryza sativa Japonica Group]
 dbj|BAF12249.2| Os03g0407000, partial [Oryza sativa Japonica Group]
Length=360

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +  
Sbjct  184  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQN  243

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  343
               K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EM
Sbjct  244  FVEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEM  301

Query  342  FVQAA  328
            F +A 
Sbjct  302  FDKAV  306



>ref|XP_004984065.1| PREDICTED: uncharacterized protein LOC101774989 isoform X2 [Setaria 
italica]
Length=632

 Score = 87.4 bits (215),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T
Sbjct  452  LKVQHVKDIPLDKVLAKQQMDLLTAKAWLLENKELERKVVKLSIQNSLPSEYTRMVLLQT  511

Query  516  EETKGTTEPSKVNKKT--GDPKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
               K        NK T    P  +++ + LR L LGFGD+ AT EN   G
Sbjct  512  NLDKIDPAQQAKNKPTKQSSPD-ERSAMPLRGLTLGFGDVVATRENLTAG  560


 Score = 25.0 bits (53),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  272  CVQINDQCAVVMTQ  231
            C ++NDQCA+VM Q
Sbjct  596  CSKMNDQCAIVMAQ  609



>ref|XP_002888881.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65140.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 74/138 (54%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  Q+AK+I L KVLA++QI  LTA AWF   K+L+EK+ R S+Q G  SEYT M  +  
Sbjct  569  LTVQKAKDIPLDKVLARRQINELTARAWFEDKKELQEKVMRLSIQTGFPSEYTQMVLSLK  628

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPP-  376
              EE K    P  + +   +P  Q    M R+           G GFG++TAT +N PP 
Sbjct  629  HDEEEKTMARPVSIKEILRNPPYQIHKQMQRSNSVRTSLLGKQGYGFGNVTATLKNVPPW  688

Query  375  -GSTSKPEAAEMFVQAAS  325
                 + E  E+ ++AAS
Sbjct  689  IEEPKETEGTELLIRAAS  706



>gb|KFK41669.1| hypothetical protein AALP_AA2G157400 [Arabis alpina]
Length=761

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 52/137 (38%), Positives = 75/137 (55%), Gaps = 13/137 (9%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L  Q+AK+I L KVLA++QI+ LT+ AWF    +L+EK+ R S++ G   EYT +     
Sbjct  570  LTVQKAKDIPLDKVLARRQIDELTSRAWFEDKIELQEKVTRLSIETGFPCEYTQLVLSLK  629

Query  516  E---ETKGTTEPSKVNKKTGDPKLQKAIIMLRN---------LGLGFGDLTATAENTPPG  373
            +   E K  T P+ + +   +P  Q    M RN          G GFG++ AT +N PP 
Sbjct  630  DEEGEEKTITRPASIKEILRNPPYQIHKQMTRNSERTSLLGKQGFGFGNVAATLKNIPPW  689

Query  372  STSK-PEAAEMFVQAAS  325
               K PE AE+ ++AAS
Sbjct  690  MEEKEPEGAEILIKAAS  706



>ref|XP_002465153.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
 gb|EER92151.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
Length=756

 Score = 85.9 bits (211),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 52/125 (42%), Positives = 70/125 (56%), Gaps = 3/125 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLAKQQ+++LTA++W  +NK+LE K+ + S+Q+ + SEYT M  + T
Sbjct  576  LKVQHIKDIPLDKVLAKQQMDLLTAKSWLMENKELERKVVKLSIQNSLPSEYTRMVLLQT  635

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIM-LRNLGLGFGDLTATAEN--TPPGSTSKPEAAE  346
               K        NK T      +   M L  L LGFGD+ AT EN  T  G    PE   
Sbjct  636  SLDKIDPAQQAKNKPTKQSSPDELPAMPLGGLALGFGDVAATRENLTTGFGDMKAPEKFV  695

Query  345  MFVQA  331
            +F +A
Sbjct  696  IFEKA  700


 Score = 25.4 bits (54),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVM  237
            C    C ++NDQCA+VM
Sbjct  715  CFIKACSKMNDQCAIVM  731



>gb|ABF96528.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=477

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT    +  
Sbjct  301  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYTRTILLQN  360

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEM  343
               K   E  K   K    + +++   L  L LGFGD  AT EN     G T  PE  EM
Sbjct  361  FVEK--IEQGKQKPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEM  418

Query  342  FVQAA  328
            F +A 
Sbjct  419  FDKAV  423



>gb|KJB07323.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=781

 Score = 86.7 bits (213),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 83/158 (53%), Gaps = 33/158 (21%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK   AK+I L +VL++Q+I++LTA+AW ++NK+LE+K+A+ S     +SEYT M  +  
Sbjct  570  LKIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVAQLSKVTCNISEYTRMVLLEK  629

Query  516  EETKGTTEPSKVNK--------------------------KTGDPK-----LQKAIIMLR  430
             +     E S   K                          K  DP      L     +L+
Sbjct  630  NKIDKAIESSGAQKVCLSLIRNSIITVNLNSQKLGFSIQVKKTDPHKIKDPLAPRKTLLQ  689

Query  429  NLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASN  322
            +L +GFGDLTATAEN  PG   +  P+AAE+F++A S+
Sbjct  690  SLSVGFGDLTATAENIRPGFEQQKLPDAAEVFLKATSD  727


 Score = 24.6 bits (52),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -2

Query  266  QINDQCAVVMTQ  231
            ++NDQCA+V+TQ
Sbjct  747  KMNDQCAIVLTQ  758



>ref|XP_009404352.1| PREDICTED: uncharacterized protein LOC103987694 [Musa acuminata 
subsp. malaccensis]
Length=750

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/126 (35%), Positives = 75/126 (60%), Gaps = 4/126 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIG-  520
            +K Q  K+  L K    Q I++LTA+AWF+++K+L+EK+ + S+Q  I SEYT M F+  
Sbjct  570  MKVQNTKDFPLEKAFVNQHIDLLTAQAWFSESKQLKEKVTKLSIQSSIPSEYTCMVFLQK  629

Query  519  -TEETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAA  349
             TE+ +   +  K + +         +I++R++ +GFGD+TAT EN P   G   +P  +
Sbjct  630  ETEKDESLKKVKKRDSRKHAGSKDNLLILVRDMAIGFGDITATIENHPTVLGEPKEPATS  689

Query  348  EMFVQA  331
             ++ +A
Sbjct  690  LVYNKA  695



>ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-trypsin inhibitor, 
heavy chain 4-like [Phoenix dactylifera]
Length=746

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 8/128 (6%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ +  K+I L KV AKQ I++LTAEAWF+++K+LEEKI + S++  + SEYT M  + T
Sbjct  569  LEVKNTKDIPLEKVFAKQHIDLLTAEAWFSESKQLEEKIIKLSMRSSVPSEYTYMILLQT  628

Query  516  EETKGTTEPSKVNKKTGDPK----LQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPE  355
            +  K   +  K  KK G  K      +  I++  L +GFG++ AT+EN P   G    PE
Sbjct  629  DTEK--QDAVKQAKKHGSQKHAGPKNRLSILVHGLTIGFGNIVATSENLPTGFGEPKLPE  686

Query  354  AAEMFVQA  331
              ++  +A
Sbjct  687  TNDVLEKA  694



>ref|NP_001141509.1| hypothetical protein [Zea mays]
 gb|ACF86519.1| unknown [Zea mays]
 tpg|DAA45736.1| TPA: hypothetical protein ZEAMMB73_410449 [Zea mays]
Length=357

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 9/125 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLAKQQ+++LTA+AW  +NK+LE K+ + S+Q+ + SEYT M  + T
Sbjct  176  LKVQHIKDIPLDKVLAKQQMDLLTAKAWLMENKELERKVVKLSIQNSLPSEYTRMVLLQT  235

Query  516  EETKGTTEPS-----KVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEA  352
               K   +P+     K  K++  P    A + L  L +GFGD+ AT EN   G     +A
Sbjct  236  SLDK--IDPAQQAKNKPTKQSSSPDELPA-MPLGGLAVGFGDVAATTENLTTG-FGDMKA  291

Query  351  AEMFV  337
            AE FV
Sbjct  292  AEKFV  296



>ref|XP_006598837.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1-like 
[Glycine max]
Length=665

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 7/132 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFI  523
            LK +  K++ LS VL+K+ I+ +TA+AW  K+++LEEK+ + S+Q+ + SEYT  NM  +
Sbjct  479  LKVKREKDMQLSNVLSKRHIDQVTAQAWLLKSEELEEKVTKMSIQNKVPSEYTCMNMVLV  538

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKA-----IIMLRNLGLGFGDLTATAENTPPGSTSKP  358
             ++E K T E   + K       QK       + L  L LGFGDL ATAEN PP      
Sbjct  539  QSDEGKKTPEQFLLQKAYNKLSFQKLELNNQNLFLGGLSLGFGDLKATAENLPPAIKEAK  598

Query  357  EAAEMFVQAASN  322
                +  +AASN
Sbjct  599  PPEGLLGRAASN  610



>gb|AET01809.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=753

 Score = 83.2 bits (204),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 17/136 (13%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFI  523
            LK +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  +
Sbjct  566  LKVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILV  625

Query  522  GTEETKGTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
               + K   EP  + K  G           PKL      L  L  GFGDL ATAENTPP 
Sbjct  626  NKNDVKKEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPA  680

Query  372  STSKPEAAEMFVQAAS  325
            +     +  +  +AAS
Sbjct  681  TKEAKPSEGLLGKAAS  696


 Score = 25.0 bits (53),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +NDQC +V TQ
Sbjct  710  CLLKTCSFVNDQCTIVCTQ  728



>ref|XP_004958289.1| PREDICTED: uncharacterized protein LOC101756562 [Setaria italica]
Length=751

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 51/125 (41%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  KEI L KVLA QQI +LT++AW + +K+LE K+ + S+Q+ I SEYT M  + T
Sbjct  571  LKVQHLKEIPLDKVLATQQISLLTSKAWLSADKQLERKVIKLSIQNSIPSEYTEMVLLQT  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAAEMF  340
               K         K  G     +  I L  L LGFGD  AT EN   G    +P    + 
Sbjct  631  NLDKVDATQKVKQKLKGQKGPDEIRIPLDGLKLGFGDKGATRENLITGYGDVRPPEKSVI  690

Query  339  VQAAS  325
            +Q AS
Sbjct  691  MQKAS  695



>ref|XP_002461009.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
 gb|EER97530.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
Length=751

 Score = 80.9 bits (198),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 0/118 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ KEI L KVL  +QI+++TA+AW + +K+LE K+ + S+Q+G+ SEYT M  + T
Sbjct  571  LKVQQLKEIPLDKVLVTKQIDLMTAKAWLSADKQLERKVIKLSIQNGVPSEYTEMTLLQT  630

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEM  343
               K         K  G     +  I++  L LGFG+  AT EN   G   +  A ++
Sbjct  631  NLDKVDGTQKVKQKLKGQKGRDEQRILMHGLKLGFGNKDATRENLITGFGDRNPAEKL  688


 Score = 26.2 bits (56),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++NDQCA++M Q
Sbjct  709  CCIKACNRMNDQCAILMAQ  727



>ref|XP_007135423.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07417.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=752

 Score = 80.9 bits (198),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 47/131 (36%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFI  523
            LK +  K+I LS VLAK+ I+++TA+AW  K++++EEK+ + S+Q+ ++SEYT  NM  +
Sbjct  567  LKVKREKDIQLSNVLAKRHIDMVTAQAWLLKSEEVEEKVTKMSIQNKVLSEYTCMNMVLV  626

Query  522  GTEETKGTTEPSKVNKKTGDPKLQK-----AIIMLRNLGLGFGDLTATAENTPPGSTSKP  358
             ++E K   E   + K       Q+       + L  L +GFGD  ATAEN  P      
Sbjct  627  QSDEGKKPPEQFLLKKAYNKLSFQQLEFDMKKLFLGGLSVGFGDSKATAENLAPSIKEAK  686

Query  357  EAAEMFVQAAS  325
                +  +AAS
Sbjct  687  PPEGLLGKAAS  697


 Score = 25.8 bits (55),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +NDQC +V TQ
Sbjct  711  CLLQACTLVNDQCTIVCTQ  729



>ref|XP_010235662.1| PREDICTED: uncharacterized protein LOC100843408 [Brachypodium 
distachyon]
Length=746

 Score = 80.5 bits (197),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+  L +VLA QQI +LTA+AWF+ +K+LE K+   S+Q+ ++SEYT M  + T
Sbjct  568  LKVQHIKDTPLDEVLAAQQIALLTAKAWFSADKQLERKVMDLSIQNSVLSEYTRMVVLQT  627

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEM  343
                G  +  K   K      +   I L  L LGFGD  AT +N  T  G    PE  ++
Sbjct  628  --NLGAAQKGKQKTKGHKGSNEPLRIPLHGLKLGFGDKAATRDNLLTGFGEEKPPETLKI  685

Query  342  FVQAA  328
            F +A 
Sbjct  686  FKKAG  690


 Score = 26.2 bits (56),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++NDQCA++M Q
Sbjct  704  CCIKACNRMNDQCAIMMAQ  722



>gb|EEE67586.1| hypothetical protein OsJ_25118 [Oryza sativa Japonica Group]
Length=755

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 52/125 (42%), Positives = 69/125 (55%), Gaps = 2/125 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T
Sbjct  576  LKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQT  635

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEM  343
             E     +  K   K      +   I L+ L LGFGD  AT EN  T  G     E  E+
Sbjct  636  LEKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEI  695

Query  342  FVQAA  328
              +AA
Sbjct  696  LNKAA  700



>dbj|BAC80088.1| unknown protein [Oryza sativa Japonica Group]
Length=342

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 0/108 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T
Sbjct  163  LKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQT  222

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
             E     +  K   K      +   I L+ L LGFGD  AT EN   G
Sbjct  223  LEKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTG  270



>ref|XP_006658810.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like, 
partial [Oryza brachyantha]
Length=703

 Score = 79.3 bits (194),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLA QQI +LTA+AW + +K LE ++ + S+Q+ I SEYT+M  + T
Sbjct  525  LKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKHLEREVVKLSIQNSIPSEYTSMVLLQT  584

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEM  343
             E        K+    G  + Q+  I L  L LGFG+  AT +N  T       PE  E+
Sbjct  585  LEKVVEQVKQKLKGHKGADEPQR--IPLHGLKLGFGNKAATRDNLITAFDDVKPPETFEI  642

Query  342  FVQAA  328
              +AA
Sbjct  643  LNKAA  647


 Score = 26.9 bits (58),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  272  CVQINDQCAVVMTQ  231
            C ++NDQCA+VM Q
Sbjct  666  CNKMNDQCAIVMAQ  679



>gb|EEC82439.1| hypothetical protein OsI_26857 [Oryza sativa Indica Group]
Length=863

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 52/125 (42%), Positives = 69/125 (55%), Gaps = 2/125 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T
Sbjct  684  LKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQT  743

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN--TPPGSTSKPEAAEM  343
             E     +  K   K      +   I L+ L LGFGD  AT EN  T  G     E  E+
Sbjct  744  LEKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTGFGDVKPLETFEI  803

Query  342  FVQAA  328
              +AA
Sbjct  804  LNKAA  808



>ref|NP_001060262.2| Os07g0614300 [Oryza sativa Japonica Group]
 dbj|BAF22176.2| Os07g0614300, partial [Oryza sativa Japonica Group]
Length=352

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 0/108 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K+I L KVLA QQI +LTA+AW + +K+LE K+ + S+Q+ I SEYT+M  + T
Sbjct  173  LKVQHIKDIPLDKVLAAQQIGLLTAKAWLSSDKQLERKVVKLSIQNSIPSEYTSMVLLQT  232

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
             E     +  K   K      +   I L+ L LGFGD  AT EN   G
Sbjct  233  LEKVDAAQKVKQKLKGHKGPDEPRRIPLQCLKLGFGDRAATRENLVTG  280



>ref|XP_006301970.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
 gb|EOA34868.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
Length=757

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 76/138 (55%), Gaps = 14/138 (10%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM--AFI  523
            L  Q+AK+I L KVLA++QI  LTA AWF + K+LEEK+ R S+Q G  SEYT M  +  
Sbjct  569  LAVQKAKDIPLDKVLARRQINELTARAWFEEKKELEEKVMRLSIQTGFPSEYTQMVLSLK  628

Query  522  GTEETKGTTEPSKVNKKTGDPKLQKAIIMLRN----------LGLGFGDLTATAENTPPG  373
              EE K  T P  + +   +P  Q    M RN           G GFG++ AT +N PP 
Sbjct  629  QDEEEKTITRPVSIKEILRNPPYQIHKQMQRNNSMRTSLLGKQGYGFGNVVATLKNVPPW  688

Query  372  STSKPEA--AEMFVQAAS  325
                 EA  AE+ ++AAS
Sbjct  689  MEEPKEAEGAELLIRAAS  706



>ref|XP_009389548.1| PREDICTED: uncharacterized protein LOC103976087 [Musa acuminata 
subsp. malaccensis]
Length=747

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 8/113 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K++ L K LAKQ I++LT++AWF+++K+LEEK+ + S+Q  I SEYT M  + T
Sbjct  570  LKVQDTKDLSLEKALAKQHIDLLTSQAWFSESKQLEEKVIKLSIQSSIPSEYTCMVLLQT  629

Query  516  E----ETKGTTEPSKVNKKTG-DPKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
            E    E     +  +  K +G D  L    I +R++  GFG++ AT EN P G
Sbjct  630  ETEKQEAVKKVKKRESRKHSGPDDNLS---ISVRSMVNGFGNVIATKENRPTG  679



>ref|XP_003627335.1| hypothetical protein MTR_8g021260 [Medicago truncatula]
Length=260

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 17/136 (13%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFI  523
            LK +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  +
Sbjct  73   LKVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILV  132

Query  522  GTEETKGTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
               + K   EP  + K  G           PKL      L  L  GFGDL ATAENTPP 
Sbjct  133  NKNDVKKEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPA  187

Query  372  STSKPEAAEMFVQAAS  325
            +     +  +  +AAS
Sbjct  188  TKEAKPSEGLLGKAAS  203



>ref|XP_006583165.1| PREDICTED: uncharacterized protein LOC100807956 isoform X2 [Glycine 
max]
Length=699

 Score = 78.6 bits (192),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 7/120 (6%)
 Frame = -1

Query  660  KVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETKGTTEPSKV  481
            +VL+K+ I+ +TA+AW  K+K+LEEK+ + S+Q+ + SEYT M  +  +  +G   P + 
Sbjct  525  EVLSKRHIDQVTAQAWLLKSKELEEKVTKMSIQNKVPSEYTCMNIVLVQSDEGKKAPEQF  584

Query  480  NKKTGDPKLQKAIIMLRN-------LGLGFGDLTATAENTPPGSTSKPEAAEMFVQAASN  322
              +    KL    + L N       L LGFGDL ATAEN PP          +  +AASN
Sbjct  585  LLQKAYNKLSFQKLELNNQNLFLGGLNLGFGDLKATAENLPPAIKEAKPPEGLLGKAASN  644


 Score = 25.4 bits (54),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +NDQC +V TQ
Sbjct  657  CLLQTCTFVNDQCTIVCTQ  675



>gb|KEH18484.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=596

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 17/136 (13%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT--NMAFI  523
            LK +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT   M  +
Sbjct  409  LKVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILV  468

Query  522  GTEETKGTTEPSKVNKKTGD----------PKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
               + K   EP  + K  G           PKL      L  L  GFGDL ATAENTPP 
Sbjct  469  NKNDVKKEPEPFLLQKAYGTLSFKGLEVEIPKL-----FLGGLSHGFGDLKATAENTPPA  523

Query  372  STSKPEAAEMFVQAAS  325
            +     +  +  +AAS
Sbjct  524  TKEAKPSEGLLGKAAS  539



>ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Elaeis 
guineensis]
Length=747

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 66/112 (59%), Gaps = 6/112 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            L+ +  K+I L KV AKQ I++LTAEAWF+++K+L+EK  + S++  + SEYT M  + T
Sbjct  569  LEVKNTKDIPLEKVFAKQHIDLLTAEAWFSESKQLKEKAIKISMRSSVPSEYTYMILLQT  628

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLR----NLGLGFGDLTATAENTPPG  373
            +  K   +  K  KK G  K       LR     L +GFG++ AT EN P G
Sbjct  629  DTEK--QDAVKQVKKHGSQKDAGPKNCLRIRVHGLAIGFGNVNATLENLPTG  678



>tpg|DAA63586.1| TPA: hypothetical protein ZEAMMB73_270893 [Zea mays]
Length=750

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 47/128 (37%), Positives = 72/128 (56%), Gaps = 9/128 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ KEI L KVL  QQI+ +T++AW + +K++E K+ + S Q+G+ SEYT+M F+ T
Sbjct  572  LKVQQLKEIPLDKVLVIQQIDFMTSKAWMSADKQVERKVIKLSTQNGVPSEYTDMIFLQT  631

Query  516  --EETKGTTE-PSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG-STSKPEAA  349
              ++ +GT +   K+    G  + Q     +  L LGFG+  AT EN   G     P   
Sbjct  632  NLDKVEGTQKVKQKLKGHKGRDEQQ-----IYGLKLGFGNKDATRENLITGFGDMNPAEK  686

Query  348  EMFVQAAS  325
             + +Q  S
Sbjct  687  SVMLQKGS  694



>ref|XP_008653341.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Zea mays]
Length=521

 Score = 73.6 bits (179),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 67/111 (60%), Gaps = 8/111 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ KEI L KVL  QQI+ +T++AW + +K++E K+ + S Q+G+ SEYT+M F+ T
Sbjct  343  LKVQQLKEIPLDKVLVIQQIDFMTSKAWMSADKQVERKVIKLSTQNGVPSEYTDMIFLQT  402

Query  516  --EETKGTTE-PSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPG  373
              ++ +GT +   K+    G  + Q     +  L LGFG+  AT EN   G
Sbjct  403  NLDKVEGTQKVKQKLKGHKGRDEQQ-----IYGLKLGFGNKDATRENLITG  448


 Score = 23.9 bits (50),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  272  CVQINDQCAVVMTQ  231
            C ++NDQCAV+M Q
Sbjct  484  CNRMNDQCAVLMAQ  497



>ref|XP_006836596.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
 gb|ERM99449.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
Length=761

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q  + I   K+LAKQ I++LTA+AWF ++K LEE++ + S+  GI SE+T+M    T
Sbjct  572  VKVQRLENIPFVKMLAKQHIDLLTAQAWFHEDKHLEEQVVKMSMHTGIPSEFTHMVLFQT  631

Query  516  EETKGTT------EPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAENTPPGSTSKPE  355
            E  K ++        +KV+           I  +  L +GFG + AT  N P  S+    
Sbjct  632  EREKHSSLVHELKLGNKVDFSEYTTSKASKITFVHGLTVGFGSIEATENNIPIESSELNV  691

Query  354  AAEMF  340
            +  +F
Sbjct  692  SKSIF  696



>dbj|BAK07105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 64/111 (58%), Gaps = 8/111 (7%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K++ L  V A QQI +LTA+AW + +K+LE K+ + S+++ ++SEYT+M  + T
Sbjct  232  LKVQHIKDMPLDNVFAPQQIALLTAKAWLSADKQLERKVIKLSIENSVLSEYTSMVVLQT  291

Query  516  --EETKGTTEPSKVNKKTGDP-KLQKAIIMLRNLGLGFGDLTATAENTPPG  373
              +  +   +  K +K   +P + Q     L  L LGFGD  AT EN   G
Sbjct  292  NLDAAQKVKQKPKGHKGANEPLRFQ-----LHGLKLGFGDKAATKENLLTG  337



>gb|KJB83726.1| hypothetical protein B456_013G261400 [Gossypium raimondii]
Length=644

 Score = 70.5 bits (171),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 70/134 (52%), Gaps = 21/134 (16%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK + AK+I L  VLA++QI+          N  L   +A+ S+Q   +SEYT M  +  
Sbjct  491  LKIRRAKDIPLDSVLARRQIDA-------ANNSGL---VAKLSIQTCNISEYTRMTLLEK  540

Query  516  EETKGTTEPSKVNKKTGDPKLQKAI-------IMLRNLGLGFGDLTATAENTPPGSTSK-  361
             +     +     KK GDP  QK +       I+L+ L +GFGDL ATAEN  PGS    
Sbjct  541  NKMLKALKHFGAWKKKGDP--QKIVESEPPEMILLQRLSVGFGDLIATAENIRPGSQEPE  598

Query  360  -PEAAEMFVQAASN  322
             PE A++F++  SN
Sbjct  599  LPEVAKIFIKTTSN  612


 Score = 23.5 bits (49),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 17/28 (61%), Gaps = 4/28 (14%)
 Frame = -2

Query  314  KWCVISAVACVAFRCVQINDQCAVVMTQ  231
            +WC +  + C    C ++N+QCA  +TQ
Sbjct  620  RWCCMGCIRC----CSKMNNQCATTLTQ  643



>ref|XP_010537629.1| PREDICTED: uncharacterized protein LOC104812256 [Tarenaya hassleriana]
Length=763

 Score = 70.1 bits (170),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 66/118 (56%), Gaps = 13/118 (11%)
 Frame = -1

Query  696  LKAQEAKEI--XLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFI  523
            L  Q+AK++   L KVLA++QI+ LTA AWF   K+++EK+ + S++ G   EYT M   
Sbjct  576  LTVQKAKDMIMPLDKVLARRQIDELTARAWFEDRKEIQEKVKKLSIETGFPCEYTPMVLF  635

Query  522  GTEETKGTTEPSKVNKKTGDP----------KLQKAIIMLRNLGLGFGDLTATAENTP  379
              E+ K  ++P  + +   +P          K +K+++M      GFG+  ATA+N P
Sbjct  636  KQEDEKIISKPLSIKEILRNPPYEIQKHMQKKSEKSMVM-GTQSRGFGNADATAKNVP  692


 Score = 23.1 bits (48),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 2/23 (9%)
 Frame = -2

Query  293  VACVA-FRCVQ-INDQCAVVMTQ  231
            V C+   RCV  +NDQC +V +Q
Sbjct  718  VCCMCCLRCVSGVNDQCTIVFSQ  740



>ref|XP_004510514.1| PREDICTED: uncharacterized protein LOC101499440 [Cicer arietinum]
Length=757

 Score = 70.5 bits (171),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 78/142 (55%), Gaps = 25/142 (18%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q  K++ L+ V +K+ ++++TA+AW  ++++LEEK+++ S+Q+ + SEYT M  +  
Sbjct  566  LKVQREKDMQLTNVFSKRHVDLVTAQAWLLESEELEEKVSKMSIQNNVPSEYTCMEMVLV  625

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGL-----------------GFGDLTATAE  388
            ++  G        K +G+  L+KA   +  L L                 GFGDL AT+E
Sbjct  626  KKDDG-------KKASGEFMLKKAYSQVSKLSLQGLEIERPKLFLGGLRHGFGDLKATSE  678

Query  387  NTPPGST-SKPEAAEMFVQAAS  325
            N PP +  +KP    +  +AAS
Sbjct  679  NIPPATKEAKPSDPGLLEKAAS  700


 Score = 22.7 bits (47),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 8/19 (42%), Positives = 11/19 (58%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C+   C  +ND C +V TQ
Sbjct  714  CLLKTCSLVNDSCTIVCTQ  732



>tpg|DAA41434.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=758

 Score = 64.7 bits (156),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIA----RASVQHGIVSEYTNMA  529
            LK Q+ KE+ L KVL  Q I+++TA+AW +  K+LE K+     + S+Q+G+ SEYT+M 
Sbjct  573  LKVQQLKEVTLDKVLVTQHIDLMTAKAWLSAAKQLERKVGYLVIKLSIQNGVPSEYTDMV  632

Query  528  FIGT--EETKGTTEPSKVNKKTG--DPKLQKAIIMLR  430
             + T  + T    + ++ N  TG  D    + I+ML+
Sbjct  633  LLQTNLDNTGTQKDATRENLVTGFWDVNSAEKIVMLQ  669


 Score = 27.7 bits (60),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 7/43 (16%)
 Frame = -2

Query  359  QKQQRCLCRQPQTVAKWCVISAVACVAFRCVQINDQCAVVMTQ  231
            QK   C  R    +   C I A       C ++NDQCA++M Q
Sbjct  669  QKGPGCCSRVADCLCCMCCIRA-------CNRMNDQCAILMAQ  704



>tpg|DAA41433.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=1295

 Score = 64.7 bits (156),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIA----RASVQHGIVSEYTNMA  529
            LK Q+ KE+ L KVL  Q I+++TA+AW +  K+LE K+     + S+Q+G+ SEYT+M 
Sbjct  573  LKVQQLKEVTLDKVLVTQHIDLMTAKAWLSAAKQLERKVGYLVIKLSIQNGVPSEYTDMV  632

Query  528  FIGT--EETKGTTEPSKVNKKTG--DPKLQKAIIMLR  430
             + T  + T    + ++ N  TG  D    + I+ML+
Sbjct  633  LLQTNLDNTGTQKDATRENLVTGFWDVNSAEKIVMLQ  669


 Score = 27.3 bits (59),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 7/43 (16%)
 Frame = -2

Query  359  QKQQRCLCRQPQTVAKWCVISAVACVAFRCVQINDQCAVVMTQ  231
            QK   C  R    +   C I A       C ++NDQCA++M Q
Sbjct  669  QKGPGCCSRVADCLCCMCCIRA-------CNRMNDQCAILMAQ  704



>gb|AAU89244.1| von Willebrand factor type A domain containing protein [Oryza 
sativa Japonica Group]
Length=801

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 55/172 (32%), Positives = 73/172 (42%), Gaps = 50/172 (29%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEK----------------------  583
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K                      
Sbjct  575  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKSGMRFTTVHCIMSYKVMLNLHY  634

Query  582  -IARASVQHGIVSEYTN----MAFIGTEETKGTTEPS------KVNKKTGDPKL------  454
             + + S+Q+ I SEYT       F+   E    TE            +T D  L      
Sbjct  635  EVVKLSIQNSIPSEYTRTILLQNFVEKIEQVFVTEGGVLYMFFSYGNRTLDETLKLKGKQ  694

Query  453  ---------QKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQA  331
                     +++   L  L LGFGD  AT EN     G T  PE  EMF +A
Sbjct  695  KPKKNSTQNEQSATSLNGLTLGFGDTAATRENLSAGFGDTKPPERFEMFDKA  746


 Score = 26.2 bits (56),  Expect(2) = 3e-10, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  287  CVAFRCVQINDQCAVVMTQ  231
            C    C ++ND+CA+VM Q
Sbjct  761  CFINTCSKMNDRCAIVMVQ  779



>gb|KJB65319.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=646

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK ++A  I L K+ A+QQI++LTA+AWF++NK+LEEK+A+ S++   +SEYT M  +  
Sbjct  568  LKIEKAMNISLDKISARQQIDLLTAQAWFSENKQLEEKVAKLSLRTCNISEYTRMILLEK  627

Query  516  EETKGTTEPSKVNKKTG  466
             + +  T+ ++  KK G
Sbjct  628  GKIERDTDTTEARKKLG  644



>gb|EMT10977.1| hypothetical protein F775_14225 [Aegilops tauschii]
Length=584

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q   ++ L  + A QQI +LTA+AW + +K+LE K+ + S+++ ++SEYT+M  + T
Sbjct  406  LKVQHITDMPLDNIFAAQQIALLTAKAWLSADKQLERKVIKLSIENSVLSEYTSMVVLQT  465

Query  516  EETKGTTEPSKVNKKTGDPKLQKAIIMLRNLGLGFGDLTATAEN  385
                      K   +TG  +  +    L  L LGFGD  AT EN
Sbjct  466  NLDAAQKVKQKPKGRTGANEPLR--FQLHGLKLGFGDKAATREN  507



>ref|XP_010318476.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028 isoform X4 [Solanum lycopersicum]
Length=641

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            +K Q+AK++ L +V AK+QIE +T  AWF+ +K+LEE +A+ S+Q G+ SEYTN+  +  
Sbjct  565  VKVQKAKDLPLERVFAKRQIETITGNAWFSGSKQLEEMVAKLSLQTGVPSEYTNLILVEN  624

Query  516  EETKGTTEPSKVNK  475
             + K T++   V++
Sbjct  625  LKEKQTSKLETVDE  638



>gb|ABF96529.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=680

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT  538
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+ + S+Q+ I SEYT
Sbjct  575  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKVVKLSIQNSIPSEYT  627



>ref|XP_007135424.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07418.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=650

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK +  K+I LS VLAK+ I+++TA+AW  K++++EEK+ + S+Q+ ++SEYT M  +  
Sbjct  567  LKVKREKDIQLSNVLAKRHIDMVTAQAWLLKSEEVEEKVTKMSIQNKVLSEYTCMNMVLV  626

Query  516  EETKGTTEP  490
            +  +G   P
Sbjct  627  QSDEGKKPP  635



>ref|XP_003609990.1| von Willebrand factor A domain-containing protein [Medicago truncatula]
Length=844

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK Q+ K I + +V A+ QI+ LTA+AW ++NK+LE+K+A+ S+Q G +SEYT M  +  
Sbjct  592  LKIQKDKGIPVQRVSARDQIQHLTAQAWLSENKQLEQKVAKLSLQTGFISEYTCMIILEN  651

Query  516  EETKGTTE  493
            +  K   E
Sbjct  652  DHLKKIKE  659


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -1

Query  444  IIMLRNLGLGFGDLTATAENTPPGSTSKPEAAEMFVQAASN  322
            +I+L NLG+GFG+L ATAENTPPG  +K E AE+F +AASN
Sbjct  750  MILLPNLGVGFGNLKATAENTPPGYEAKIEMAEIF-KAASN  789



>gb|KHN06057.1| hypothetical protein glysoja_035963 [Glycine soja]
Length=178

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSE  544
            +K Q+AK+I + ++ A+ QIE LTA+AW +K++KLE+K+A+ S+Q+  +SE
Sbjct  128  MKIQDAKDIPVQRICARDQIEYLTAQAWLSKDEKLEQKVAKLSLQNDFISE  178



>ref|XP_006385522.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63319.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=690

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMA  529
            LKAQ+ K++   +V+ ++QI++LTA AW + +K+LE+K+A+ S+Q G  SEYT M 
Sbjct  575  LKAQKTKDLPFDRVVGRRQIDLLTANAWLSGSKELEQKVAKMSIQTGFPSEYTLMV  630



>ref|XP_007216978.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
 gb|EMJ18177.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
Length=624

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYT  538
            LK Q +KE  L +VLA++ I++LTA AW   +K+LEEK+++ S Q G+ SEYT
Sbjct  562  LKVQRSKEFPLDRVLARRHIDMLTAHAWLLGSKELEEKVSKMSKQTGVPSEYT  614



>gb|EPS65940.1| hypothetical protein M569_08838, partial [Genlisea aurea]
Length=637

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = -1

Query  696  LKA-QEAKEIXLSKVLAKQQIEILTAEAWFTK--NKKLEEKIARASVQHGIVSEYTNMAF  526
            LKA     +I + ++ AK +IE+LT++AW++   N +L+ K+A  S+Q+G+VSEYTNM  
Sbjct  572  LKAVDHGSDIVIPQITAKLRIELLTSQAWYSSSGNGELKHKVANLSIQNGVVSEYTNMVL  631

Query  525  IGT  517
            I T
Sbjct  632  IET  634



>gb|KDO73865.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=613

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASV  565
            LK Q AK+I L ++ AKQQI++LTA+AWF+++K+LEEK+  +++
Sbjct  570  LKLQLAKDIPLDRICAKQQIDLLTAQAWFSEDKRLEEKVRCSAI  613



>gb|KEH18485.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=648

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT M  I  
Sbjct  566  LKVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILV  625

Query  516  EETKGTTEP  490
             +     EP
Sbjct  626  NKNDVKKEP  634



>gb|KEH18487.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=491

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGT  517
            LK +  K++ L+ V +K+ I+++TA AW  ++++LEEK+++ S+Q+ + SEYT M  I  
Sbjct  409  LKVKREKDMKLTYVFSKRHIDLVTARAWLLESQELEEKVSKMSIQNNVPSEYTFMEMILV  468

Query  516  EETKGTTEP  490
             +     EP
Sbjct  469  NKNDVKKEP  477



>ref|XP_006452826.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66066.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=613

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASV  565
            LK Q AK++ L ++ AKQQI++LTA+AWF+++K+LEEK+  +++
Sbjct  570  LKLQLAKDLPLDRICAKQQIDLLTAQAWFSEDKRLEEKVRCSAI  613



>gb|ETO27230.1| hypothetical protein RFI_09901, partial [Reticulomyxa filosa]
Length=191

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -1

Query  684  EAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNMAFIGTEETK  505
            E   + + K+L KQ+I++LTA+AWF+++K +  K+ ++S++H + S YT++    T + K
Sbjct  102  ETPHLPVDKILIKQKIDLLTAQAWFSQDKAVIRKVVQSSIEHCVPSHYTSLIAFETRKEK  161



>gb|ETO32114.1| hypothetical protein RFI_05003 [Reticulomyxa filosa]
Length=278

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  684  EAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIARASVQHGIVSEYTNM  532
            E   + + K+  K++I++LTA+AWF+ +KK+E ++ + SV H I S+YT++
Sbjct  99   ETPHLPVDKIFVKEKIDLLTAQAWFSDDKKIENQVIQESVTHSIPSQYTSL  149



>gb|ABF96530.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=614

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKI  580
            L+ Q  K+I L KVLAKQQ+++LTA+AWF +N +LE K+
Sbjct  575  LRVQHVKDISLDKVLAKQQMDLLTAKAWFYENNQLEMKV  613



>ref|XP_010477112.1| PREDICTED: uncharacterized protein LOC104756252 [Camelina sativa]
Length=131

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = -1

Query  459  KLQKAIIMLRNLGLGFGDLTATAENTPPGSTSK--PEAAEMFVQAASN  322
            K+    I L++LG+GFGD TAT EN PPG   +  P+AAE FV+AAS+
Sbjct  29   KMISRTIPLQSLGIGFGDKTATRENVPPGFGEQRAPDAAEKFVKAASS  76



>gb|KJB07324.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07326.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=614

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEEKIA  577
            LK   AK+I L +VL++Q+I++LTA+AW ++NK+LE+K+ 
Sbjct  570  LKIVRAKDIPLDRVLSRQEIDLLTAQAWLSENKQLEQKVC  609



>ref|XP_010462785.1| PREDICTED: uncharacterized protein LOC104743395 [Camelina sativa]
Length=273

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = -1

Query  459  KLQKAIIMLRNLGLGFGDLTATAENTPP--GSTSKPEAAEMFVQAASN  322
            K+    I L++LG+GFGD TAT EN PP  G    P+AAE FV+AAS+
Sbjct  29   KMVSRTIPLQSLGIGFGDKTATRENVPPGFGEQKAPDAAEKFVKAASS  76



>gb|EMT04548.1| hypothetical protein F775_32683 [Aegilops tauschii]
Length=628

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  696  LKAQEAKEIXLSKVLAKQQIEILTAEAWFTKNKKLEE  586
            LK Q  K+I L KVLAKQQ+++LTA+AW ++NK+LE+
Sbjct  475  LKVQHIKDIPLDKVLAKQQMDLLTAKAWLSENKQLEQ  511



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160