BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025M23

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777394.1|  PREDICTED: putative clathrin assembly protei...    188   2e-52   Nicotiana sylvestris
ref|XP_006355077.1|  PREDICTED: putative clathrin assembly protei...    188   2e-52   Solanum tuberosum [potatoes]
ref|NP_001265941.1|  Hop-interacting protein THI028                     186   1e-51   Solanum lycopersicum
ref|XP_009627948.1|  PREDICTED: putative clathrin assembly protei...    182   4e-50   Nicotiana tomentosiformis
ref|XP_010274743.1|  PREDICTED: putative clathrin assembly protei...    178   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002284689.2|  PREDICTED: putative clathrin assembly protei...    176   1e-47   Vitis vinifera
ref|XP_010654389.1|  PREDICTED: putative clathrin assembly protei...    175   1e-47   Vitis vinifera
ref|XP_007222905.1|  hypothetical protein PRUPE_ppa003610mg             172   2e-46   Prunus persica
ref|XP_010101968.1|  Putative clathrin assembly protein                 172   2e-46   
ref|XP_010265534.1|  PREDICTED: putative clathrin assembly protei...    170   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008221433.1|  PREDICTED: putative clathrin assembly protei...    170   1e-45   Prunus mume [ume]
ref|XP_009351512.1|  PREDICTED: putative clathrin assembly protei...    167   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_008389195.1|  PREDICTED: putative clathrin assembly protei...    166   5e-44   Malus domestica [apple tree]
ref|XP_010044208.1|  PREDICTED: putative clathrin assembly protei...    164   1e-43   Eucalyptus grandis [rose gum]
emb|CDP00810.1|  unnamed protein product                                164   2e-43   Coffea canephora [robusta coffee]
ref|XP_011070604.1|  PREDICTED: putative clathrin assembly protei...    164   2e-43   Sesamum indicum [beniseed]
ref|XP_011075418.1|  PREDICTED: putative clathrin assembly protei...    163   2e-43   
ref|XP_011023782.1|  PREDICTED: putative clathrin assembly protei...    163   4e-43   Populus euphratica
ref|XP_011023792.1|  PREDICTED: putative clathrin assembly protei...    163   4e-43   Populus euphratica
ref|XP_011463190.1|  PREDICTED: putative clathrin assembly protei...    162   5e-43   Fragaria vesca subsp. vesca
gb|KCW86253.1|  hypothetical protein EUGRSUZ_B02940                     162   9e-43   Eucalyptus grandis [rose gum]
gb|EYU21032.1|  hypothetical protein MIMGU_mgv1a020579mg                161   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_002311513.1|  clathrin assembly family protein                   160   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006469211.1|  PREDICTED: putative clathrin assembly protei...    159   7e-42   Citrus sinensis [apfelsine]
gb|KJB60908.1|  hypothetical protein B456_009G330700                    159   8e-42   Gossypium raimondii
gb|KJB60910.1|  hypothetical protein B456_009G330700                    159   8e-42   Gossypium raimondii
gb|KJB60906.1|  hypothetical protein B456_009G330700                    159   8e-42   Gossypium raimondii
gb|KJB60907.1|  hypothetical protein B456_009G330700                    159   9e-42   Gossypium raimondii
ref|XP_007045208.1|  ENTH/ANTH/VHS superfamily protein                  159   1e-41   
ref|XP_006448214.1|  hypothetical protein CICLE_v10014774mg             159   1e-41   Citrus clementina [clementine]
ref|XP_004142277.1|  PREDICTED: putative clathrin assembly protei...    159   1e-41   Cucumis sativus [cucumbers]
ref|XP_008464707.1|  PREDICTED: putative clathrin assembly protei...    159   1e-41   
gb|KJB60905.1|  hypothetical protein B456_009G330700                    159   1e-41   Gossypium raimondii
gb|KDP38084.1|  hypothetical protein JCGZ_04727                         159   2e-41   Jatropha curcas
gb|EYU33129.1|  hypothetical protein MIMGU_mgv1a0037702mg               157   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_003524854.1|  PREDICTED: putative clathrin assembly protei...    158   2e-41   Glycine max [soybeans]
gb|KHN12469.1|  Putative clathrin assembly protein                      157   5e-41   Glycine soja [wild soybean]
ref|XP_003531146.1|  PREDICTED: putative clathrin assembly protei...    157   5e-41   Glycine max [soybeans]
gb|KDO64585.1|  hypothetical protein CISIN_1g008579mg                   156   9e-41   Citrus sinensis [apfelsine]
ref|XP_002315872.2|  hypothetical protein POPTR_0010s12020g             156   1e-40   
ref|XP_002315925.2|  hypothetical protein POPTR_0010s12020g             155   1e-40   
ref|XP_007158803.1|  hypothetical protein PHAVU_002G183100g             155   2e-40   Phaseolus vulgaris [French bean]
ref|XP_011038608.1|  PREDICTED: putative clathrin assembly protei...    155   2e-40   Populus euphratica
gb|KJB30769.1|  hypothetical protein B456_005G159800                    155   2e-40   Gossypium raimondii
gb|KJB30771.1|  hypothetical protein B456_005G159800                    155   2e-40   Gossypium raimondii
gb|KJB30768.1|  hypothetical protein B456_005G159800                    155   3e-40   Gossypium raimondii
gb|KJB30770.1|  hypothetical protein B456_005G159800                    155   3e-40   Gossypium raimondii
ref|XP_002527787.1|  clathrin assembly protein, putative                154   5e-40   Ricinus communis
ref|XP_004504573.1|  PREDICTED: putative clathrin assembly protei...    152   2e-39   Cicer arietinum [garbanzo]
ref|XP_010553785.1|  PREDICTED: putative clathrin assembly protei...    147   1e-37   Tarenaya hassleriana [spider flower]
gb|KHN03156.1|  Putative clathrin assembly protein                      144   2e-36   Glycine soja [wild soybean]
ref|XP_003533950.1|  PREDICTED: putative clathrin assembly protei...    144   2e-36   Glycine max [soybeans]
gb|KHG06013.1|  hypothetical protein F383_02907                         144   2e-36   Gossypium arboreum [tree cotton]
gb|KHG06012.1|  hypothetical protein F383_02907                         144   5e-36   Gossypium arboreum [tree cotton]
gb|KJB78155.1|  hypothetical protein B456_012G181700                    142   1e-35   Gossypium raimondii
gb|KJB78156.1|  hypothetical protein B456_012G181700                    142   1e-35   Gossypium raimondii
gb|KJB78157.1|  hypothetical protein B456_012G181700                    142   1e-35   Gossypium raimondii
gb|KJB78154.1|  hypothetical protein B456_012G181700                    142   1e-35   Gossypium raimondii
ref|XP_010921268.1|  PREDICTED: putative clathrin assembly protei...    138   2e-35   
ref|XP_010921261.1|  PREDICTED: putative clathrin assembly protei...    140   5e-35   
ref|XP_010921255.1|  PREDICTED: putative clathrin assembly protei...    140   7e-35   Elaeis guineensis
ref|XP_010921252.1|  PREDICTED: putative clathrin assembly protei...    140   7e-35   Elaeis guineensis
ref|XP_007153280.1|  hypothetical protein PHAVU_003G022000g             133   1e-32   Phaseolus vulgaris [French bean]
ref|XP_010924074.1|  PREDICTED: putative clathrin assembly protei...    132   3e-32   Elaeis guineensis
ref|XP_010681909.1|  PREDICTED: putative clathrin assembly protei...    132   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010527791.1|  PREDICTED: putative clathrin assembly protei...    129   3e-31   Tarenaya hassleriana [spider flower]
gb|EPS70597.1|  hypothetical protein M569_04158                         127   1e-30   Genlisea aurea
ref|XP_008803559.1|  PREDICTED: putative clathrin assembly protei...    126   4e-30   Phoenix dactylifera
ref|XP_006655551.1|  PREDICTED: putative clathrin assembly protei...    126   5e-30   Oryza brachyantha
ref|XP_009418441.1|  PREDICTED: putative clathrin assembly protei...    124   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799224.1|  PREDICTED: putative clathrin assembly protei...    123   4e-29   Phoenix dactylifera
emb|CDY17459.1|  BnaC09g20780D                                          123   6e-29   Brassica napus [oilseed rape]
ref|XP_009114226.1|  PREDICTED: putative clathrin assembly protei...    123   6e-29   Brassica rapa
ref|XP_008799223.1|  PREDICTED: putative clathrin assembly protei...    122   2e-28   Phoenix dactylifera
ref|XP_002441469.1|  hypothetical protein SORBIDRAFT_09g027370          122   2e-28   Sorghum bicolor [broomcorn]
ref|XP_009101331.1|  PREDICTED: putative clathrin assembly protei...    121   3e-28   Brassica rapa
ref|XP_006395874.1|  hypothetical protein EUTSA_v10003910mg             121   3e-28   Eutrema salsugineum [saltwater cress]
gb|AAD12692.3|  expressed protein                                       119   3e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17660.1|  BnaA06g34790D                                          121   3e-28   Brassica napus [oilseed rape]
emb|CDY36239.1|  BnaC07g20930D                                          121   4e-28   Brassica napus [oilseed rape]
gb|AFW80976.1|  hypothetical protein ZEAMMB73_079219                    120   5e-28   
gb|AFW80975.1|  hypothetical protein ZEAMMB73_079219                    120   6e-28   
ref|NP_001145773.1|  uncharacterized protein LOC100279280               120   6e-28   Zea mays [maize]
gb|AAM67368.1|  unknown                                                 118   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969636.1|  PREDICTED: putative clathrin assembly protei...    119   1e-27   Setaria italica
ref|XP_009396332.1|  PREDICTED: putative clathrin assembly protei...    119   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565267.1|  putative clathrin assembly protein                    119   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456192.1|  hypothetical protein SORBIDRAFT_03g031930          119   2e-27   Sorghum bicolor [broomcorn]
gb|KFK33381.1|  hypothetical protein AALP_AA5G005800                    118   4e-27   Arabis alpina [alpine rockcress]
gb|AFW78994.1|  hypothetical protein ZEAMMB73_223268                    115   5e-27   
ref|XP_009396331.1|  PREDICTED: putative clathrin assembly protei...    117   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136989.1|  uncharacterized protein LOC100217151               117   1e-26   Zea mays [maize]
ref|XP_010424931.1|  PREDICTED: putative clathrin assembly protei...    114   1e-26   
ref|XP_008672590.1|  PREDICTED: uncharacterized protein LOC100276...    116   3e-26   
ref|XP_008672589.1|  PREDICTED: uncharacterized protein LOC100276...    116   3e-26   Zea mays [maize]
emb|CDY53525.1|  BnaC05g11150D                                          115   6e-26   Brassica napus [oilseed rape]
ref|NP_001043956.1|  Os01g0694900                                       115   6e-26   
gb|KFK32949.1|  hypothetical protein AALP_AA6G310300                    115   6e-26   Arabis alpina [alpine rockcress]
gb|EEC71324.1|  hypothetical protein OsI_03369                          115   6e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004961341.1|  PREDICTED: putative clathrin assembly protei...    114   1e-25   Setaria italica
ref|XP_010476568.1|  PREDICTED: putative clathrin assembly protei...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002875082.1|  hypothetical protein ARALYDRAFT_904366             114   2e-25   Arabidopsis lyrata subsp. lyrata
ref|NP_001056232.1|  Os05g0549000                                       113   2e-25   
ref|XP_006646232.1|  PREDICTED: putative clathrin assembly protei...    113   3e-25   Oryza brachyantha
ref|XP_010496638.1|  PREDICTED: putative clathrin assembly protei...    113   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010459007.1|  PREDICTED: putative clathrin assembly protei...    113   6e-25   Camelina sativa [gold-of-pleasure]
emb|CDY45299.1|  BnaA06g09690D                                          112   7e-25   Brassica napus [oilseed rape]
ref|XP_009148877.1|  PREDICTED: putative clathrin assembly protei...    112   1e-24   Brassica rapa
ref|XP_006306843.1|  hypothetical protein CARUB_v10008396mg             112   1e-24   Capsella rubella
emb|CDY48813.1|  BnaC02g34010D                                          111   1e-24   Brassica napus [oilseed rape]
gb|EMT23238.1|  Putative clathrin assembly protein                      110   2e-24   
ref|XP_009129221.1|  PREDICTED: putative clathrin assembly protei...    111   2e-24   
emb|CDY09433.1|  BnaA02g25770D                                          111   2e-24   Brassica napus [oilseed rape]
gb|EAY98914.1|  hypothetical protein OsI_20869                          110   3e-24   Oryza sativa Indica Group [Indian rice]
emb|CAA71818.1|  hypothetical protein (cDNA194)                         108   4e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAA71879.1|  hypothetical protein 194                               109   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567959.1|  PREDICTED: putative clathrin assembly protei...    109   7e-24   Brachypodium distachyon [annual false brome]
ref|NP_172944.1|  putative clathrin assembly protein                    110   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513887.1|  PREDICTED: putative clathrin assembly protei...    108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010424932.1|  PREDICTED: putative clathrin assembly protei...    108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006292297.1|  hypothetical protein CARUB_v10018506mg             108   2e-23   Capsella rubella
emb|CDM83847.1|  unnamed protein product                                107   4e-23   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA51587.1|  TPA: hypothetical protein ZEAMMB73_095588              105   1e-22   
dbj|BAK06048.1|  predicted protein                                      105   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006838117.1|  hypothetical protein AMTR_s00106p00058730          103   9e-22   Amborella trichopoda
ref|XP_006416959.1|  hypothetical protein EUTSA_v10007171mg           99.0    3e-20   
ref|XP_008811452.1|  PREDICTED: putative clathrin assembly protei...  97.8    9e-20   Phoenix dactylifera
ref|XP_010929366.1|  PREDICTED: putative clathrin assembly protei...  94.7    4e-19   
gb|AAF79231.1|AC006917_16  F10B6.32                                   95.9    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929365.1|  PREDICTED: putative clathrin assembly protei...  94.7    7e-19   
ref|XP_010929364.1|  PREDICTED: putative clathrin assembly protei...  94.7    7e-19   
ref|XP_010929363.1|  PREDICTED: putative clathrin assembly protei...  94.7    8e-19   
ref|XP_010929362.1|  PREDICTED: putative clathrin assembly protei...  94.7    9e-19   
ref|XP_009390454.1|  PREDICTED: putative clathrin assembly protei...  91.7    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004965651.1|  PREDICTED: putative clathrin assembly protei...  90.9    2e-17   Setaria italica
gb|EYU30089.1|  hypothetical protein MIMGU_mgv1a0050551mg             86.3    3e-17   Erythranthe guttata [common monkey flower]
ref|NP_001174939.1|  Os06g0661400                                     87.4    7e-17   
gb|EMT16298.1|  Putative clathrin assembly protein                    89.0    1e-16   
ref|XP_003569612.1|  PREDICTED: putative clathrin assembly protei...  88.2    1e-16   Brachypodium distachyon [annual false brome]
gb|EAZ37894.1|  hypothetical protein OsJ_22244                        87.8    2e-16   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD46420.1|  phosphoprotein-like                                  87.4    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656326.1|  PREDICTED: putative clathrin assembly protei...  87.4    3e-16   Oryza brachyantha
ref|XP_009408060.1|  PREDICTED: putative clathrin assembly protei...  87.0    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002437410.1|  hypothetical protein SORBIDRAFT_10g026380        83.6    1e-15   
ref|XP_010913847.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...  85.5    1e-15   Elaeis guineensis
ref|NP_001151036.1|  clathrin assembly protein                        85.1    2e-15   
ref|XP_002324695.1|  clathrin assembly family protein                 85.1    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011017657.1|  PREDICTED: putative clathrin assembly protei...  84.7    2e-15   Populus euphratica
ref|XP_008781765.1|  PREDICTED: putative clathrin assembly protei...  84.7    2e-15   Phoenix dactylifera
ref|XP_006850889.1|  hypothetical protein AMTR_s00025p00161520        84.3    3e-15   Amborella trichopoda
gb|ACN36497.1|  unknown                                               81.3    7e-15   Zea mays [maize]
ref|XP_008391574.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...  83.2    7e-15   
ref|XP_007222299.1|  hypothetical protein PRUPE_ppa003361mg           82.8    9e-15   Prunus persica
ref|XP_008223882.1|  PREDICTED: putative clathrin assembly protei...  82.8    1e-14   Prunus mume [ume]
emb|CDP10454.1|  unnamed protein product                              82.4    1e-14   Coffea canephora [robusta coffee]
emb|CDP20659.1|  unnamed protein product                              82.4    2e-14   Coffea canephora [robusta coffee]
ref|XP_010057620.1|  PREDICTED: putative clathrin assembly protei...  82.0    2e-14   Eucalyptus grandis [rose gum]
ref|XP_002453380.1|  hypothetical protein SORBIDRAFT_04g005060        82.0    2e-14   Sorghum bicolor [broomcorn]
ref|XP_010273537.1|  PREDICTED: putative clathrin assembly protei...  82.0    2e-14   Nelumbo nucifera [Indian lotus]
gb|AFW76126.1|  clathrin assembly protein                             82.0    2e-14   
ref|XP_009359933.1|  PREDICTED: putative clathrin assembly protei...  81.6    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_011020009.1|  PREDICTED: putative clathrin assembly protei...  81.6    2e-14   Populus euphratica
ref|XP_003542645.1|  PREDICTED: putative clathrin assembly protei...  81.6    3e-14   Glycine max [soybeans]
gb|KHN03612.1|  Putative clathrin assembly protein                    81.6    3e-14   Glycine soja [wild soybean]
ref|XP_002308116.2|  hypothetical protein POPTR_0006s07540g           81.3    3e-14   
ref|XP_010250225.1|  PREDICTED: putative clathrin assembly protei...  80.9    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003563341.1|  PREDICTED: putative clathrin assembly protei...  80.1    7e-14   Brachypodium distachyon [annual false brome]
ref|XP_010240260.1|  PREDICTED: putative clathrin assembly protei...  80.1    8e-14   Brachypodium distachyon [annual false brome]
ref|XP_002269299.1|  PREDICTED: putative clathrin assembly protei...  80.1    8e-14   Vitis vinifera
ref|XP_007013561.1|  ENTH/ANTH/VHS superfamily protein isoform 1      80.1    8e-14   
ref|XP_006597797.1|  PREDICTED: putative clathrin assembly protei...  80.1    1e-13   
ref|XP_007014413.1|  ENTH/ANTH/VHS superfamily protein                79.7    1e-13   
ref|XP_010110275.1|  Putative clathrin assembly protein               79.3    1e-13   
gb|EMT24265.1|  Putative clathrin assembly protein                    79.3    2e-13   
ref|XP_004287277.1|  PREDICTED: putative clathrin assembly protei...  78.6    3e-13   Fragaria vesca subsp. vesca
gb|EYU34970.1|  hypothetical protein MIMGU_mgv1a003922mg              78.2    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_003549739.1|  PREDICTED: putative clathrin assembly protei...  78.2    3e-13   Glycine max [soybeans]
ref|XP_004297901.1|  PREDICTED: putative clathrin assembly protei...  78.2    4e-13   Fragaria vesca subsp. vesca
ref|XP_007201932.1|  hypothetical protein PRUPE_ppa003855mg           77.8    4e-13   Prunus persica
ref|XP_004951735.1|  PREDICTED: putative clathrin assembly protei...  77.8    4e-13   Setaria italica
ref|XP_008242823.1|  PREDICTED: putative clathrin assembly protei...  77.8    5e-13   Prunus mume [ume]
gb|KHN15336.1|  Putative clathrin assembly protein                    77.4    6e-13   Glycine soja [wild soybean]
ref|XP_002324629.1|  hypothetical protein POPTR_0018s12580g           77.0    8e-13   
ref|XP_002982426.1|  hypothetical protein SELMODRAFT_268581           77.0    8e-13   Selaginella moellendorffii
ref|XP_009400569.1|  PREDICTED: putative clathrin assembly protei...  77.0    8e-13   
ref|XP_009403215.1|  PREDICTED: putative clathrin assembly protei...  77.0    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002966589.1|  hypothetical protein SELMODRAFT_230819           76.6    1e-12   
ref|XP_006372154.1|  hypothetical protein POPTR_0018s12580g           76.6    1e-12   
ref|XP_008443941.1|  PREDICTED: putative clathrin assembly protei...  75.9    1e-12   
ref|XP_008443942.1|  PREDICTED: putative clathrin assembly protei...  76.6    1e-12   Cucumis melo [Oriental melon]
emb|CAN83852.1|  hypothetical protein VITISV_037564                   76.6    1e-12   Vitis vinifera
ref|XP_002531947.1|  clathrin assembly protein, putative              76.3    1e-12   Ricinus communis
emb|CBI28256.3|  unnamed protein product                              76.3    1e-12   Vitis vinifera
ref|XP_011017841.1|  PREDICTED: putative clathrin assembly protei...  76.3    2e-12   Populus euphratica
ref|XP_010906894.1|  PREDICTED: putative clathrin assembly protei...  75.9    2e-12   
ref|XP_002285448.2|  PREDICTED: putative clathrin assembly protei...  75.9    2e-12   Vitis vinifera
ref|XP_010687911.1|  PREDICTED: putative clathrin assembly protei...  75.9    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP30243.1|  hypothetical protein JCGZ_17025                       75.9    2e-12   Jatropha curcas
ref|XP_007213050.1|  hypothetical protein PRUPE_ppa020397mg           73.6    3e-12   
ref|XP_006403061.1|  hypothetical protein EUTSA_v10003447mg           75.1    3e-12   
gb|KJB64693.1|  hypothetical protein B456_010G060800                  74.7    3e-12   Gossypium raimondii
ref|XP_008794954.1|  PREDICTED: putative clathrin assembly protei...  75.1    3e-12   Phoenix dactylifera
ref|XP_002308057.2|  hypothetical protein POPTR_0006s06390g           75.1    4e-12   
gb|KJB64689.1|  hypothetical protein B456_010G060800                  74.7    4e-12   Gossypium raimondii
gb|KJB64695.1|  hypothetical protein B456_010G060800                  74.3    5e-12   Gossypium raimondii
ref|XP_009785618.1|  PREDICTED: putative clathrin assembly protei...  74.7    5e-12   Nicotiana sylvestris
gb|ABR16117.1|  unknown                                               74.7    5e-12   Picea sitchensis
ref|XP_011020196.1|  PREDICTED: putative clathrin assembly protei...  74.7    5e-12   Populus euphratica
ref|XP_011020194.1|  PREDICTED: putative clathrin assembly protei...  74.7    5e-12   Populus euphratica
ref|NP_001143721.1|  uncharacterized protein LOC100276465             70.1    6e-12   
gb|EMT14882.1|  Putative clathrin assembly protein                    74.3    6e-12   
ref|XP_006586993.1|  PREDICTED: putative clathrin assembly protei...  74.3    6e-12   Glycine max [soybeans]
ref|XP_004150528.1|  PREDICTED: putative clathrin assembly protei...  74.3    6e-12   Cucumis sativus [cucumbers]
ref|XP_011078406.1|  PREDICTED: putative clathrin assembly protei...  74.3    6e-12   Sesamum indicum [beniseed]
gb|KHN35810.1|  Putative clathrin assembly protein                    74.3    6e-12   Glycine soja [wild soybean]
ref|XP_007155057.1|  hypothetical protein PHAVU_003G169400g           74.3    7e-12   Phaseolus vulgaris [French bean]
ref|XP_009340644.1|  PREDICTED: putative clathrin assembly protei...  74.3    7e-12   Pyrus x bretschneideri [bai li]
ref|XP_009340645.1|  PREDICTED: putative clathrin assembly protei...  74.3    7e-12   Pyrus x bretschneideri [bai li]
gb|KJB64690.1|  hypothetical protein B456_010G060800                  73.9    7e-12   Gossypium raimondii
ref|XP_010533128.1|  PREDICTED: putative clathrin assembly protei...  74.3    7e-12   Tarenaya hassleriana [spider flower]
ref|XP_010533127.1|  PREDICTED: putative clathrin assembly protei...  74.3    7e-12   Tarenaya hassleriana [spider flower]
gb|KJB53729.1|  hypothetical protein B456_009G002600                  73.9    9e-12   Gossypium raimondii
ref|XP_003609412.1|  hypothetical protein MTR_4g115420                73.6    1e-11   Medicago truncatula
ref|XP_008361112.1|  PREDICTED: putative clathrin assembly protei...  73.6    1e-11   
ref|XP_008385249.1|  PREDICTED: putative clathrin assembly protei...  73.6    1e-11   
ref|XP_006346667.1|  PREDICTED: putative clathrin assembly protei...  73.2    2e-11   Solanum tuberosum [potatoes]
ref|XP_009614798.1|  PREDICTED: putative clathrin assembly protei...  73.2    2e-11   Nicotiana tomentosiformis
ref|XP_010323282.1|  PREDICTED: putative clathrin assembly protei...  73.2    2e-11   Solanum lycopersicum
ref|XP_010241584.1|  PREDICTED: putative clathrin assembly protei...  73.2    2e-11   Nelumbo nucifera [Indian lotus]
gb|AFK40929.1|  unknown                                               72.8    2e-11   Lotus japonicus
ref|XP_009398625.1|  PREDICTED: putative clathrin assembly protei...  72.0    2e-11   
ref|XP_009398623.1|  PREDICTED: putative clathrin assembly protei...  72.8    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004231715.1|  PREDICTED: putative clathrin assembly protei...  72.8    2e-11   Solanum lycopersicum
ref|XP_009363972.1|  PREDICTED: putative clathrin assembly protei...  72.0    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_010087990.1|  Putative clathrin assembly protein               72.0    3e-11   Morus notabilis
gb|KHG16288.1|  hypothetical protein F383_00250                       72.0    3e-11   Gossypium arboreum [tree cotton]
dbj|BAH20213.1|  AT5G35200                                            71.2    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17630.1|  Putative clathrin assembly protein                    71.6    4e-11   Glycine soja [wild soybean]
ref|XP_006600479.1|  PREDICTED: putative clathrin assembly protei...  71.6    4e-11   Glycine max [soybeans]
gb|KGN61174.1|  hypothetical protein Csa_2G061530                     71.6    5e-11   Cucumis sativus [cucumbers]
ref|XP_004167932.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...  71.6    5e-11   
gb|KDO73480.1|  hypothetical protein CISIN_1g009078mg                 71.6    5e-11   Citrus sinensis [apfelsine]
ref|XP_007154718.1|  hypothetical protein PHAVU_003G141500g           71.6    5e-11   Phaseolus vulgaris [French bean]
gb|KDO73477.1|  hypothetical protein CISIN_1g009078mg                 71.6    5e-11   Citrus sinensis [apfelsine]
ref|XP_006453089.1|  hypothetical protein CICLE_v10007931mg           71.6    5e-11   Citrus clementina [clementine]
gb|AES92253.2|  clathrin assembly plant-like protein                  71.6    5e-11   Medicago truncatula
ref|XP_006358316.1|  PREDICTED: putative clathrin assembly protei...  71.6    5e-11   Solanum tuberosum [potatoes]
ref|XP_004149514.1|  PREDICTED: putative clathrin assembly protei...  71.6    5e-11   
ref|NP_198370.1|  putative clathrin assembly protein                  71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610056.1|  Phosphoprotein-like protein                      71.6    5e-11   
ref|XP_006358317.1|  PREDICTED: putative clathrin assembly protei...  71.2    6e-11   Solanum tuberosum [potatoes]
ref|XP_002527806.1|  clathrin assembly protein, putative              71.2    6e-11   Ricinus communis
ref|XP_007138775.1|  hypothetical protein PHAVU_009G236300g           71.2    8e-11   Phaseolus vulgaris [French bean]
ref|XP_008451229.1|  PREDICTED: putative clathrin assembly protei...  70.9    8e-11   Cucumis melo [Oriental melon]
ref|XP_010541947.1|  PREDICTED: putative clathrin assembly protei...  70.9    9e-11   Tarenaya hassleriana [spider flower]
ref|XP_006453261.1|  hypothetical protein CICLE_v10010653mg           70.9    1e-10   Citrus clementina [clementine]
ref|XP_004508453.1|  PREDICTED: putative clathrin assembly protei...  70.5    1e-10   Cicer arietinum [garbanzo]
ref|XP_008644118.1|  PREDICTED: hypothetical protein isoform X1       70.5    1e-10   Zea mays [maize]
ref|NP_001169970.1|  hypothetical protein                             70.5    1e-10   Zea mays [maize]
gb|KDO61895.1|  hypothetical protein CISIN_1g040258mg                 70.5    1e-10   Citrus sinensis [apfelsine]
ref|XP_002870422.1|  hypothetical protein ARALYDRAFT_915653           70.1    1e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_004487991.1|  PREDICTED: putative clathrin assembly protei...  70.1    1e-10   
ref|XP_004487990.1|  PREDICTED: putative clathrin assembly protei...  70.1    2e-10   Cicer arietinum [garbanzo]
ref|XP_009401365.1|  PREDICTED: putative clathrin assembly protei...  69.7    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY12401.1|  BnaC08g08040D                                        69.7    2e-10   Brassica napus [oilseed rape]
ref|NP_001046057.1|  Os02g0175700                                     69.7    2e-10   
gb|EMT06005.1|  Putative clathrin assembly protein                    69.7    2e-10   
gb|EEC72596.1|  hypothetical protein OsI_06060                        69.3    3e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010536897.1|  PREDICTED: putative clathrin assembly protei...  69.3    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_009595513.1|  PREDICTED: putative clathrin assembly protei...  69.3    3e-10   Nicotiana tomentosiformis
ref|XP_006648363.1|  PREDICTED: putative clathrin assembly protei...  68.9    3e-10   Oryza brachyantha
ref|XP_004507896.1|  PREDICTED: putative clathrin assembly protei...  68.6    5e-10   
ref|XP_004507895.1|  PREDICTED: putative clathrin assembly protei...  68.6    6e-10   Cicer arietinum [garbanzo]
ref|XP_008793594.1|  PREDICTED: putative clathrin assembly protei...  68.2    6e-10   
gb|KDP41089.1|  hypothetical protein JCGZ_03219                       68.2    6e-10   Jatropha curcas
gb|AES65322.2|  clathrin assembly plant-like protein                  68.2    6e-10   Medicago truncatula
ref|XP_003595071.1|  hypothetical protein MTR_2g037980                68.2    7e-10   
emb|CBI36596.3|  unnamed protein product                              67.4    1e-09   Vitis vinifera
ref|XP_006593512.1|  PREDICTED: putative clathrin assembly protei...  67.4    1e-09   Glycine max [soybeans]
ref|XP_002271781.2|  PREDICTED: putative clathrin assembly protei...  67.4    1e-09   
ref|XP_008648219.1|  PREDICTED: uncharacterized protein LOC100501...  67.4    1e-09   
ref|XP_011094096.1|  PREDICTED: putative clathrin assembly protei...  67.0    2e-09   
ref|XP_006655844.1|  PREDICTED: putative clathrin assembly protei...  67.0    2e-09   
ref|XP_010050955.1|  PREDICTED: putative clathrin assembly protei...  67.0    2e-09   
ref|XP_009108052.1|  PREDICTED: putative clathrin assembly protei...  66.6    2e-09   
ref|XP_009757132.1|  PREDICTED: putative clathrin assembly protei...  66.6    2e-09   
ref|XP_009757131.1|  PREDICTED: putative clathrin assembly protei...  66.6    2e-09   
ref|XP_009595316.1|  PREDICTED: putative clathrin assembly protei...  66.6    2e-09   
ref|NP_001056950.1|  Os06g0175500                                     66.2    3e-09   
ref|XP_009595317.1|  PREDICTED: putative clathrin assembly protei...  66.2    3e-09   
ref|XP_008659222.1|  PREDICTED: putative clathrin assembly protei...  66.2    3e-09   
gb|EAY99883.1|  hypothetical protein OsI_21879                        66.2    3e-09   
ref|XP_010904605.1|  PREDICTED: putative clathrin assembly protei...  66.2    3e-09   
gb|EMT21757.1|  Putative clathrin assembly protein                    65.5    4e-09   
gb|KHN22664.1|  Putative clathrin assembly protein                    65.1    6e-09   
gb|AAL23930.1|AF420331_1  unknown                                     64.7    6e-09   
ref|XP_010545391.1|  PREDICTED: putative clathrin assembly protei...  64.7    8e-09   
ref|XP_010545389.1|  PREDICTED: putative clathrin assembly protei...  64.7    8e-09   
ref|XP_006845427.1|  hypothetical protein AMTR_s00019p00093710        64.7    1e-08   
ref|XP_010314098.1|  PREDICTED: putative clathrin assembly protei...  64.3    1e-08   
gb|KJB53994.1|  hypothetical protein B456_009G015300                  64.3    1e-08   
ref|NP_001048425.1|  Os02g0803300                                     63.9    2e-08   
ref|XP_006344967.1|  PREDICTED: putative clathrin assembly protei...  63.5    2e-08   
ref|XP_009773773.1|  PREDICTED: putative clathrin assembly protei...  63.5    2e-08   
gb|KHG01486.1|  hypothetical protein F383_22177                       63.2    3e-08   
gb|KHG01485.1|  hypothetical protein F383_22177                       63.2    3e-08   
gb|EYU18219.1|  hypothetical protein MIMGU_mgv1a003551mg              63.2    3e-08   
gb|EEC74189.1|  hypothetical protein OsI_09327                        62.8    3e-08   
gb|KDO62335.1|  hypothetical protein CISIN_1g037435mg                 62.8    4e-08   
ref|XP_006453525.1|  hypothetical protein CICLE_v10010196mg           62.8    4e-08   
ref|XP_006474617.1|  PREDICTED: putative clathrin assembly protei...  62.4    4e-08   
ref|XP_010435408.1|  PREDICTED: putative clathrin assembly protei...  62.4    4e-08   
ref|XP_010435407.1|  PREDICTED: putative clathrin assembly protei...  62.4    5e-08   
ref|XP_004964714.1|  PREDICTED: putative clathrin assembly protei...  62.4    6e-08   
ref|XP_004964715.1|  PREDICTED: putative clathrin assembly protei...  62.0    6e-08   
ref|XP_004967244.1|  PREDICTED: putative clathrin assembly protei...  62.0    6e-08   
ref|XP_006657301.1|  PREDICTED: putative clathrin assembly protei...  62.0    7e-08   
ref|XP_010440697.1|  PREDICTED: putative clathrin assembly protei...  62.0    8e-08   
gb|KFK29105.1|  hypothetical protein AALP_AA7G089800                  61.6    1e-07   
ref|XP_003564229.1|  PREDICTED: putative clathrin assembly protei...  61.6    1e-07   
ref|XP_010433571.1|  PREDICTED: putative clathrin assembly protei...  61.2    1e-07   
gb|EPS57540.1|  hypothetical protein M569_17277                       60.1    1e-07   
ref|XP_010688409.1|  PREDICTED: putative clathrin assembly protei...  61.2    1e-07   
ref|XP_006286251.1|  hypothetical protein CARUB_v10007821mg           60.8    1e-07   
gb|KDP41088.1|  hypothetical protein JCGZ_03218                       58.9    2e-07   
ref|XP_010438819.1|  PREDICTED: putative clathrin assembly protei...  60.5    2e-07   
gb|EAZ38170.1|  hypothetical protein OsJ_22524                        60.5    2e-07   
gb|EEC81258.1|  hypothetical protein OsI_24348                        60.1    3e-07   
dbj|BAD54001.1|  destination factor-like                              60.1    3e-07   
ref|XP_006648067.1|  PREDICTED: putative clathrin assembly protei...  59.7    4e-07   
gb|KCW86255.1|  hypothetical protein EUGRSUZ_B02940                   58.9    6e-07   
ref|XP_009395481.1|  PREDICTED: putative clathrin assembly protei...  58.9    7e-07   
ref|XP_009395478.1|  PREDICTED: putative clathrin assembly protei...  58.5    8e-07   
emb|CDX89382.1|  BnaA01g15110D                                        58.2    1e-06   
ref|XP_006283381.1|  hypothetical protein CARUB_v10004424mg           58.2    2e-06   
gb|EMT14615.1|  Putative clathrin assembly protein                    57.4    2e-06   
ref|XP_002867587.1|  hypothetical protein ARALYDRAFT_492223           57.4    2e-06   
ref|XP_008679209.1|  PREDICTED: putative clathrin assembly protei...  57.0    3e-06   
ref|XP_010448345.1|  PREDICTED: putative clathrin assembly protei...  56.6    4e-06   
gb|EPS68909.1|  hypothetical protein M569_05859                       56.6    4e-06   
emb|CAB39659.1|  predicted protein destination factor                 56.6    5e-06   
ref|NP_194324.2|  ENTH/ANTH/VHS superfamily protein                   56.6    5e-06   
emb|CDX94400.1|  BnaC01g17840D                                        55.8    7e-06   
ref|XP_001755297.1|  predicted protein                                55.5    1e-05   
ref|XP_009139694.1|  PREDICTED: putative clathrin assembly protei...  55.5    1e-05   
ref|XP_002452995.1|  hypothetical protein SORBIDRAFT_04g036280        55.5    1e-05   
ref|XP_004954262.1|  PREDICTED: putative clathrin assembly protei...  54.7    2e-05   
gb|KFK27275.1|  hypothetical protein AALP_AA8G360900                  53.9    3e-05   
ref|XP_002533433.1|  clathrin assembly protein, putative              53.1    6e-05   
ref|NP_200530.1|  putative clathrin assembly protein                  52.8    8e-05   
ref|XP_010927972.1|  PREDICTED: putative clathrin assembly protei...  52.8    9e-05   
ref|XP_010483224.1|  PREDICTED: putative clathrin assembly protei...  52.8    1e-04   
ref|XP_004954260.1|  PREDICTED: putative clathrin assembly protei...  52.4    1e-04   
ref|XP_011077728.1|  PREDICTED: putative clathrin assembly protei...  52.4    1e-04   
ref|XP_009126852.1|  PREDICTED: putative clathrin assembly protei...  52.4    1e-04   
ref|XP_006401230.1|  hypothetical protein EUTSA_v10013043mg           52.4    1e-04   
ref|XP_006413249.1|  hypothetical protein EUTSA_v10024721mg           52.0    2e-04   
ref|XP_006413250.1|  hypothetical protein EUTSA_v10024721mg           52.0    2e-04   
ref|XP_010451872.1|  PREDICTED: putative clathrin assembly protei...  51.6    2e-04   
ref|XP_006279508.1|  hypothetical protein CARUB_v10027557mg           51.2    3e-04   
ref|XP_009120244.1|  PREDICTED: putative clathrin assembly protei...  51.2    3e-04   
emb|CDY38276.1|  BnaA10g11240D                                        51.2    3e-04   
emb|CDY52732.1|  BnaC09g53320D                                        51.2    3e-04   
gb|EYU38747.1|  hypothetical protein MIMGU_mgv1a003095mg              51.2    3e-04   
ref|XP_002864505.1|  predicted protein                                51.2    3e-04   
ref|XP_007013936.1|  Clathrin assembly protein, putative              50.1    7e-04   
ref|XP_010443398.1|  PREDICTED: putative clathrin assembly protei...  50.1    8e-04   



>ref|XP_009777394.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nicotiana 
sylvestris]
Length=562

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 116/171 (68%), Gaps = 8/171 (5%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            SAIEESNALAL IVPSG T   S   QPK FD TGWELALV+TP   LS   ERQL GGL
Sbjct  393  SAIEESNALALAIVPSGTTPFDSNPAQPKDFDPTGWELALVTTPSSDLSAAHERQLAGGL  452

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
            DSLT NSLYDEGA RASQQPVYG PAPNPFEVADPF MS+ +  PPSVQ+A  P      
Sbjct  453  DSLTLNSLYDEGAYRASQQPVYGQPAPNPFEVADPFVMSSTMPPPPSVQMAMAPQHQMNP  512

Query  310  pfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                  A   PQNP+M  PH P GD G  AFPANN     AH Q TNPFGS
Sbjct  513  FGPFQPAYPQPQNPMM-NPHNPFGDAGFSAFPANN----VAHPQTTNPFGS  558



>ref|XP_006355077.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Solanum tuberosum]
Length=563

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 119/171 (70%), Gaps = 8/171 (5%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            SAIE+SNALAL IVPSG T   S   QPK FD TGWELALV+TP   LS  QERQL GG+
Sbjct  394  SAIEDSNALALAIVPSGTTPFDSNPAQPKDFDPTGWELALVTTPSSDLSAAQERQLAGGM  453

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
            DSLT NSLYDEGA RASQ+PVYGAPAPNPFEVADPFAMS  +A PPSVQ+A +P      
Sbjct  454  DSLTLNSLYDEGAYRASQRPVYGAPAPNPFEVADPFAMSTTMAPPPSVQMAAVPQHQMNP  513

Query  310  pfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                  A   PQNP+M  PH P GD G  AFP N+     AH Q TNPFGS
Sbjct  514  FGPFEPAYPQPQNPMM-NPHNPFGDAGFSAFPTNH----VAHPQTTNPFGS  559



>ref|NP_001265941.1| Hop-interacting protein THI028 [Solanum lycopersicum]
 ref|XP_010319119.1| PREDICTED: hop-interacting protein THI028 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69791.1| Hop-interacting protein THI028 [Solanum lycopersicum]
Length=563

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 118/171 (69%), Gaps = 8/171 (5%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            SAIE+SNALAL IVPSG T   S   QPK FD TGWELALV+TP   LS  QERQL GGL
Sbjct  394  SAIEDSNALALAIVPSGTTPFDSNPAQPKDFDPTGWELALVTTPSSDLSAAQERQLAGGL  453

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
            DSLT NSLYDEGA RASQ+PVYGAPAPNPFEVADPFAMS  +  PPSVQ+A +P      
Sbjct  454  DSLTLNSLYDEGAYRASQRPVYGAPAPNPFEVADPFAMSTTMPPPPSVQMAAVPQHQMNP  513

Query  310  pfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                  A   PQNP M+ PH P GD G  AFP N+     AH Q TNPFGS
Sbjct  514  FGPFEPAYPQPQNP-MLNPHNPFGDAGFSAFPTNH----VAHPQTTNPFGS  559



>ref|XP_009627948.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nicotiana 
tomentosiformis]
Length=562

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 117/171 (68%), Gaps = 8/171 (5%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            SAIEESNALAL IVPSG T   S   QPK FD TGWELALV+TP   LS  QERQL GGL
Sbjct  393  SAIEESNALALAIVPSGTTPFDSNPAQPKDFDPTGWELALVTTPSSDLSAAQERQLAGGL  452

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
            DSLT NSLYDEGA RASQQPVYG PAPNPFEVADPFAMS+ +   PSVQ+A +P      
Sbjct  453  DSLTLNSLYDEGAYRASQQPVYGQPAPNPFEVADPFAMSSTMPPLPSVQMAMVPQHQMNP  512

Query  310  pfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                      PQNP+M  PH P GD G  AFPANN     AH Q TNPFGS
Sbjct  513  FGPFQPPYPQPQNPMM-NPHNPFGDAGFSAFPANN----VAHPQTTNPFGS  558



>ref|XP_010274743.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nelumbo 
nucifera]
Length=564

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 115/177 (65%), Gaps = 11/177 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSE----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPS + S     TVQ K  D TGWELALV+TP   +S+  ERQL 
Sbjct  388  DASAIEESNALALAIVPSTSISSHDNGTVQAKDIDPTGWELALVTTPSSNISSVTERQLA  447

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GGLD+LT NSLYD+GA RA+QQPVYGAPAPNPFEV DPFAMSN +A PP+VQ+A M    
Sbjct  448  GGLDTLTLNSLYDDGAYRAAQQPVYGAPAPNPFEVQDPFAMSNNVAPPPAVQIAAMAQQQ  507

Query  319  p---fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                             Q  LM+GP  P GDTG GAFP N       H QN NPFGS
Sbjct  508  SNPFAHYQLNYPQQQQQQQHLMMGPSNPFGDTGFGAFPVN----PVLHTQNNNPFGS  560



>ref|XP_002284689.2| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Vitis vinifera]
 emb|CBI26868.3| unnamed protein product [Vitis vinifera]
Length=567

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 116/180 (64%), Gaps = 13/180 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D SAIEESNALAL IVPSG+       S   Q K FD TGWELALV+TP   +S+  ERQ
Sbjct  387  DASAIEESNALALAIVPSGSAAAPTFDSGAFQAKDFDPTGWELALVTTPSSNISSANERQ  446

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLD+LT  SLYDEGA RA+QQPVYGAPAPNPFEV DPFA+SN +AAPP+VQ+A M  
Sbjct  447  LAGGLDTLTLTSLYDEGAYRAAQQPVYGAPAPNPFEVHDPFAVSNGVAAPPAVQMAAMAQ  506

Query  325  px----pfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                     P +        Q  LM GP  P GD G GAFP N      AH QN NPFGS
Sbjct  507  QQPNPFAPYPTYQQQQQQQQQQHLMFGPPNPFGDAGFGAFPRNT---TTAHPQNNNPFGS  563



>ref|XP_010654389.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Vitis vinifera]
Length=568

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 116/181 (64%), Gaps = 14/181 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT-------SETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            D SAIEESNALAL IVPSG+        S   Q K FD TGWELALV+TP   +S+  ER
Sbjct  387  DASAIEESNALALAIVPSGSAAAAPTFDSGAFQAKDFDPTGWELALVTTPSSNISSANER  446

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLD+LT  SLYDEGA RA+QQPVYGAPAPNPFEV DPFA+SN +AAPP+VQ+A M 
Sbjct  447  QLAGGLDTLTLTSLYDEGAYRAAQQPVYGAPAPNPFEVHDPFAVSNGVAAPPAVQMAAMA  506

Query  328  xpx----pfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                      P +        Q  LM GP  P GD G GAFP N      AH QN NPFG
Sbjct  507  QQQPNPFAPYPTYQQQQQQQQQQHLMFGPPNPFGDAGFGAFPRNT---TTAHPQNNNPFG  563

Query  160  S  158
            S
Sbjct  564  S  564



>ref|XP_007222905.1| hypothetical protein PRUPE_ppa003610mg [Prunus persica]
 gb|EMJ24104.1| hypothetical protein PRUPE_ppa003610mg [Prunus persica]
Length=562

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 115/177 (65%), Gaps = 9/177 (5%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGA------TSETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            SDVS +EE NALAL IV S         S  VQPK FD TGWELALV+TP   +S+  ER
Sbjct  385  SDVSVMEERNALALAIVSSETDAAPTFNSSAVQPKDFDPTGWELALVTTPSNNISSVNER  444

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDEGA RA+QQPVYGAPAPNPFEV DPFA+SN +A PP VQ+A M 
Sbjct  445  QLAGGLDSLTLNSLYDEGAYRAAQQPVYGAPAPNPFEVQDPFALSNNVAPPPGVQMAAMA  504

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                           P Q  +M+GP  P GDTG GAFPA+       H Q +NPFGS
Sbjct  505  QQQSNPFGSFQPTYQPQQQNVMMGPTNPFGDTGFGAFPAH---PPAPHPQTSNPFGS  558



>ref|XP_010101968.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB90892.1| Putative clathrin assembly protein [Morus notabilis]
Length=584

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 116/181 (64%), Gaps = 15/181 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            DVSAIEE NALAL IVPS         S  ++ K FD TGWELALVSTP   +STP +RQ
Sbjct  404  DVSAIEERNALALAIVPSETNAAPTFNSSAIEAKDFDPTGWELALVSTPSTNISTPTDRQ  463

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYGAPAPNPFEV DPFAMSN +A PP VQ+A +  
Sbjct  464  LAGGLDSLTLNSLYDEAAYRASQQPVYGAPAPNPFEVQDPFAMSNGVAPPPPVQMAALAQ  523

Query  325  pxp-----fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                    + P         PQ  L++ P  P GD G GAFPAN     G HQQ  NPFG
Sbjct  524  QQANPFGPYQPTFQPQMQPQPQQHLLMSPANPFGDAGFGAFPAN----PGPHQQQKNPFG  579

Query  160  S  158
            S
Sbjct  580  S  580



>ref|XP_010265534.1| PREDICTED: putative clathrin assembly protein At2g01600 [Nelumbo 
nucifera]
Length=559

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 113/175 (65%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSE----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D S IEESNALAL IVPS   +     TVQ K FD +GWELALV+TP   +S+  ERQL 
Sbjct  385  DASVIEESNALALAIVPSTDHASHDNGTVQTKDFDPSGWELALVTTPSSNISSVTERQLA  444

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GGLD+LT NSLYDEGA RA+Q+PVYGAP PNPFEV DPFA+SN +  PP+VQ+A M    
Sbjct  445  GGLDTLTLNSLYDEGAYRAAQKPVYGAPTPNPFEVQDPFALSNNVVPPPAVQMAAMSQQQ  504

Query  319  pf-gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                  +        Q  L++G   P GDTG GAFP N       H QNTNPFGS
Sbjct  505  SNPFIHYQPNYQPQQQRNLIMGASNPFGDTGFGAFPVN----PALHPQNTNPFGS  555



>ref|XP_008221433.1| PREDICTED: putative clathrin assembly protein At2g01600 [Prunus 
mume]
Length=562

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 115/177 (65%), Gaps = 9/177 (5%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGA------TSETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            +DVS +EE NALAL IV S         S  VQPK FD TGWELALV+TP   +S+  ER
Sbjct  385  ADVSVMEERNALALAIVSSETDAAPTFNSSAVQPKDFDPTGWELALVTTPSNNISSVNER  444

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDEGA RA+QQPVYGAPAPNPFEV DPFA+SN +A PP VQ+A M 
Sbjct  445  QLAGGLDSLTLNSLYDEGAYRAAQQPVYGAPAPNPFEVQDPFALSNNVAPPPGVQMAAMA  504

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                           P Q  +M+GP  P GDTG GAFPA+       H Q +NPFGS
Sbjct  505  QQQSNPFGPFQPTYQPQQQNVMMGPTNPFGDTGFGAFPAH---PPAPHPQTSNPFGS  558



>ref|XP_009351512.1| PREDICTED: putative clathrin assembly protein At2g01600 [Pyrus 
x bretschneideri]
Length=563

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 113/178 (63%), Gaps = 11/178 (6%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGA------TSETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            +DVSAIE+ NALAL I+ S A       S   Q   FD TGWELALV+TP   +S P ER
Sbjct  386  ADVSAIEDRNALALAIITSEADAAPTFNSSAAQTNGFDPTGWELALVTTPSTDISAPNER  445

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDEGA RASQQPVYG+PAPNPFEV DPFA SN +A PP VQ+A M 
Sbjct  446  QLAGGLDSLTLNSLYDEGAYRASQQPVYGSPAPNPFEVQDPFAFSNNVAPPPGVQMAAMS  505

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGD-TGXGAFPANNGDAAGAHQQNTNPFGS  158
                    H       PQ  +M+G   P GD TG GAFPAN       H Q +NPFGS
Sbjct  506  QQQSNPFGHFQPTYQQPQPNVMMGATNPFGDTTGFGAFPAN----PAPHPQTSNPFGS  559



>ref|XP_008389195.1| PREDICTED: putative clathrin assembly protein At2g01600 [Malus 
domestica]
Length=561

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 113/178 (63%), Gaps = 11/178 (6%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGA------TSETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            +DVSAIE+ NALAL I+ S A       S   Q   FD TGWELALVSTP   +S P ER
Sbjct  384  ADVSAIEDRNALALAIITSEADAAPTFNSGAAQANGFDPTGWELALVSTPSTDISAPNER  443

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDEGA RASQQPVYGAPAPNPFEV DPFA SN IA PP+VQ+A M 
Sbjct  444  QLAGGLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVQDPFAFSNNIAPPPAVQIASMA  503

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGD-TGXGAFPANNGDAAGAHQQNTNPFGS  158
                            PQ  +M+G   P GD TG G FPA    +   H Q++NPFGS
Sbjct  504  QQQSNPFGPFQPTYQQPQPNVMMGATNPFGDTTGFGTFPA----SPAPHPQSSNPFGS  557



>ref|XP_010044208.1| PREDICTED: putative clathrin assembly protein At2g01600 [Eucalyptus 
grandis]
 gb|KCW86254.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=568

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 113/181 (62%), Gaps = 14/181 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATSETV-----QPKXFDRTGWELALVSTPGXXLSTPQER  509
            D S+IEE NALAL IVPS  GA S        Q K F+ TGWELALVSTP   +S   ER
Sbjct  387  DASSIEEKNALALAIVPSEPGAASSAFGSGATQSKDFNPTGWELALVSTPSTNISAANER  446

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLD+LT +SLYDEGA RASQQPVYGAPAPNPFEV DPFAMSN IA PPSVQ+A + 
Sbjct  447  QLAGGLDTLTLHSLYDEGAYRASQQPVYGAPAPNPFEVQDPFAMSNGIAPPPSVQMAAIN  506

Query  328  xpxp----fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                                PQ  LM+GP  P GD G GAFP N   +A      TNPFG
Sbjct  507  QQQTNPFGPYQPTYPPQQQLPQQHLMMGPTNPFGDPGFGAFPVN---SASHPPPATNPFG  563

Query  160  S  158
            S
Sbjct  564  S  564



>emb|CDP00810.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 112/173 (65%), Gaps = 7/173 (4%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT-SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            D SAIEESNALAL IVPSG T S +   K FD TGWELALV+TP   LS+ QERQL GGL
Sbjct  386  DASAIEESNALALAIVPSGTTDSSSASIKDFDPTGWELALVTTPSSNLSSSQERQLAGGL  445

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
            D+LT NSLYD+GA RASQQP+YG PAPNPFEV DPFA+SN I  P SVQ+  MP P    
Sbjct  446  DTLTLNSLYDDGAYRASQQPMYGVPAPNPFEVHDPFAVSNNIPPPHSVQMGAMPQPQANP  505

Query  310  p--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               F P       Q   M+    P GD G  AFP N    +  H Q TNPFGS
Sbjct  506  FGPFQPVYPQNQQQQHYMMSQQNPFGDAGFTAFPVN----SVGHPQTTNPFGS  554



>ref|XP_011070604.1| PREDICTED: putative clathrin assembly protein At2g01600 [Sesamum 
indicum]
Length=564

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 119/175 (68%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIEE+NALAL IVPSG T   S+  Q K FD TGWELALV+TP   LS+ QERQL G
Sbjct  390  DASAIEETNALALAIVPSGTTPFDSDAPQVKDFDPTGWELALVTTPSTNLSSVQERQLAG  449

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
            GLDSLT NSLYDEGA RASQQPVYGAPAPNPFEV+DPFA+SN +  PP+VQ+A M  P  
Sbjct  450  GLDSLTLNSLYDEGAYRASQQPVYGAPAPNPFEVSDPFAISNNVPPPPTVQMAAMTQPQN  509

Query  316  f--gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                PF PA      Q  L++ P  P GD G GA       A  AH Q TNPFGS
Sbjct  510  NPFAPFQPAYPPPQQQQHLLMSPQNPFGDAGFGA----FPAAPAAHPQTTNPFGS  560



>ref|XP_011075418.1| PREDICTED: putative clathrin assembly protein At2g01600 [Sesamum 
indicum]
Length=507

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IEESN LAL IVPS  T   S   QP  FD TGWELALV+TP   LS+ QE+QL G
Sbjct  334  DASVIEESNTLALAIVPSETTPFESNVSQPN-FDPTGWELALVTTPSINLSSVQEKQLVG  392

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
            GLDSLT  SLYDEGA RASQQP+YGAPAPNPFEV DPFAMS+ +A PP+VQ   +     
Sbjct  393  GLDSLTLESLYDEGAYRASQQPIYGAPAPNPFEVGDPFAMSDTVAMPPAVQTVAVSQHQN  452

Query  316  --fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
              F PF PA      Q  L++GP  P GD G  AFP         H Q TNPFGS
Sbjct  453  NPFAPFQPAYPQAQQQQQLLMGPQNPFGDAGFVAFPVE----PSVHPQTTNPFGS  503



>ref|XP_011023782.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Populus euphratica]
Length=563

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA----TSETV--QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + S IEESNALAL IVPS +    T  +V  Q K FD TGWELALVSTP   +S   ERQ
Sbjct  386  NASTIEESNALALAIVPSESDVAPTFNSVAGQAKDFDPTGWELALVSTPSSNISATNERQ  445

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDEGA RA++QPVYGAPAPNPFE  DPFA+SN+IAAPPSVQ+A M  
Sbjct  446  LAGGLDSLTLNSLYDEGAYRAARQPVYGAPAPNPFETQDPFALSNSIAAPPSVQMAAMTQ  505

Query  325  pxpfgp--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                    + P       Q  +M+    P GDTG GAF A+      AH Q  NPFGS
Sbjct  506  QPHNPFGPYQPTYPQPQHQQNMMMSHANPFGDTGFGAFHAH----PMAHPQTNNPFGS  559



>ref|XP_011023792.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Populus euphratica]
Length=562

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA----TSETV--QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + S IEESNALAL IVPS +    T  +V  Q K FD TGWELALVSTP   +S   ERQ
Sbjct  385  NASTIEESNALALAIVPSESDVAPTFNSVAGQAKDFDPTGWELALVSTPSSNISATNERQ  444

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDEGA RA++QPVYGAPAPNPFE  DPFA+SN+IAAPPSVQ+A M  
Sbjct  445  LAGGLDSLTLNSLYDEGAYRAARQPVYGAPAPNPFETQDPFALSNSIAAPPSVQMAAMTQ  504

Query  325  pxpfgp--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                    + P       Q  +M+    P GDTG GAF A+      AH Q  NPFGS
Sbjct  505  QPHNPFGPYQPTYPQPQHQQNMMMSHANPFGDTGFGAFHAH----PMAHPQTNNPFGS  558



>ref|XP_011463190.1| PREDICTED: putative clathrin assembly protein At2g01600 [Fragaria 
vesca subsp. vesca]
Length=557

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 114/174 (66%), Gaps = 12/174 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS-GATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            D SAIEESNALAL IVPS  A +  VQ K FD +GWELALV TP   +S+  +RQL GGL
Sbjct  388  DASAIEESNALALAIVPSETAPTFNVQSKDFDPSGWELALVETPSTNISSANDRQLAGGL  447

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
            DSLT NSLYDEG  RASQQPVYG PAPNPFEV DPFA+SN +AAPP+VQ+A M       
Sbjct  448  DSLTLNSLYDEGQYRASQQPVYGQPAPNPFEVQDPFALSNNVAAPPAVQMAAMAQQQSNP  507

Query  310  pfhpaxaaypPQNPLMVG-PHXPXGD-TGXGAFPANNGDAAGAHQ-QNTNPFGS  158
                     PPQ  +M+G    P GD TG G FP        AHQ Q +NPFGS
Sbjct  508  FGPFQPTYQPPQQNMMMGATSNPFGDTTGFGTFP--------AHQPQTSNPFGS  553



>gb|KCW86253.1| hypothetical protein EUGRSUZ_B02940 [Eucalyptus grandis]
Length=574

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 113/187 (60%), Gaps = 20/187 (11%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--------GATSETV-----QPKXFDRTGWELALVSTPGXXL  527
            D S+IEE NALAL IVPS        GA S        Q K F+ TGWELALVSTP   +
Sbjct  387  DASSIEEKNALALAIVPSEPVWRVVTGAASSAFGSGATQSKDFNPTGWELALVSTPSTNI  446

Query  526  STPQERQLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
            S   ERQL GGLD+LT +SLYDEGA RASQQPVYGAPAPNPFEV DPFAMSN IA PPSV
Sbjct  447  SAANERQLAGGLDTLTLHSLYDEGAYRASQQPVYGAPAPNPFEVQDPFAMSNGIAPPPSV  506

Query  346  QLApmpxpxp----fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQ  179
            Q+A +                     PQ  LM+GP  P GD G GAFP N   +A     
Sbjct  507  QMAAINQQQTNPFGPYQPTYPPQQQLPQQHLMMGPTNPFGDPGFGAFPVN---SASHPPP  563

Query  178  NTNPFGS  158
             TNPFGS
Sbjct  564  ATNPFGS  570



>gb|EYU21032.1| hypothetical protein MIMGU_mgv1a020579mg [Erythranthe guttata]
Length=565

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 108/173 (62%), Gaps = 13/173 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            S IEE NALAL IVPSG T  S++ Q   FD TGWELALV+ P   LS+ QERQL GGLD
Sbjct  395  SVIEERNALALAIVPSGTTTFSDSSQANKFDPTGWELALVTAPSANLSSVQERQLAGGLD  454

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx----  320
            +LT  SLYDEGA RASQ+PVYGAP PNPFEV+DPFAMSN +  PPSVQ+A M        
Sbjct  455  TLTLESLYDEGAYRASQRPVYGAPTPNPFEVSDPFAMSNNVPMPPSVQMATMQQNNPFGP  514

Query  319  pfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                          Q    +GPH P GD+G G+FP +   AA       NPFG
Sbjct  515  FQQQPSSYPHQSQQQQHFQMGPHNPFGDSGFGSFPTHPQTAA-------NPFG  560



>ref|XP_002311513.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEE88880.1| clathrin assembly family protein [Populus trichocarpa]
Length=562

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 115/178 (65%), Gaps = 12/178 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA----TSETV--QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + S IEESNALAL IVPS +    T  +V  Q K FD TGWELALV+TP   +S   ERQ
Sbjct  385  NASTIEESNALALAIVPSESDVAPTFNSVAGQAKDFDPTGWELALVTTPSSNISATNERQ  444

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDEGA RA+++PVYGAPAPNPFE+ DPFA+SN+IAAPPSVQ+A M  
Sbjct  445  LAGGLDSLTLNSLYDEGAYRAARRPVYGAPAPNPFEIQDPFALSNSIAAPPSVQMAAMTQ  504

Query  325  pxpfgp--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                    + P       Q  +M+    P GD G GAF A+      AH Q  NPFGS
Sbjct  505  QPHNPFGPYQPTYPQPQHQQNMMMSHANPFGDAGFGAFHAH----PMAHPQTNNPFGS  558



>ref|XP_006469211.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Citrus sinensis]
Length=561

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 112/179 (63%), Gaps = 14/179 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATSETVQ-----PKXFDRTGWELALVSTPGXXLSTPQER  509
            D SAIEESNALAL IVPS  GAT+ T        K FD TGWELALVSTP   +S+  ER
Sbjct  384  DASAIEESNALALAIVPSEPGATAPTFNSGAGLTKDFDPTGWELALVSTPSTNISSANER  443

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDE A RA QQP YGA APNPFEV D FAMSN +A PPSVQ+A M 
Sbjct  444  QLAGGLDSLTLNSLYDEAAYRA-QQPAYGAAAPNPFEVQDIFAMSNGVAPPPSVQMAAMA  502

Query  328  xpxpfgp--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                     F P     P Q  LM+ P  P GDTG GAFP N       H Q  NPFG+
Sbjct  503  QQQTNPFGPFQPTYQQLPQQQHLMMNPSNPFGDTGFGAFPVN----PVTHPQANNPFGT  557



>gb|KJB60908.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=522

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + SAIEESNALAL IVP      S   S   QPK FD TGWELALV+TP   +S P ERQ
Sbjct  345  NASAIEESNALALAIVPTESGTASAFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQ  404

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYG  APNPFEV DPFA+SN IA P  VQ+A    
Sbjct  405  LAGGLDSLTLNSLYDEAAYRASQQPVYGTAAPNPFEVQDPFAVSNNIATPTVVQMA--AM  462

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                     +     PQ  L++ P  P GD G GAFPAN      A     NPFG
Sbjct  463  GQQQNNPFGSYQPTYPQQHLVMRPSNPFGDAGLGAFPANQM-VPFAQPHANNPFG  516



>gb|KJB60910.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=509

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + SAIEESNALAL IVP      S   S   QPK FD TGWELALV+TP   +S P ERQ
Sbjct  332  NASAIEESNALALAIVPTESGTASAFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQ  391

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYG  APNPFEV DPFA+SN IA P  VQ+A    
Sbjct  392  LAGGLDSLTLNSLYDEAAYRASQQPVYGTAAPNPFEVQDPFAVSNNIATPTVVQMA--AM  449

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                     +     PQ  L++ P  P GD G GAFPAN      A     NPFG
Sbjct  450  GQQQNNPFGSYQPTYPQQHLVMRPSNPFGDAGLGAFPANQM-VPFAQPHANNPFG  503



>gb|KJB60906.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=531

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + SAIEESNALAL IVP      S   S   QPK FD TGWELALV+TP   +S P ERQ
Sbjct  354  NASAIEESNALALAIVPTESGTASAFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQ  413

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYG  APNPFEV DPFA+SN IA P  VQ+A    
Sbjct  414  LAGGLDSLTLNSLYDEAAYRASQQPVYGTAAPNPFEVQDPFAVSNNIATPTVVQMA--AM  471

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                     +     PQ  L++ P  P GD G GAFPAN      A     NPFG
Sbjct  472  GQQQNNPFGSYQPTYPQQHLVMRPSNPFGDAGLGAFPANQM-VPFAQPHANNPFG  525



>gb|KJB60907.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=545

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + SAIEESNALAL IVP      S   S   QPK FD TGWELALV+TP   +S P ERQ
Sbjct  368  NASAIEESNALALAIVPTESGTASAFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQ  427

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYG  APNPFEV DPFA+SN IA P  VQ+A    
Sbjct  428  LAGGLDSLTLNSLYDEAAYRASQQPVYGTAAPNPFEVQDPFAVSNNIATPTVVQMA--AM  485

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                     +     PQ  L++ P  P GD G GAFPAN      A     NPFG
Sbjct  486  GQQQNNPFGSYQPTYPQQHLVMRPSNPFGDAGLGAFPANQM-VPFAQPHANNPFG  539



>ref|XP_007045208.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOY01040.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=565

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 111/178 (62%), Gaps = 9/178 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS----GAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AIEESNALAL IVP+    G T  S T QPK FD TGWELALV+TP   +S   +RQ
Sbjct  385  DALAIEESNALALAIVPTEPGTGPTFNSTTGQPKDFDPTGWELALVTTPSSDISAVNDRQ  444

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYGAPAPNPFEV DPFAMSN IA   +VQ+A M  
Sbjct  445  LAGGLDSLTLNSLYDEAAYRASQQPVYGAPAPNPFEVQDPFAMSNNIAPARAVQMAAMAQ  504

Query  325  pxpfgp--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
            P       + P       Q  +M+ P  P GD G GAFP N          N NPFGS
Sbjct  505  PQSNPFGPYQPTYQQPLQQQHMMMSPSNPFGDAGFGAFPVNQMPPVAQPHAN-NPFGS  561



>ref|XP_006448214.1| hypothetical protein CICLE_v10014774mg [Citrus clementina]
 gb|ESR61454.1| hypothetical protein CICLE_v10014774mg [Citrus clementina]
Length=561

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 112/179 (63%), Gaps = 14/179 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATSETVQ-----PKXFDRTGWELALVSTPGXXLSTPQER  509
            D SAIEESNALAL IVPS  GAT+ T        K FD TGWELALVSTP   +S+  ER
Sbjct  384  DASAIEESNALALAIVPSEPGATAPTFNSGAGLTKDFDPTGWELALVSTPSTNISSANER  443

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDE A RA QQP YGA APNPFEV D FAMSN +A PPSVQ+A M 
Sbjct  444  QLAGGLDSLTLNSLYDEAAYRA-QQPAYGAAAPNPFEVQDIFAMSNGVAPPPSVQMAAMA  502

Query  328  xpxpfgp--fhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                     F P     P Q  LM+ P  P GDTG GAFP N       H Q  NPFG+
Sbjct  503  QQQTNPFGPFQPTYQQLPQQQHLMMNPSNPFGDTGFGAFPLN----PVTHPQANNPFGT  557



>ref|XP_004142277.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Cucumis sativus]
 ref|XP_004156128.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Cucumis sativus]
 gb|KGN49630.1| hypothetical protein Csa_5G033480 [Cucumis sativus]
Length=566

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 111/181 (61%), Gaps = 16/181 (9%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            ++VSAIEE NALAL IVPSG T      S   Q   FD TGWELALV+TP   LS+  ER
Sbjct  388  TEVSAIEERNALALAIVPSGDTEAPTFHSNGAQANDFDPTGWELALVTTPSTNLSSANER  447

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLD+L  +SLYDEGA RAS QPVYG PAPNPFEV DPFA SNAIA PPSVQ+AP+ 
Sbjct  448  QLAGGLDTLILDSLYDEGAYRASLQPVYGKPAPNPFEVQDPFAYSNAIAPPPSVQMAPLA  507

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQ----NTNPFG  161
                             Q P  + P  P GD+G GAFPA N      H       +NPFG
Sbjct  508  QQQANPFGPFQPTFPQQQQPFTMDPTNPFGDSGFGAFPAPN------HHTVPPPASNPFG  561

Query  160  S  158
            S
Sbjct  562  S  562



>ref|XP_008464707.1| PREDICTED: putative clathrin assembly protein At2g01600 [Cucumis 
melo]
Length=657

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 110/177 (62%), Gaps = 8/177 (5%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQER  509
            ++VSAIEE NALAL IVPSG T      S       FD TGWELALV+TP   LST  ER
Sbjct  479  TEVSAIEERNALALAIVPSGDTEAPTFHSNGAHANDFDPTGWELALVTTPSTNLSTANER  538

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLD+LT +SLYDEGA RAS QPVYG PAPNPFEV DPFA SNAIA PPSVQ+AP+ 
Sbjct  539  QLAGGLDTLTLDSLYDEGAYRASLQPVYGKPAPNPFEVQDPFAYSNAIAPPPSVQMAPLA  598

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
             P               Q P  + P  P GD G GAFPA N          +NPFGS
Sbjct  599  QPQANPFGPFQPTFPQQQQPFTMDPTNPFGDAGFGAFPAPNHHTVPP--PASNPFGS  653



>gb|KJB60905.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
 gb|KJB60909.1| hypothetical protein B456_009G330700 [Gossypium raimondii]
Length=562

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + SAIEESNALAL IVP      S   S   QPK FD TGWELALV+TP   +S P ERQ
Sbjct  385  NASAIEESNALALAIVPTESGTASAFNSSAGQPKDFDPTGWELALVTTPSTDISAPTERQ  444

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RASQQPVYG  APNPFEV DPFA+SN IA P  VQ+A    
Sbjct  445  LAGGLDSLTLNSLYDEAAYRASQQPVYGTAAPNPFEVQDPFAVSNNIATPTVVQMA--AM  502

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                     +     PQ  L++ P  P GD G GAFPAN      A     NPFG
Sbjct  503  GQQQNNPFGSYQPTYPQQHLVMRPSNPFGDAGLGAFPANQM-VPFAQPHANNPFG  556



>gb|KDP38084.1| hypothetical protein JCGZ_04727 [Jatropha curcas]
Length=564

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 110/178 (62%), Gaps = 12/178 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV------QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D SAIEESNALAL I+P+   +         Q K FD TGWELALV+TP   +S+  ERQ
Sbjct  387  DASAIEESNALALAIIPTEQNAAPTFNSGAGQAKDFDPTGWELALVTTPSTNISSVNERQ  446

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYD+ A RA+QQPVYGAPAPNPFEV DPFAMSN IA    VQ+A M  
Sbjct  447  LAGGLDSLTLNSLYDDAAYRAAQQPVYGAPAPNPFEVQDPFAMSNGIAPSAGVQMAAMAQ  506

Query  325  pxpf-gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAH-QQNTNPFGS  158
                    +      P Q  L++GP  P GDTG G FP N      AH   N NPFGS
Sbjct  507  QASNPFGPYQPAYPQPQQQHLLMGPTNPFGDTGFGTFPVNT----VAHPHVNNNPFGS  560



>gb|EYU33129.1| hypothetical protein MIMGU_mgv1a0037702mg, partial [Erythranthe 
guttata]
Length=479

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 108/173 (62%), Gaps = 13/173 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            S IEE NALAL IVPSG T  S++ Q   FD TGWELALV+ P   LS+ QERQL GGLD
Sbjct  309  SVIEERNALALAIVPSGTTTFSDSSQANKFDPTGWELALVTAPSANLSSVQERQLAGGLD  368

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx----  320
            +LT  SLYDEGA RASQ+PVYGAP PNPFEV+DPFAMSN +  PPSVQ+A M        
Sbjct  369  TLTLESLYDEGAYRASQRPVYGAPTPNPFEVSDPFAMSNNVPMPPSVQMATMQQNNPFGP  428

Query  319  pfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                          Q  L +GP  P GD+G G+FP +   AA       NPFG
Sbjct  429  FQQQSSYPHQFQQQQQHLQMGPQNPFGDSGFGSFPTHPQTAA-------NPFG  474



>ref|XP_003524854.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
isoform 1 [Glycine max]
 gb|KHN46088.1| Putative clathrin assembly protein [Glycine soja]
Length=569

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 116/181 (64%), Gaps = 14/181 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATS----ETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S+IEE NALAL IVP+  GATS       Q K FD TGWELALVSTP   +S   ERQ
Sbjct  388  DASSIEERNALALAIVPTETGATSAFNSTASQTKDFDPTGWELALVSTPSTDISAANERQ  447

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A R++QQPVYGAPAPNPFEV DPFA+S++I  PP+VQ+A M  
Sbjct  448  LAGGLDSLTLNSLYDEAAYRSAQQPVYGAPAPNPFEVQDPFALSSSIPPPPAVQMAAMQQ  507

Query  325  p-----xpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                      PF P       Q  +++ P  P GD G GAFPA+N      H QN NPFG
Sbjct  508  QANPFGSYQQPFQPQPQLQQQQQLMLMNPANPFGDAGFGAFPASN---PVPHPQNNNPFG  564

Query  160  S  158
            S
Sbjct  565  S  565



>gb|KHN12469.1| Putative clathrin assembly protein [Glycine soja]
Length=568

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 114/181 (63%), Gaps = 15/181 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATS----ETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S+IEE NALAL IVP+  G TS       Q K FD TGWELALVSTP   +S   ERQ
Sbjct  388  DASSIEERNALALAIVPTETGTTSAFNTTAAQTKDFDPTGWELALVSTPSTDISAANERQ  447

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A R SQQPVYGAPAPNPFE+ DPFA+S++I  PP+VQLA M  
Sbjct  448  LAGGLDSLTLNSLYDEAAYR-SQQPVYGAPAPNPFEMQDPFALSSSIPPPPAVQLAAMQQ  506

Query  325  px-----pfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                      PF P       Q+ +++ P  P GD G GAFPA N      H QN NPFG
Sbjct  507  QANPFGPYQQPFQPQPQPQQQQHHMLMNPANPFGDAGFGAFPAPN---PAPHPQNNNPFG  563

Query  160  S  158
            S
Sbjct  564  S  564



>ref|XP_003531146.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
isoform 1 [Glycine max]
Length=568

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 114/181 (63%), Gaps = 15/181 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATS----ETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S+IEE NALAL IVP+  G TS       Q K FD TGWELALVSTP   +S   ERQ
Sbjct  388  DASSIEERNALALAIVPTETGTTSAFNTTAAQTKDFDPTGWELALVSTPSTDISAANERQ  447

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A R SQQPVYGAPAPNPFE+ DPFA+S++I  PP+VQLA M  
Sbjct  448  LAGGLDSLTLNSLYDEAAYR-SQQPVYGAPAPNPFEMQDPFALSSSIPPPPAVQLAAMQQ  506

Query  325  px-----pfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                      PF P       Q+ +++ P  P GD G GAFPA N      H QN NPFG
Sbjct  507  QANPFGPYQQPFQPQPQPQQQQHHMLMNPANPFGDAGFGAFPAPN---PAPHPQNNNPFG  563

Query  160  S  158
            S
Sbjct  564  S  564



>gb|KDO64585.1| hypothetical protein CISIN_1g008579mg [Citrus sinensis]
Length=561

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 114/179 (64%), Gaps = 14/179 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS--GATSETVQ-----PKXFDRTGWELALVSTPGXXLSTPQER  509
            D SAIEESNALAL IVPS  GAT+ T        K FD TGWELALVSTP   +S+  ER
Sbjct  384  DASAIEESNALALAIVPSEPGATAPTFNSGAGLTKDFDPTGWELALVSTPSTNISSANER  443

Query  508  QLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            QL GGLDSLT NSLYDE A RA QQP YGA APNPF+V D FAMSN +A PPSVQ+A M 
Sbjct  444  QLAGGLDSLTLNSLYDEAAYRA-QQPAYGAAAPNPFDVQDIFAMSNGVAPPPSVQMAAMA  502

Query  328  xpxpf--gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                   GPF P     P Q  LM+ P  P GDTG GAFP N       H Q  NPFG+
Sbjct  503  QQQTNPFGPFQPTYQQPPQQQHLMMNPSNPFGDTGFGAFPVN----PVTHPQANNPFGT  557



>ref|XP_002315872.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
 gb|EEF02043.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
Length=549

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 111/178 (62%), Gaps = 16/178 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S+IEESNALAL I+PS +       S   Q K FD TGWELALV+TP   +S   ERQ
Sbjct  376  DASSIEESNALALAIIPSESNAAPTFNSAAGQAKDFDPTGWELALVTTPSSNISATNERQ  435

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT +SLY EGA RA+QQPVYGAPAPNPFEV DPFA+SN+IA PPSVQ+A M  
Sbjct  436  LAGGLDSLTLDSLYHEGAYRAAQQPVYGAPAPNPFEVQDPFALSNSIAPPPSVQMAAMAQ  495

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHX-PXGD-TGXGAFPANNGDAAGAHQQNTNPFGS  158
                           PQ   ++  H  P GD TG GAFP        AH +  NPFGS
Sbjct  496  QPHNPFSPYQPPYPQPQQQHVMTSHANPFGDTTGFGAFP--------AHPETNNPFGS  545



>ref|XP_002315925.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
 gb|EEF02096.2| hypothetical protein POPTR_0010s12020g [Populus trichocarpa]
Length=555

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 111/178 (62%), Gaps = 16/178 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S+IEESNALAL I+PS +       S   Q K FD TGWELALV+TP   +S   ERQ
Sbjct  382  DASSIEESNALALAIIPSESNAAPTFNSAAGQAKDFDPTGWELALVTTPSSNISATNERQ  441

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT +SLY EGA RA+QQPVYGAPAPNPFEV DPFA+SN+IA PPSVQ+A M  
Sbjct  442  LAGGLDSLTLDSLYHEGAYRAAQQPVYGAPAPNPFEVQDPFALSNSIAPPPSVQMAAMAQ  501

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHX-PXGD-TGXGAFPANNGDAAGAHQQNTNPFGS  158
                           PQ   ++  H  P GD TG GAFP        AH +  NPFGS
Sbjct  502  QPHNPFSPYQPPYPQPQQQHVMTSHANPFGDTTGFGAFP--------AHPETNNPFGS  551



>ref|XP_007158803.1| hypothetical protein PHAVU_002G183100g [Phaseolus vulgaris]
 gb|ESW30797.1| hypothetical protein PHAVU_002G183100g [Phaseolus vulgaris]
Length=563

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 110/179 (61%), Gaps = 14/179 (8%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S IEE NALAL IVP      S   S + Q K FD TGWELALVSTP   +S   ERQ
Sbjct  386  DASLIEERNALALAIVPTEIGTTSAFNSTSAQTKDFDPTGWELALVSTPSTDISAANERQ  445

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A R+SQQP YGAPAPNPFEV DPFA+SN++  PP+VQ+A M  
Sbjct  446  LAGGLDSLTLNSLYDEAAYRSSQQPQYGAPAPNPFEVHDPFALSNSVPPPPAVQMAAMHH  505

Query  325  pxp---fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                          +  P Q  +++ P  P GD G GAFP N      +H QN NPFGS
Sbjct  506  QANPFGPYQPFQPQSQPPQQQHMLMNPANPFGDAGFGAFPPN----PVSHPQN-NPFGS  559



>ref|XP_011038608.1| PREDICTED: putative clathrin assembly protein At2g01600 [Populus 
euphratica]
Length=558

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 110/178 (62%), Gaps = 16/178 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT------SETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D S+IEESNALAL I+PS +       S   Q K FD TGWELALVSTP   +S   ERQ
Sbjct  385  DASSIEESNALALAIIPSESNAAPTFNSAAGQAKDFDPTGWELALVSTPSSNISATNERQ  444

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT +SLY EGA RA+QQPVYGAPAPNPFEV DPF +SN+IA PPSVQ+A M  
Sbjct  445  LAGGLDSLTLDSLYHEGAYRAAQQPVYGAPAPNPFEVQDPFVLSNSIAPPPSVQMAAMAQ  504

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHX-PXGD-TGXGAFPANNGDAAGAHQQNTNPFGS  158
                           PQ   ++  H  P GD TG GAFP        AH +  NPFGS
Sbjct  505  QPHNPFSPYQPPYPQPQQQHVMMSHANPFGDTTGFGAFP--------AHPETNNPFGS  554



>gb|KJB30769.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=526

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA-TSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D SAIEESNALAL IVP+ + T+ T      QP  FD TGWELALV+TP   +S P +RQ
Sbjct  346  DASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALVTTPSTDISAPTDRQ  405

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RA Q P YG PAPNPF+  DPFAMSN +A PP+VQ+A M  
Sbjct  406  LAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNNVAPPPAVQMAAMAQ  464

Query  325  pxpf---gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                               Q  LM+ P  P GDTG GAFP N     G    N NPFGS
Sbjct  465  QQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDTGFGAFPVNQVAPVGQPHAN-NPFGS  522



>gb|KJB30771.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=539

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA-TSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D SAIEESNALAL IVP+ + T+ T      QP  FD TGWELALV+TP   +S P +RQ
Sbjct  359  DASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALVTTPSTDISAPTDRQ  418

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RA Q P YG PAPNPF+  DPFAMSN +A PP+VQ+A M  
Sbjct  419  LAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNNVAPPPAVQMAAMAQ  477

Query  325  pxpf---gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                               Q  LM+ P  P GDTG GAFP N     G    N NPFGS
Sbjct  478  QQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDTGFGAFPVNQVAPVGQPHAN-NPFGS  535



>gb|KJB30768.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=566

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA-TSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D SAIEESNALAL IVP+ + T+ T      QP  FD TGWELALV+TP   +S P +RQ
Sbjct  386  DASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALVTTPSTDISAPTDRQ  445

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RA Q P YG PAPNPF+  DPFAMSN +A PP+VQ+A M  
Sbjct  446  LAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNNVAPPPAVQMAAMAQ  504

Query  325  pxpf---gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                               Q  LM+ P  P GDTG GAFP N     G    N NPFGS
Sbjct  505  QQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDTGFGAFPVNQVAPVGQPHAN-NPFGS  562



>gb|KJB30770.1| hypothetical protein B456_005G159800 [Gossypium raimondii]
Length=592

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA-TSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D SAIEESNALAL IVP+ + T+ T      QP  FD TGWELALV+TP   +S P +RQ
Sbjct  412  DASAIEESNALALAIVPTESGTASTFNSSAGQPVEFDPTGWELALVTTPSTDISAPTDRQ  471

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDE A RA Q P YG PAPNPF+  DPFAMSN +A PP+VQ+A M  
Sbjct  472  LAGGLDSLTLNSLYDEAAYRA-QHPAYGTPAPNPFDAQDPFAMSNNVAPPPAVQMAAMAQ  530

Query  325  pxpf---gpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                               Q  LM+ P  P GDTG GAFP N     G    N NPFGS
Sbjct  531  QQNNPFGAYQPAYQQPQQQQQQLMMSPSNPFGDTGFGAFPVNQVAPVGQPHAN-NPFGS  588



>ref|XP_002527787.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF34597.1| clathrin assembly protein, putative [Ricinus communis]
Length=567

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 115/183 (63%), Gaps = 20/183 (11%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVP----------SGATSETVQPKXFDRTGWELALVSTPGXXLST  521
            S  SAIEE NALAL IVP          SGA     QPK FD TGWELALV+TP   +S+
Sbjct  389  SAASAIEERNALALAIVPLEQDAAPTFNSGAG----QPKDFDPTGWELALVTTPSANISS  444

Query  520  PQERQLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQL  341
              +RQL GGLD+LT NSLYD+ A RA+QQPVYGAPAPNPFEV DPFAMSN+IA P +VQ+
Sbjct  445  VNDRQLAGGLDTLTLNSLYDDVAYRAAQQPVYGAPAPNPFEVHDPFAMSNSIAPPSAVQM  504

Query  340  Apmpxp--xpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNP  167
            A M      PFGP+ P       Q  LM+ P  P GD G G FP N       H  + NP
Sbjct  505  AAMTQQPPNPFGPYQPTYPQPQQQQHLMMSPANPFGDAGFGTFPVNT----VTHPHSNNP  560

Query  166  FGS  158
            FGS
Sbjct  561  FGS  563



>ref|XP_004504573.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Cicer arietinum]
Length=564

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 113/177 (64%), Gaps = 11/177 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            + S+IEE NALAL IVP      S   S   Q K FD TGWELALVSTP   +S+  ERQ
Sbjct  388  NASSIEERNALALAIVPTETGTASAFNSSAAQTKDFDPTGWELALVSTPSTDISSVNERQ  447

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            L GGLDSLT NSLYDEGA RA+QQPVYG PAPNPFEV DPFA+S++IA   +VQ+A M  
Sbjct  448  LAGGLDSLTLNSLYDEGAYRAAQQPVYGTPAPNPFEVHDPFAISSSIAPSAAVQMAAMQQ  507

Query  325  pxp-fgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                FGP+    A    Q  +++ P  P  D+G GAF A       +H QN NPFGS
Sbjct  508  QANPFGPYQQFQAQPQQQQHMLMNPANPFADSGFGAFHAT----PVSHPQNNNPFGS  560



>ref|XP_010553785.1| PREDICTED: putative clathrin assembly protein At2g01600 [Tarenaya 
hassleriana]
Length=578

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 111/190 (58%), Gaps = 23/190 (12%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS----GATSETVQP-KXFDRTGWELALVSTPGXXLSTPQERQL  503
            D S IE+ NALAL IVP+     +++    P K FD TGWELALV+T    +S   ERQL
Sbjct  388  DASVIEDQNALALAIVPTNGDNSSSASGFNPAKDFDPTGWELALVTTSSTDISAATERQL  447

Query  502  XGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
             GGLD+LT NSLYDEGA RASQ+PVYGAPAPNPFEV DPFA+SN I  PPSVQL+ +   
Sbjct  448  AGGLDTLTLNSLYDEGAYRASQRPVYGAPAPNPFEVQDPFALSNGIPPPPSVQLSAVTAQ  507

Query  322  xpfgpfhpaxaa--ypPQNPLMVGPHXPXGD-------------TGXGAFPANNGDAAGA  188
             P               Q+ L+  P  P GD             TG G FP   G+ A  
Sbjct  508  QPAANNPFGPYQPPTYTQHQLVPSPTNPFGDFSVNPLPQPTAHTTGFGDFP---GNPAAH  564

Query  187  HQQNTNPFGS  158
            HQ + NPFGS
Sbjct  565  HQAHNNPFGS  574



>gb|KHN03156.1| Putative clathrin assembly protein [Glycine soja]
Length=554

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 107/175 (61%), Gaps = 10/175 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIV--PSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQL  503
            D S IEE NALAL IV   +G+T   S   Q + FD T WE+ALVSTP   +S+  ERQL
Sbjct  381  DASLIEERNALALAIVSTETGSTALDSSGAQARDFDPTEWEIALVSTPSTNISSVNERQL  440

Query  502  XGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
             GGL+SLT +SLYDEGA R++QQPVY  PAPNPFEV DPFA+S++I    +VQ+A +   
Sbjct  441  AGGLNSLTLSSLYDEGAYRSAQQPVYVVPAPNPFEVQDPFALSSSIPPTSTVQMAAIAQQ  500

Query  322  xpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                  H        Q+ LM  P  P GD G GAFP N      +H  N NPFGS
Sbjct  501  HINPFLHYQPYQPLQQHMLM-NPANPFGDAGYGAFPVN----PVSHPHNKNPFGS  550



>ref|XP_003533950.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Glycine max]
Length=554

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 107/175 (61%), Gaps = 10/175 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIV--PSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQL  503
            D S IEE NALAL IV   +G+T   S   Q + FD T WE+ALVSTP   +S+  ERQL
Sbjct  381  DASLIEERNALALAIVSTETGSTALDSSGAQARDFDPTEWEIALVSTPSTNISSVNERQL  440

Query  502  XGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
             GGL+SLT +SLYDEGA R++QQPVY  PAPNPFEV DPFA+S++I    +VQ+A +   
Sbjct  441  AGGLNSLTLSSLYDEGAYRSAQQPVYVVPAPNPFEVQDPFALSSSIPPTSTVQMAAIAQQ  500

Query  322  xpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                  H        Q+ LM  P  P GD G GAFP N      +H  N NPFGS
Sbjct  501  HINPFLHYQPYQPLQQHMLM-NPANPFGDAGYGAFPVN----PVSHPHNKNPFGS  550



>gb|KHG06013.1| hypothetical protein F383_02907 [Gossypium arboreum]
 gb|KHG17498.1| hypothetical protein F383_05122 [Gossypium arboreum]
Length=561

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 105/177 (59%), Gaps = 9/177 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP--SGA----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AIE+ NALAL IVP  SG     +S   Q K FD TGWELALV+TP   +S   ERQ
Sbjct  383  DAFAIEQINALALAIVPIDSGTAPTYSSAAGQSKDFDPTGWELALVTTPSTDISAAAERQ  442

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGA-PAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GGLDSLT NSLYDE A RASQQPVYG+  APNPFEV DPFAMSN+IA P +VQ++   
Sbjct  443  LAGGLDSLTLNSLYDEAAYRASQQPVYGSTTAPNPFEVQDPFAMSNSIATPIAVQMS--G  500

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P      A   Y  Q+  +     P GD G G FP N          N NPFGS
Sbjct  501  MTQPQNNPFDAYQPYQQQHLTIPSASNPFGDAGFGTFPVNQTAVIAQPHANNNPFGS  557



>gb|KHG06012.1| hypothetical protein F383_02907 [Gossypium arboreum]
Length=693

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 105/177 (59%), Gaps = 9/177 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP--SGA----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AIE+ NALAL IVP  SG     +S   Q K FD TGWELALV+TP   +S   ERQ
Sbjct  515  DAFAIEQINALALAIVPIDSGTAPTYSSAAGQSKDFDPTGWELALVTTPSTDISAAAERQ  574

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGA-PAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GGLDSLT NSLYDE A RASQQPVYG+  APNPFEV DPFAMSN+IA P +VQ++   
Sbjct  575  LAGGLDSLTLNSLYDEAAYRASQQPVYGSTTAPNPFEVQDPFAMSNSIATPIAVQMS--G  632

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P      A   Y  Q+  +     P GD G G FP N          N NPFGS
Sbjct  633  MTQPQNNPFDAYQPYQQQHLTIPSASNPFGDAGFGTFPVNQTAVIAQPHANNNPFGS  689



>gb|KJB78155.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=500

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 104/177 (59%), Gaps = 9/177 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP-SGATSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AI++ N LAL IVP    T+ T      QPK FD TGWELALV+TP   +S   ERQ
Sbjct  322  DAFAIKQINTLALAIVPIDSGTAPTYSSGAGQPKDFDPTGWELALVTTPSTDISAAAERQ  381

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGA-PAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GGLDSLT NSLYDE A RASQQPVYG+  APNPFEV DPFAMSN+IA P +VQ++   
Sbjct  382  LAGGLDSLTFNSLYDEAANRASQQPVYGSTTAPNPFEVHDPFAMSNSIAPPIAVQMS--G  439

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P      A   Y  Q+  +     P GD G G FP N          N NPFGS
Sbjct  440  MAQPQNNPFDAYQPYQQQHLTIPSASNPFGDAGFGTFPVNQTAVIAQPHANNNPFGS  496



>gb|KJB78156.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=561

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 105/177 (59%), Gaps = 9/177 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP--SGA----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AI++ N LAL IVP  SG     +S   QPK FD TGWELALV+TP   +S   ERQ
Sbjct  383  DAFAIKQINTLALAIVPIDSGTAPTYSSGAGQPKDFDPTGWELALVTTPSTDISAAAERQ  442

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGA-PAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GGLDSLT NSLYDE A RASQQPVYG+  APNPFEV DPFAMSN+IA P +VQ++   
Sbjct  443  LAGGLDSLTFNSLYDEAANRASQQPVYGSTTAPNPFEVHDPFAMSNSIAPPIAVQMS--G  500

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P      A   Y  Q+  +     P GD G G FP N          N NPFGS
Sbjct  501  MAQPQNNPFDAYQPYQQQHLTIPSASNPFGDAGFGTFPVNQTAVIAQPHANNNPFGS  557



>gb|KJB78157.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=561

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 104/177 (59%), Gaps = 9/177 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP-SGATSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AI++ N LAL IVP    T+ T      QPK FD TGWELALV+TP   +S   ERQ
Sbjct  383  DAFAIKQINTLALAIVPIDSGTAPTYSSGAGQPKDFDPTGWELALVTTPSTDISAAAERQ  442

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGA-PAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GGLDSLT NSLYDE A RASQQPVYG+  APNPFEV DPFAMSN+IA P +VQ++   
Sbjct  443  LAGGLDSLTFNSLYDEAANRASQQPVYGSTTAPNPFEVHDPFAMSNSIAPPIAVQMS--G  500

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P      A   Y  Q+  +     P GD G G FP N          N NPFGS
Sbjct  501  MAQPQNNPFDAYQPYQQQHLTIPSASNPFGDAGFGTFPVNQTAVIAQPHANNNPFGS  557



>gb|KJB78154.1| hypothetical protein B456_012G181700 [Gossypium raimondii]
Length=560

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 105/177 (59%), Gaps = 9/177 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP--SGA----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            D  AI++ N LAL IVP  SG     +S   QPK FD TGWELALV+TP   +S   ERQ
Sbjct  382  DAFAIKQINTLALAIVPIDSGTAPTYSSGAGQPKDFDPTGWELALVTTPSTDISAAAERQ  441

Query  505  LXGGLDSLTXNSLYDEGAXRASQQPVYGA-PAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GGLDSLT NSLYDE A RASQQPVYG+  APNPFEV DPFAMSN+IA P +VQ++   
Sbjct  442  LAGGLDSLTFNSLYDEAANRASQQPVYGSTTAPNPFEVHDPFAMSNSIAPPIAVQMS--G  499

Query  328  xpxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P      A   Y  Q+  +     P GD G G FP N          N NPFGS
Sbjct  500  MAQPQNNPFDAYQPYQQQHLTIPSASNPFGDAGFGTFPVNQTAVIAQPHANNNPFGS  556



>ref|XP_010921268.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X4 [Elaeis guineensis]
 ref|XP_010921278.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X4 [Elaeis guineensis]
 ref|XP_010921284.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X4 [Elaeis guineensis]
Length=310

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 105/182 (58%), Gaps = 16/182 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPSG T+       Q K FD +GWELALV+TP    S+  E  L 
Sbjct  134  DASAIEESNALALAIVPSGDTTSIDSGMTQEKGFDPSGWELALVTTPSSTNSSMVESHLG  193

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GG D LT +SLYDE A R  QQ  YGAPAPNPF  ADPFAMSN + APP+VQ A M    
Sbjct  194  GGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPFLSADPFAMSNRVTAPPAVQTAAMAQQQ  253

Query  319  pfgpfhpaxaaypPQNP-----LMVG-PHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                      + P   P     ++VG    P GD G GAFPANN       Q  TNPFG+
Sbjct  254  QQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFGDVGVGAFPANNP------QHQTNPFGT  307

Query  157  LL  152
             L
Sbjct  308  QL  309



>ref|XP_010921261.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X3 [Elaeis guineensis]
Length=533

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 105/182 (58%), Gaps = 16/182 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPSG T+       Q K FD +GWELALV+TP    S+  E  L 
Sbjct  357  DASAIEESNALALAIVPSGDTTSIDSGMTQEKGFDPSGWELALVTTPSSTNSSMVESHLG  416

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GG D LT +SLYDE A R  QQ  YGAPAPNPF  ADPFAMSN + APP+VQ A M    
Sbjct  417  GGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPFLSADPFAMSNRVTAPPAVQTAAMAQQQ  476

Query  319  pfgpfhpaxaaypPQNP-----LMVG-PHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                      + P   P     ++VG    P GD G GAFPANN       Q  TNPFG+
Sbjct  477  QQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFGDVGVGAFPANNP------QHQTNPFGT  530

Query  157  LL  152
             L
Sbjct  531  QL  532



>ref|XP_010921255.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Elaeis guineensis]
Length=558

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 105/182 (58%), Gaps = 16/182 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPSG T+       Q K FD +GWELALV+TP    S+  E  L 
Sbjct  382  DASAIEESNALALAIVPSGDTTSIDSGMTQEKGFDPSGWELALVTTPSSTNSSMVESHLG  441

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GG D LT +SLYDE A R  QQ  YGAPAPNPF  ADPFAMSN + APP+VQ A M    
Sbjct  442  GGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPFLSADPFAMSNRVTAPPAVQTAAMAQQQ  501

Query  319  pfgpfhpaxaaypPQNP-----LMVG-PHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                      + P   P     ++VG    P GD G GAFPANN       Q  TNPFG+
Sbjct  502  QQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFGDVGVGAFPANNP------QHQTNPFGT  555

Query  157  LL  152
             L
Sbjct  556  QL  557



>ref|XP_010921252.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Elaeis guineensis]
Length=560

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 105/182 (58%), Gaps = 16/182 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPSG T+       Q K FD +GWELALV+TP    S+  E  L 
Sbjct  384  DASAIEESNALALAIVPSGDTTSIDSGMTQEKGFDPSGWELALVTTPSSTNSSMVESHLG  443

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GG D LT +SLYDE A R  QQ  YGAPAPNPF  ADPFAMSN + APP+VQ A M    
Sbjct  444  GGFDKLTLDSLYDEAAYRRQQQQFYGAPAPNPFLSADPFAMSNRVTAPPAVQTAAMAQQQ  503

Query  319  pfgpfhpaxaaypPQNP-----LMVG-PHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                      + P   P     ++VG    P GD G GAFPANN       Q  TNPFG+
Sbjct  504  QQQQMSMMVPSNPFAQPIPQQHMVVGAASNPFGDVGVGAFPANNP------QHQTNPFGT  557

Query  157  LL  152
             L
Sbjct  558  QL  559



>ref|XP_007153280.1| hypothetical protein PHAVU_003G022000g [Phaseolus vulgaris]
 gb|ESW25274.1| hypothetical protein PHAVU_003G022000g [Phaseolus vulgaris]
Length=552

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 96/173 (55%), Gaps = 6/173 (3%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            SD S IEE NA AL IVP+   S     +  D TGWELALVSTP   +S   ERQL G L
Sbjct  380  SDASFIEERNAHALAIVPTEIDSRADPARDLDPTGWELALVSTPSTTVSPVNERQLAGRL  439

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfg  311
             SLT NS+YD GA R  QQP +G PAPNPFEV  PF +S +   PP+VQ+A +       
Sbjct  440  SSLTLNSIYDPGAYRYVQQPAFGVPAPNPFEVQHPFGLSTSFPRPPNVQMATISQEHIHH  499

Query  310  --pfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                +      P Q  +++ P  P  D G GAFP +      +H  N NPFGS
Sbjct  500  PFGHYQPYQHQPLQQHMLMSPANPFEDAGYGAFPVH----PVSHPHNNNPFGS  548



>ref|XP_010924074.1| PREDICTED: putative clathrin assembly protein At2g01600 [Elaeis 
guineensis]
Length=562

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 105/199 (53%), Gaps = 46/199 (23%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPS  T+ +    VQ K FD +GWELALV+TP    S+  E QL 
Sbjct  382  DASAIEESNALALAIVPSDYTTSSGSGMVQEKGFDPSGWELALVTTPSNTNSSMVESQLG  441

Query  499  GGLDSLTXNSLYDEGAXR------ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            GG D LT +SLYDE A R        QQ  YGAPAPNPF  ADPF MSN +AAPPSVQ  
Sbjct  442  GGFDKLTLDSLYDEAAYRQGQQQQQQQQQFYGAPAPNPFLSADPFMMSNQVAAPPSVQ--  499

Query  337  pmpxpxpfgpfhpaxaaypPQNPLMVGP-----------------HXPXGDTGXGAFPAN  209
                         A A    Q PLM  P                   P GD G GAFPAN
Sbjct  500  -----------MAAMAQQQQQMPLMAPPNPFFQPVPQQHMGIGAAQNPFGDVGFGAFPAN  548

Query  208  NGDAAGAHQQNTNPFGSLL  152
            N       Q  +NPFGS L
Sbjct  549  NT------QHQSNPFGSQL  561



>ref|XP_010681909.1| PREDICTED: putative clathrin assembly protein At2g01600 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 107/178 (60%), Gaps = 16/178 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPS---GATSE--TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            SAIEESNALAL IVPS    +TS   T   K FD  GWELALV+TP   +S+  ERQL G
Sbjct  392  SAIEESNALALAIVPSEDSASTSNYGTASAKEFDPNGWELALVTTPSNDISSHTERQLAG  451

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
            GLDSL  NSLYDE A RA+QQPVYGAPA NPFEV DPF MSN  A   +VQ+  M    P
Sbjct  452  GLDSLILNSLYDEAAYRANQQPVYGAPAHNPFEVQDPFGMSNNFAPSAAVQMNSMTQQPP  511

Query  316  fgpfhpaxaaypPQN--PLMVGPHXPXGDTGXGAF---PANNGDAAGAHQQNTNPFGS  158
              PF    A +  Q+  P+ VG   P  D G G +   PAN+       Q   NPFG+
Sbjct  512  ANPFGAYQAPFHAQSQPPVGVGAPNPFTDMGFGPYSVTPANHP------QHAANPFGN  563



>ref|XP_010527791.1| PREDICTED: putative clathrin assembly protein At2g01600 [Tarenaya 
hassleriana]
Length=572

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP-----SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQL  503
            D S IE+ NALAL IVP     S  TS   Q K FD TGWELALV+TP   +S   ERQL
Sbjct  388  DASVIEDQNALALAIVPTDGNNSSTTSGYGQVKEFDPTGWELALVTTPTPDISAATERQL  447

Query  502  XGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
             GGLD+LT NSLY+EGA RA QQP YGAPAPNPFEV DPFA++N   AP
Sbjct  448  AGGLDTLTLNSLYEEGAYRAGQQPAYGAPAPNPFEVQDPFALANVAPAP  496



>gb|EPS70597.1| hypothetical protein M569_04158, partial [Genlisea aurea]
Length=429

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = -1

Query  658  AIEESNALALXIVPSGATSETV-QPKXFDRTGWELALVSTPGXXLSTP--QERQLXGGLD  488
            AIEE+NALAL IVPSG++S    Q K FD TGWELALVSTP   LS+   QE+QL GGLD
Sbjct  259  AIEEANALALAIVPSGSSSNGSSQVKDFDPTGWELALVSTPSTNLSSSSVQEKQLAGGLD  318

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAI  365
            SLT NSLYDEGA RASQ PVYG+PAPNPF + DPFA+SN I
Sbjct  319  SLTLNSLYDEGAYRASQIPVYGSPAPNPFMINDPFAVSNRI  359



>ref|XP_008803559.1| PREDICTED: putative clathrin assembly protein At2g01600 [Phoenix 
dactylifera]
Length=557

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 105/179 (59%), Gaps = 15/179 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSG----ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            SAIEESNALAL IVPSG    + S  VQ K FD +GWELALV+TP    S+  E QL GG
Sbjct  384  SAIEESNALALAIVPSGGAPSSDSGMVQEKGFDPSGWELALVTTPSSNNSSMVENQLGGG  443

Query  493  LDSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
             D LT +SLYDE   R   QQ  YGA APNPF  ADPF MSN +AAPPSVQ+A M     
Sbjct  444  FDKLTLDSLYDEATYRQQQQQQFYGASAPNPFLSADPFMMSNQVAAPPSVQMAAMAQQQQ  503

Query  316  fgpfhp---axaaypPQNPLMVGPH-XPXGDTGXGAFPANNGDAAGAHQQNTNPFGSLL  152
                       A   PQ  +++G    P GD G GAFPANN       Q  +NPFG+ L
Sbjct  504  QMSMMAPPNPFAQPIPQQHVVIGAAPNPFGDVGFGAFPANNP------QHQSNPFGTQL  556



>ref|XP_006655551.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Oryza brachyantha]
Length=566

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 105/179 (59%), Gaps = 17/179 (9%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA-----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            VSAIEESNALAL IVP+ A     ++ T Q K FD TGWELALV+TP    S+  + QL 
Sbjct  389  VSAIEESNALALAIVPTDAGASTSSTATWQDKGFDPTGWELALVTTPSNTNSSVADSQLG  448

Query  499  GGLDSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
            GG D L  +SLYD+G  R   QQP+YG+ APNPF   DPFAMSN IA PPSVQ+A M   
Sbjct  449  GGFDKLILDSLYDQGDYRQRQQQPLYGSSAPNPFMSNDPFAMSNQIAPPPSVQMAAMSQQ  508

Query  322  xpfg-pfhpaxaaypPQNPLMVG---PHXPXGDTGXGAFP-ANNGDAAGAHQQNTNPFG  161
                     A    PP  P  VG      P  D+G G FP ANNG     HQQ  NPFG
Sbjct  509  HQQIPTMMQANPFGPPMQPQHVGMGPATNPFLDSGFGPFPVANNG-----HQQ-ANPFG  561



>ref|XP_009418441.1| PREDICTED: putative clathrin assembly protein At2g01600 [Musa 
acuminata subsp. malaccensis]
Length=560

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 104/179 (58%), Gaps = 14/179 (8%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPS--GATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            S+V+AIEE+NA+AL IVP+     S TVQ K FD TGWELALV+TP    +T  E +L G
Sbjct  384  SNVAAIEETNAMALAIVPASFATDSSTVQDKEFDPTGWELALVTTPSSNNATVVESKLAG  443

Query  496  GLDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
            G D LT +SLYDE A R    QQ  YGAP PNPF  ADPF +SN +AAPP+VQ+A M   
Sbjct  444  GFDKLTLDSLYDEAAYRQQQQQQQYYGAPPPNPFMAADPFTVSNQVAAPPAVQMAAMAQQ  503

Query  322  xpfgpfhpa----xaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                               Q+  M     P G  G GAFPA++      HQQN NPFG+
Sbjct  504  QQQMSMFMQSNPFAQPVYQQHVTMGAASNPFGGNGFGAFPASD-----PHQQN-NPFGN  556



>ref|XP_008799224.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Phoenix dactylifera]
Length=555

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 101/180 (56%), Gaps = 16/180 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT----SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIEESNALAL IVPSG T    S   Q K FD +GWELALV+TP    S+  E Q  
Sbjct  382  DASAIEESNALALTIVPSGGTISIDSGMAQEKGFDPSGWELALVTTPSSTNSSMVESQSG  441

Query  499  GGLDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            G  D LT +SLYDE A R    QQ  +GAPAPNPF    PFA SN +AAPP+VQ+A M  
Sbjct  442  GSFDKLTLDSLYDEAASRQIRQQQQFHGAPAPNPFLSTGPFATSNQVAAPPAVQMAAMAQ  501

Query  325  pxpfgpfhpax---aaypPQNPLMVG-PHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                          A    Q  +++G    P GD G GAFPAN+       Q  +NPFG+
Sbjct  502  QQQQMSMMVPSNPFAQPISQQHMVIGAASNPFGDVGFGAFPAND------KQHQSNPFGT  555



>emb|CDY17459.1| BnaC09g20780D [Brassica napus]
Length=570

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPS----GATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            D SAIE+ NALAL I+ +     +T  + Q   +D TGWELALV+TP   +S   +RQL 
Sbjct  389  DASAIEDQNALALAIISTDGGNASTPRSFQANDYDPTGWELALVTTPSNDISAATDRQLA  448

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            GGLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPFA SN    P
Sbjct  449  GGLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSNGTLPP  496



>ref|XP_009114226.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
 emb|CDY04095.1| BnaA09g18730D [Brassica napus]
Length=571

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET---VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIE+ NALAL I+ +   S T    Q   +D TGWELALV+TP   +S   +RQL G
Sbjct  391  DASAIEDQNALALAIISNDGNSSTPRSFQANDYDPTGWELALVTTPSNDISAATDRQLAG  450

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSN  371
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPFA SN
Sbjct  451  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSN  492



>ref|XP_008799223.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Phoenix dactylifera]
Length=558

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 101/183 (55%), Gaps = 19/183 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV-------QPKXFDRTGWELALVSTPGXXLSTPQER  509
            D SAIEESNALAL IVPSG    T+       Q K FD +GWELALV+TP    S+  E 
Sbjct  382  DASAIEESNALALTIVPSGVFGGTISIDSGMAQEKGFDPSGWELALVTTPSSTNSSMVES  441

Query  508  QLXGGLDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAp  335
            Q  G  D LT +SLYDE A R    QQ  +GAPAPNPF    PFA SN +AAPP+VQ+A 
Sbjct  442  QSGGSFDKLTLDSLYDEAASRQIRQQQQFHGAPAPNPFLSTGPFATSNQVAAPPAVQMAA  501

Query  334  mpxpxpfgpfhpax---aaypPQNPLMVG-PHXPXGDTGXGAFPANNGDAAGAHQQNTNP  167
            M                A    Q  +++G    P GD G GAFPAN+       Q  +NP
Sbjct  502  MAQQQQQMSMMVPSNPFAQPISQQHMVIGAASNPFGDVGFGAFPAND------KQHQSNP  555

Query  166  FGS  158
            FG+
Sbjct  556  FGT  558



>ref|XP_002441469.1| hypothetical protein SORBIDRAFT_09g027370 [Sorghum bicolor]
 gb|EES19899.1| hypothetical protein SORBIDRAFT_09g027370 [Sorghum bicolor]
Length=564

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 107/179 (60%), Gaps = 16/179 (9%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            VSAIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL G
Sbjct  388  VSAIEESNALALAIVPTDGASTTSNTAFQDKGFDATGWELALVTAPSNTTSSSSVGQLGG  447

Query  496  GLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            G D L  +SLYD+GA  +  QQ +YG+ APNPF   DPFAMSN +A PPSVQ+A M    
Sbjct  448  GFDKLILDSLYDDGAYRQRQQQQLYGSAAPNPFMTNDPFAMSNQVAPPPSVQMAAMSQQH  507

Query  319  pfgpfhpaxaayp--PQNPLMVGP--HXPXGDTGXGAFP-ANNGDAAGAHQQNTNPFGS  158
            P  P       +    Q  + +GP  + P  D+G GAFP ANNG     HQQ+ NPFGS
Sbjct  508  PQIPTMMQPNPFGPPMQPQMSMGPATNNPFLDSGFGAFPVANNG-----HQQH-NPFGS  560



>ref|XP_009101331.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
Length=571

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIEE NALAL ++P+     T    Q   +D +GWELALV+TP   +S   +RQL G
Sbjct  390  DASAIEEQNALALAVIPTDGNPPTPRFGQTNNYDPSGWELALVTTPSNDISAATDRQLAG  449

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSN  371
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPFA SN
Sbjct  450  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSN  491



>ref|XP_006395874.1| hypothetical protein EUTSA_v10003910mg [Eutrema salsugineum]
 gb|ESQ33160.1| hypothetical protein EUTSA_v10003910mg [Eutrema salsugineum]
Length=571

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIE  NALAL I+P+    +T    Q   +D +GWELALV+TP   +S   +RQL G
Sbjct  388  DASAIENQNALALAIIPTDGNPSTPRFGQANDYDPSGWELALVTTPSNDISAATDRQLAG  447

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPFA SN+   P
Sbjct  448  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVQDPFASSNSTPTP  494



>gb|AAD12692.3| expressed protein [Arabidopsis thaliana]
Length=348

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL IV + A   T    QP  +D TGWELALV+ P   +S   ER+L G
Sbjct  165  DTSVIEDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAPSSDISASTERKLAG  224

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT +SLYD+GA  ASQ+PVYGAPAPNPF   DPFA SN  A PP  Q
Sbjct  225  GLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTAPPPQQQ  275



>emb|CDY17660.1| BnaA06g34790D [Brassica napus]
Length=571

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIEE NALAL ++P+     T    Q   +D +GWELALV+TP   +S   +RQL G
Sbjct  390  DASAIEEQNALALAVIPTDGNPPTPSFGQTNNYDPSGWELALVTTPSNDISAATDRQLAG  449

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNA  368
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPFA SN+
Sbjct  450  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSNS  492



>emb|CDY36239.1| BnaC07g20930D [Brassica napus]
Length=571

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIE+ NALAL ++P+     T    Q   +D +GWELALV+TP   +S   +RQL G
Sbjct  390  DASAIEDQNALALAVIPTDGNPPTPRFGQTNNYDPSGWELALVTTPSNDISAATDRQLAG  449

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPFA SN+   P
Sbjct  450  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFATSNSTLPP  496



>gb|AFW80976.1| hypothetical protein ZEAMMB73_079219 [Zea mays]
Length=564

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 104/192 (54%), Gaps = 42/192 (22%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            VSAIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL G
Sbjct  388  VSAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSTSVGQLGG  447

Query  496  GLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GLD L   SLYD+GA  +  QQ +YG+ APNPF   DPFAMSN +A PPSVQ+A      
Sbjct  448  GLDKLILESLYDDGAYRQRQQQQLYGSAAPNPFMANDPFAMSNQVAPPPSVQMA------  501

Query  319  pfgpfhpaxaaypPQNPLMVGP-----------------HXPXGDTGXGAFP-ANNGDAA  194
                   A +    Q P M+ P                 + P  D G GAFP ANNG   
Sbjct  502  -------AMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATNNPFLDAGFGAFPAANNG---  551

Query  193  GAHQQNTNPFGS  158
              HQQ+ NPFGS
Sbjct  552  --HQQH-NPFGS  560



>gb|AFW80975.1| hypothetical protein ZEAMMB73_079219 [Zea mays]
Length=568

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 104/192 (54%), Gaps = 42/192 (22%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            VSAIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL G
Sbjct  392  VSAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSTSVGQLGG  451

Query  496  GLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GLD L   SLYD+GA  +  QQ +YG+ APNPF   DPFAMSN +A PPSVQ+A      
Sbjct  452  GLDKLILESLYDDGAYRQRQQQQLYGSAAPNPFMANDPFAMSNQVAPPPSVQMA------  505

Query  319  pfgpfhpaxaaypPQNPLMVGP-----------------HXPXGDTGXGAFP-ANNGDAA  194
                   A +    Q P M+ P                 + P  D G GAFP ANNG   
Sbjct  506  -------AMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATNNPFLDAGFGAFPAANNG---  555

Query  193  GAHQQNTNPFGS  158
              HQQ+ NPFGS
Sbjct  556  --HQQH-NPFGS  564



>ref|NP_001145773.1| uncharacterized protein LOC100279280 [Zea mays]
 gb|ACL52564.1| unknown [Zea mays]
Length=564

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 104/192 (54%), Gaps = 42/192 (22%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            VSAIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL G
Sbjct  388  VSAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSTSVGQLGG  447

Query  496  GLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            GLD L   SLYD+GA  +  QQ +YG+ APNPF   DPFAMSN +A PPSVQ+A      
Sbjct  448  GLDKLILESLYDDGAYRQRQQQQLYGSAAPNPFMANDPFAMSNQVAPPPSVQMA------  501

Query  319  pfgpfhpaxaaypPQNPLMVGP-----------------HXPXGDTGXGAFP-ANNGDAA  194
                   A +    Q P M+ P                 + P  D G GAFP ANNG   
Sbjct  502  -------AMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATNNPFLDAGFGAFPAANNG---  551

Query  193  GAHQQNTNPFGS  158
              HQQ+ NPFGS
Sbjct  552  --HQQH-NPFGS  560



>gb|AAM67368.1| unknown [Arabidopsis thaliana]
Length=306

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL IV + A   T    QP  +D TGWELALV+ P   +S   ER+L G
Sbjct  123  DTSVIEDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAPSSDISASTERKLAG  182

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT +SLYD+GA   SQ+PVYGAPAPNPF   DPFA SN  A PP  Q
Sbjct  183  GLDTLTLSSLYDDGAYITSQRPVYGAPAPNPFASHDPFASSNGTAPPPQQQ  233



>ref|XP_004969636.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Setaria italica]
Length=565

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 105/194 (54%), Gaps = 44/194 (23%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA-----TSETVQPKXFDRTGWELALVSTPGXXLS-TPQERQ  506
            +VS IEESNALAL I+P+G      ++ T Q K FD TGWELALV+TP    +    E  
Sbjct  388  NVSVIEESNALALAIMPTGVDNSTTSTATQQDKGFDPTGWELALVATPSTNTNPLAMESS  447

Query  505  LXGGLDSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
            L GG D LT +SLYD+G  R   QQ +YG+  PNPF  +DPFAMSN +A+PPSVQ+A M 
Sbjct  448  LGGGFDKLTLDSLYDDGTYRQMQQQQLYGSAPPNPFMASDPFAMSNQVASPPSVQMAAMA  507

Query  328  xpxpfgpfhpaxaaypPQNPLMV-----GP-----HX-------PXGDTGXGAFPANNGD  200
                              +PLM+     GP     H        P  D G GAFPA N  
Sbjct  508  QQP---------------HPLMIEANPFGPPLQPQHAGMAPAANPFLDAGFGAFPAAN--  550

Query  199  AAGAHQQNTNPFGS  158
              G H Q  NPFG+
Sbjct  551  --GMHPQ-ANPFGA  561



>ref|XP_009396332.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=566

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 101/181 (56%), Gaps = 16/181 (9%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSGATSE--TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            S  SAIE++NALAL IVP+ AT+   TVQ + FD TGWELALV+TP    +T  E +L G
Sbjct  388  SYASAIEDTNALALSIVPADATTNSGTVQDQVFDPTGWELALVTTPSSNNATAVESKLGG  447

Query  496  GLDSLTXNSLYDEGAXR---ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
            G D LT +SLYDE A R     QQ +YG P PNPF   DPFAMSN +AAPP+VQ+A M  
Sbjct  448  GFDKLTLDSLYDEAAYRQQQQQQQQLYGVPPPNPFMTTDPFAMSNQVAAPPAVQMAAMAQ  507

Query  325  pxpfgpfhpa----xaaypPQNPLMVGP-HXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
                                Q P+       P GD G G FP +N        Q +NPFG
Sbjct  508  QQQQMSMFMQSNPFAQPLYQQQPVSAATASNPFGDAGFGTFPVSNP------HQESNPFG  561

Query  160  S  158
            +
Sbjct  562  N  562



>ref|NP_565267.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q8LBH2.2|CAP8_ARATH RecName: Full=Putative clathrin assembly protein At2g01600 [Arabidopsis 
thaliana]
 gb|AAL11587.1|AF424593_1 At2g01600/F2I9.22 [Arabidopsis thaliana]
 gb|AAM15059.1| expressed protein [Arabidopsis thaliana]
 gb|AAM20138.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91762.1| unknown protein [Arabidopsis thaliana]
 gb|AEC05472.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=571

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL IV + A   T    QP  +D TGWELALV+ P   +S   ER+L G
Sbjct  388  DTSVIEDQNALALAIVSTDADPPTPHFGQPNNYDPTGWELALVTAPSSDISASTERKLAG  447

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT +SLYD+GA  ASQ+PVYGAPAPNPF   DPFA SN  A PP  Q
Sbjct  448  GLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTAPPPQQQ  498



>ref|XP_002456192.1| hypothetical protein SORBIDRAFT_03g031930 [Sorghum bicolor]
 gb|EES01312.1| hypothetical protein SORBIDRAFT_03g031930 [Sorghum bicolor]
Length=563

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 98/180 (54%), Gaps = 23/180 (13%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA--TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            VSAIEESNALAL I+P+G   ++ T Q + FD TGWELALV+T         E  L GG 
Sbjct  389  VSAIEESNALALAILPTGVDNSTTTQQDRGFDPTGWELALVTTSSNMTPLSMESNLGGGF  448

Query  490  DSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxpf  314
            D LT +SLYD+G  R   QQ +YG+  PNPF  +DPFA+SN +A PPSVQ+A M      
Sbjct  449  DKLTLDSLYDDGTYRQMQQQQLYGSAPPNPFMASDPFAVSNQVAPPPSVQMAAMAPQPQH  508

Query  313  gpfhpaxaaypPQNPL---------MVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFG  161
             P           NP          M     P  D G GAFPA N    G H Q TNPFG
Sbjct  509  LPMMIEA------NPFGPPQQHHAGMAPAANPFLDAGFGAFPAGN----GMHPQ-TNPFG  557



>gb|KFK33381.1| hypothetical protein AALP_AA5G005800 [Arabis alpina]
Length=572

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            SAIE+ NALAL I+P+     T    Q   +D +GWELALV+TP   +S   +RQL GGL
Sbjct  388  SAIEDQNALALAIIPTDVNPPTPRFGQANNYDPSGWELALVTTPSNDISAATDRQLAGGL  447

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            D+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV DPF  SN    P
Sbjct  448  DTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHDPFTSSNGTTPP  492



>gb|AFW78994.1| hypothetical protein ZEAMMB73_223268 [Zea mays]
Length=315

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 102/178 (57%), Gaps = 14/178 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            VSAIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL G
Sbjct  139  VSAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSASVGQLGG  198

Query  496  GLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            G D L  +SLYD+GA  +  QQ VYG+  PNPF   DPF MSN +A PPSVQ+A M    
Sbjct  199  GFDKLILDSLYDDGAYRQRQQQQVYGSAVPNPFMTNDPFVMSNQVAPPPSVQMAAMSQQH  258

Query  319  pfgpfhpaxaay--pPQNPLMVGP--HXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
               P       +  P Q  + +GP  + P  D G GAFP  N     +HQQ+ NPFGS
Sbjct  259  QQIPTMMQPNPFGPPMQPQVGMGPATNNPFLDAGFGAFPVAN----NSHQQH-NPFGS  311



>ref|XP_009396331.1| PREDICTED: putative clathrin assembly protein At2g01600 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=569

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 100/184 (54%), Gaps = 19/184 (10%)
 Frame = -1

Query  670  SDVSAIEESNALALXIVPSG-----ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQ  506
            S  SAIE++NALAL IVP+G       S TVQ + FD TGWELALV+TP    +T  E +
Sbjct  388  SYASAIEDTNALALSIVPAGMFDATTNSGTVQDQVFDPTGWELALVTTPSSNNATAVESK  447

Query  505  LXGGLDSLTXNSLYDEGAXR---ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLAp  335
            L GG D LT +SLYDE A R     QQ +YG P PNPF   DPFAMSN +AAPP+VQ+A 
Sbjct  448  LGGGFDKLTLDSLYDEAAYRQQQQQQQQLYGVPPPNPFMTTDPFAMSNQVAAPPAVQMAA  507

Query  334  mpxpxpfgpfhpa----xaaypPQNPLMVGP-HXPXGDTGXGAFPANNGDAAGAHQQNTN  170
            M                      Q P+       P GD G G FP +N        Q +N
Sbjct  508  MAQQQQQMSMFMQSNPFAQPLYQQQPVSAATASNPFGDAGFGTFPVSNP------HQESN  561

Query  169  PFGS  158
            PFG+
Sbjct  562  PFGN  565



>ref|NP_001136989.1| uncharacterized protein LOC100217151 [Zea mays]
 gb|ACF83027.1| unknown [Zea mays]
 gb|AFW78996.1| hypothetical protein ZEAMMB73_223268 [Zea mays]
Length=563

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 100/191 (52%), Gaps = 40/191 (21%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            VSAIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL G
Sbjct  387  VSAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSASVGQLGG  446

Query  496  GLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpx  320
            G D L  +SLYD+GA  +  QQ VYG+  PNPF   DPF MSN +A PPSVQ+A      
Sbjct  447  GFDKLILDSLYDDGAYRQRQQQQVYGSAVPNPFMTNDPFVMSNQVAPPPSVQMA------  500

Query  319  pfgpfhpaxaaypPQNPLMVGP-----------------HXPXGDTGXGAFPANNGDAAG  191
                   A +    Q P M+ P                 + P  D G GAFP  N     
Sbjct  501  -------AMSQQHQQIPTMMQPNPFGPPMQPQVGMGPATNNPFLDAGFGAFPVAN----N  549

Query  190  AHQQNTNPFGS  158
            +HQQ+ NPFGS
Sbjct  550  SHQQH-NPFGS  559



>ref|XP_010424931.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=284

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL I+ + A   T    Q   +D TGWELALV+ P   +S   ER+L G
Sbjct  99   DASVIEDQNALALAIISTDANPSTPGFGQANDYDPTGWELALVTAPSSDISAATERKLAG  158

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT +SLYD+GA  ASQ+PVYGAPAPNPF   DPFA SN    PP  Q
Sbjct  159  GLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTTPPPQQQ  209



>ref|XP_008672590.1| PREDICTED: uncharacterized protein LOC100276465 isoform X2 [Zea 
mays]
 gb|ACN29328.1| unknown [Zea mays]
 tpg|DAA57998.1| TPA: hypothetical protein ZEAMMB73_100643 [Zea mays]
Length=560

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 99/188 (53%), Gaps = 38/188 (20%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            V AIEES+ALAL I+P+G   +T+ T Q   FD TGWELALV+T         E  L GG
Sbjct  385  VLAIEESSALALAILPTGIDNSTTTTQQDSGFDPTGWELALVTTSSNATPLSMESNLGGG  444

Query  493  LDSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
             D LT +SLYD+G  R   QQ +YG+  PNPF  +DPFA+SN +A PPSVQ+A M     
Sbjct  445  FDKLTLDSLYDDGTYRQMQQQQLYGSAPPNPFMASDPFAVSNQVAPPPSVQMAAMAPQPQ  504

Query  316  fgpfhpaxaaypPQNPLMVGPH----------------XPXGDTGXGAFPANNGDAAGAH  185
                           P+M+ P+                 P  D G GAFPA N    G H
Sbjct  505  HL-------------PMMIEPNPFGPPQQHHAGVAPAANPFLDAGFGAFPAVN----GMH  547

Query  184  QQNTNPFG  161
             Q TNPFG
Sbjct  548  PQ-TNPFG  554



>ref|XP_008672589.1| PREDICTED: uncharacterized protein LOC100276465 isoform X1 [Zea 
mays]
Length=566

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 99/188 (53%), Gaps = 38/188 (20%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            V AIEES+ALAL I+P+G   +T+ T Q   FD TGWELALV+T         E  L GG
Sbjct  391  VLAIEESSALALAILPTGIDNSTTTTQQDSGFDPTGWELALVTTSSNATPLSMESNLGGG  450

Query  493  LDSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
             D LT +SLYD+G  R   QQ +YG+  PNPF  +DPFA+SN +A PPSVQ+A M     
Sbjct  451  FDKLTLDSLYDDGTYRQMQQQQLYGSAPPNPFMASDPFAVSNQVAPPPSVQMAAMAPQPQ  510

Query  316  fgpfhpaxaaypPQNPLMVGPH----------------XPXGDTGXGAFPANNGDAAGAH  185
                           P+M+ P+                 P  D G GAFPA N    G H
Sbjct  511  HL-------------PMMIEPNPFGPPQQHHAGVAPAANPFLDAGFGAFPAVN----GMH  553

Query  184  QQNTNPFG  161
             Q TNPFG
Sbjct  554  PQ-TNPFG  560



>emb|CDY53525.1| BnaC05g11150D [Brassica napus]
Length=697

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            I + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL GGLD+
Sbjct  387  ILDQNALALALVSTDVESSFFDLGQARDSDPSGWELALVTTPSSDISATTERQLAGGLDT  446

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            LT NSLYD+ A RA+QQP YGAPAPNPFEV DPFA SN+++AP
Sbjct  447  LTLNSLYDDVAYRAAQQPAYGAPAPNPFEVQDPFAFSNSVSAP  489



>ref|NP_001043956.1| Os01g0694900 [Oryza sativa Japonica Group]
 dbj|BAD81807.1| clathrin assembly protein AP180 short form-like [Oryza sativa 
Japonica Group]
 dbj|BAF05870.1| Os01g0694900 [Oryza sativa Japonica Group]
 dbj|BAG88648.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55230.1| hypothetical protein OsJ_03107 [Oryza sativa Japonica Group]
Length=568

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 99/189 (52%), Gaps = 33/189 (17%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET-----VQPKXFDRTGWELALVSTPGXXL-STPQERQL  503
            VSAIEESNALAL I+P+G  + T     +Q K FD TGWELALV+TP     S   +  L
Sbjct  389  VSAIEESNALALAIIPTGGETSTSGTATLQDKGFDPTGWELALVTTPSTNTNSMAMDSNL  448

Query  502  XGGLDSLTXNSLYDEGAXRASQQP--VYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
             GG D L  +SLYDEG  R   Q   +YG+ APNPF  +DPFAMSN +A PPSVQ+A   
Sbjct  449  GGGFDKLILDSLYDEGTYRQQMQQQQLYGSAAPNPFMASDPFAMSNQVAPPPSVQMA---  505

Query  328  xpxpfgpfhpaxaaypPQNPLMVGP-----HX-------PXGDTGXGAFPANNGDAAGAH  185
                              NP   GP     H        P  D G G FPA+N    G H
Sbjct  506  ---SMTQQPQQMPMMMQPNPF--GPPLQPQHAGIAQAPNPFLDAGFGPFPASN----GMH  556

Query  184  QQNTNPFGS  158
             Q  NPFG+
Sbjct  557  PQ-ANPFGT  564



>gb|KFK32949.1| hypothetical protein AALP_AA6G310300 [Arabis alpina]
Length=705

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = -1

Query  658  AIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            AI + NALAL +V +   S T    Q    D +GWELALV+TP   +S   ERQL GGLD
Sbjct  396  AILDQNALALALVSADVDSSTFGFGQANDLDPSGWELALVTTPSDDISAATERQLAGGLD  455

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPS  350
            +LT NSLYD+GA RA+QQP YGAP PNPFEV DPF  SN++  PPS
Sbjct  456  TLTLNSLYDDGAYRAAQQPAYGAPTPNPFEVQDPFTFSNSV-PPPS  500



>gb|EEC71324.1| hypothetical protein OsI_03369 [Oryza sativa Indica Group]
Length=568

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 99/189 (52%), Gaps = 33/189 (17%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET-----VQPKXFDRTGWELALVSTPGXXL-STPQERQL  503
            VSAIEESNALAL I+P+G  + T     +Q K FD TGWELALV+TP     S   +  L
Sbjct  389  VSAIEESNALALAIIPTGGETSTSGTATLQDKGFDPTGWELALVTTPSTNTNSMAMDSNL  448

Query  502  XGGLDSLTXNSLYDEGAXRASQQP--VYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmp  329
             GG D L  +SLYDEG  R   Q   +YG+ APNPF  +DPFAMSN +A PPSVQ+A   
Sbjct  449  GGGFDKLILDSLYDEGTYRQQMQQQQLYGSAAPNPFMASDPFAMSNQVAPPPSVQMA---  505

Query  328  xpxpfgpfhpaxaaypPQNPLMVGP-----HX-------PXGDTGXGAFPANNGDAAGAH  185
                              NP   GP     H        P  D G G FPA+N    G H
Sbjct  506  ---SMTQQPQQMPMMMQPNPF--GPPLQPQHAGIAQAPNPFLDAGFGPFPASN----GMH  556

Query  184  QQNTNPFGS  158
             Q  NPFG+
Sbjct  557  PQ-ANPFGT  564



>ref|XP_004961341.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Setaria italica]
Length=564

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 102/177 (58%), Gaps = 16/177 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            SAIEESNALAL IVP+  TS T     Q K FD TGWELALV+ P    S+    QL GG
Sbjct  389  SAIEESNALALAIVPTDGTSTTGNAAFQDKGFDPTGWELALVTAPSNTTSSASSSQLGGG  448

Query  493  LDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxpxp  317
             D L  +SLYD+GA  +  QQ +YG+  PNPF   DPFAMSN +A PPSVQ+A M     
Sbjct  449  FDKLILDSLYDDGAYRQRQQQQLYGSAVPNPFMTNDPFAMSNQVAPPPSVQMAAMSQQHQ  508

Query  316  fgpfhpaxaayp--PQNPLMVGP--HXPXGDTGXGAFP-ANNGDAAGAHQQNTNPFG  161
              P       +    Q  + +GP  + P  D G G FP ANNG     HQQ+ NPFG
Sbjct  509  QIPTVMQPNPFGPPMQPQMGMGPATNNPFLDAGFGPFPVANNG-----HQQH-NPFG  559



>ref|XP_010476568.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=707

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            I + NALAL +V +     T    Q +  D +GWELALV+TP   +S   ERQL GGLD+
Sbjct  394  ILDQNALALALVSTDDDFSTFGFGQARDLDSSGWELALVTTPSNDISAATERQLAGGLDT  453

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            LT NSLYD GA  A+QQP YGAPAPNPFEV DPFA SN++A P
Sbjct  454  LTLNSLYDNGAYIAAQQPAYGAPAPNPFEVQDPFAFSNSVAPP  496



>ref|XP_002875082.1| hypothetical protein ARALYDRAFT_904366 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51341.1| hypothetical protein ARALYDRAFT_904366 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSET---VQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL I+ + A   T    Q   +D TGWELALV+ P   +S   ER+L G
Sbjct  387  DASVIEDQNALALAIISTDANPSTPRFGQANDYDPTGWELALVTAPSSDISAATERKLAG  446

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPP  353
            GLD+LT +SLYD+GA  ASQ+PVYGAPAPNPF   DPFA SN    PP
Sbjct  447  GLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTTPPP  494



>ref|NP_001056232.1| Os05g0549000 [Oryza sativa Japonica Group]
 dbj|BAF18146.1| Os05g0549000 [Oryza sativa Japonica Group]
 gb|EEE64590.1| hypothetical protein OsJ_19442 [Oryza sativa Japonica Group]
Length=567

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 102/179 (57%), Gaps = 17/179 (9%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA-----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            VSAIEESNALAL IVP+ A     ++ T Q K FD TGWELALV+TP    S+  + QL 
Sbjct  390  VSAIEESNALALAIVPADAGASTSSTATWQDKGFDPTGWELALVTTPSNTNSSAADSQLG  449

Query  499  GGLDSLTXNSLYDEG-AXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
            GG D L   SLYD+G   +  QQ +YG+ APNPF   DPF MSN +A PPSVQ+A M   
Sbjct  450  GGFDKLILESLYDQGDYRQRQQQQLYGSSAPNPFMSNDPFVMSNQVAPPPSVQMAAMSQQ  509

Query  322  xpfg-pfhpaxaaypPQNPLMVG---PHXPXGDTGXGAFP-ANNGDAAGAHQQNTNPFG  161
                     A    PP  P  VG      P  D+G G FP ANNG     HQQ  NPFG
Sbjct  510  HQQIPTMMQANPFGPPMQPQHVGMGPATNPFLDSGFGPFPMANNG-----HQQ-ANPFG  562



>ref|XP_006646232.1| PREDICTED: putative clathrin assembly protein At2g01600-like 
[Oryza brachyantha]
Length=574

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 100/195 (51%), Gaps = 43/195 (22%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET-----VQPKXFDRTGWELALVSTPGXXL-STPQERQL  503
            VSAIEESNALAL I+P+G  + T     VQ K FD TGWELALV+TP     S   +  L
Sbjct  393  VSAIEESNALALAIIPTGGDTSTSGTTTVQDKGFDPTGWELALVTTPSTNTNSLAMDSNL  452

Query  502  XGGLDSLTXNSLYDEGAXRASQQP---VYGAPAPNPFEVADPFAMSNAIAAPPSVQLApm  332
             GG D LT  SLYD+G  R   Q    +YG+ APNPF   DPFAMSN +A PPSVQ+A  
Sbjct  453  GGGFDKLTLESLYDDGVYRQHMQQQQQLYGSAAPNPFMATDPFAMSNQVAPPPSVQMA--  510

Query  331  pxpxpfgpfhpaxaaypPQNPLMVGPH-----------------XPXGDTGXGAFPANNG  203
                         A  P Q PLM+ P+                  P  D G G FPA+N 
Sbjct  511  -----------NMAQQPQQMPLMMQPNPFGPPLQPQHAGIAQAPNPFLDAGFGPFPASN-  558

Query  202  DAAGAHQQNTNPFGS  158
               G      NPFG+
Sbjct  559  ---GMQHPQANPFGT  570



>ref|XP_010496638.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=720

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D  AI + NALAL +V +     T    Q +  D +GWELALV+TP   +S   ER+L G
Sbjct  390  DPLAILDQNALALALVSTDDDFSTFGFGQARDLDSSGWELALVTTPSNDISAATERKLAG  449

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIA  362
            GLD+LT NSLYD GA  A+QQP YGAPAPNPFEV DPFA++N++A
Sbjct  450  GLDTLTLNSLYDNGAYIAAQQPAYGAPAPNPFEVQDPFALTNSVA  494



>ref|XP_010459007.1| PREDICTED: putative clathrin assembly protein At1g14910 [Camelina 
sativa]
Length=721

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D  AI + NALAL +V +     T    Q +  D +GWELALV+TP   +S   ER+L G
Sbjct  390  DPLAILDQNALALALVSTDDDFSTFGFGQARDLDSSGWELALVTTPSNDISAATERKLAG  449

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIA  362
            GLD+LT NSLYD GA  A+QQP YGAPAPNPFEV DPFA++N++A
Sbjct  450  GLDTLTLNSLYDNGAYIAAQQPAYGAPAPNPFEVQDPFALTNSVA  494



>emb|CDY45299.1| BnaA06g09690D [Brassica napus]
Length=688

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            I + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL GGLD+
Sbjct  387  ILDQNALALALVSTDVESSFFDLGQVRDSDPSGWELALVTTPSSDISATTERQLAGGLDT  446

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            LT NSLYD+   RA+QQP YGAPAPNPFEV DPF  SN+++AP
Sbjct  447  LTLNSLYDDVTYRAAQQPAYGAPAPNPFEVQDPFGFSNSVSAP  489



>ref|XP_009148877.1| PREDICTED: putative clathrin assembly protein At1g14910 [Brassica 
rapa]
Length=766

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            I + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL GGLD+
Sbjct  388  ILDQNALALALVSTDVESSFFDLGQVRDSDPSGWELALVTTPSSDISATTERQLAGGLDT  447

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            LT NSLYD+   RA+QQP YGAPAPNPFEV DPF  SN+++AP
Sbjct  448  LTLNSLYDDVTYRAAQQPAYGAPAPNPFEVQDPFGFSNSVSAP  490



>ref|XP_006306843.1| hypothetical protein CARUB_v10008396mg [Capsella rubella]
 gb|EOA39741.1| hypothetical protein CARUB_v10008396mg [Capsella rubella]
Length=742

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 4/105 (4%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            I + NALAL +V +   S T    Q +  D +GWELALV+TP   +S   ERQL GGLD+
Sbjct  394  ILDQNALALALVSTDDDSSTFGFGQVRDLDSSGWELALVTTPSNDISAATERQLAGGLDT  453

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPS  350
            LT NSLY++GA RA+QQP YG PAPNPFEV D FA SN+ A PPS
Sbjct  454  LTLNSLYEDGAYRAAQQPAYGTPAPNPFEVQDQFAFSNS-APPPS  497



>emb|CDY48813.1| BnaC02g34010D [Brassica napus]
Length=583

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIE  NALAL I+P+    AT        +D +GWELALV+T    +S   +RQL G
Sbjct  393  DASAIENQNALALAIIPTDDNPATPRFGHANDYDPSGWELALVTTASNDISAATDRQLGG  452

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEV-ADPFA-MSNAIAAP  356
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV  DPFA  SN I  P
Sbjct  453  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHHDPFASSSNGIQTP  501



>gb|EMT23238.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=536

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 105/220 (48%), Gaps = 60/220 (27%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            VSAIEESNALAL IV S A++ T      Q K FD TGWELALV+ P    S+  + QL 
Sbjct  328  VSAIEESNALALAIVTSDASTSTTGSTAWQDKGFDPTGWELALVTAPSNTNSSATDSQLV  387

Query  499  G-------------------------------GLDSLTXNSLYDEGAXRASQQP-VYGAP  416
            G                               GLD L  +SLYDEGA R SQQ  +YG+ 
Sbjct  388  GFSTFAILFFSEDIYPVDSFGLLVTVNRSKGGGLDKLILDSLYDEGAYRQSQQQQLYGSS  447

Query  415  APNPFEVADPFAMSNAIAAPPSVQLApmpxpxpfgpfhpaxaaypPQNPLM--VGPHXPX  242
            APNPF  +DPFAMSN +AAP SVQ+A                    QNP    + P  P 
Sbjct  448  APNPFMTSDPFAMSNHVAAPSSVQMA------AMSQQQQQIPTMIHQNPFGPPIQPQHPG  501

Query  241  G---------DTGXGAFPANNGDAAGAHQQNTNPF-GSLL  152
                      D+G GAFPA N       QQ  NPF GSLL
Sbjct  502  AGPAAVNPFLDSGFGAFPAANNS-----QQQANPFGGSLL  536



>ref|XP_009129221.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brassica 
rapa]
Length=577

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIE  NA AL I+P+    AT        +D +GWELALV+TP   +S   +RQL G
Sbjct  392  DASAIENQNARALAIIPTDDNPATPRFGHANDYDPSGWELALVTTPSNDISAATDRQLGG  451

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEV-ADPFA-MSNAIAAP  356
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV  DPFA  SN I  P
Sbjct  452  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHHDPFASSSNGIQTP  500



>emb|CDY09433.1| BnaA02g25770D [Brassica napus]
Length=577

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D SAIE  NA AL I+P+    AT        +D +GWELALV+TP   +S   +RQL G
Sbjct  392  DASAIENQNARALAIIPTDDNPATPRFGHANDYDPSGWELALVTTPSNDISAATDRQLGG  451

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEV-ADPFAM-SNAIAAP  356
            GLD+LT NSLYD+GA  ASQ+PVYGAPAPNPFEV  DPFA  SN I  P
Sbjct  452  GLDTLTLNSLYDDGAYIASQRPVYGAPAPNPFEVHHDPFAASSNGIQTP  500



>gb|EAY98914.1| hypothetical protein OsI_20869 [Oryza sativa Indica Group]
Length=567

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 101/179 (56%), Gaps = 17/179 (9%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA-----TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            VSAIEESNALAL IVP+ A     ++ T Q K FD TGWELALV+TP    S+  + QL 
Sbjct  390  VSAIEESNALALAIVPADAGASTSSTATWQDKGFDPTGWELALVTTPSNTNSSAADSQLG  449

Query  499  GGLDSLTXNSLYDEG-AXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
            GG D L   SLYD+G   +  QQ +YG+ APNPF   DPF MSN +A P SVQ+A M   
Sbjct  450  GGFDKLILESLYDQGDYRQRQQQQLYGSSAPNPFMSNDPFVMSNQVAPPSSVQMAAMSQQ  509

Query  322  xpfg-pfhpaxaaypPQNPLMVG---PHXPXGDTGXGAFP-ANNGDAAGAHQQNTNPFG  161
                     A    PP  P  VG      P  D+G G FP ANNG     HQQ  NPFG
Sbjct  510  HQQIPTMMQANPFGPPMQPQHVGMGPATNPFLDSGFGPFPMANNG-----HQQ-ANPFG  562



>emb|CAA71818.1| hypothetical protein (cDNA194) [Arabidopsis thaliana]
 emb|CAA71880.1| hypothetical protein 194, partial [Arabidopsis thaliana]
Length=413

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D  AI + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL G
Sbjct  111  DPLAILDQNALALALVSNDVDSSPFSFGQARDLDPSGWELALVTTPSNDISAATERQLAG  170

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT NSLYD+GA RA+QQP YG PA NPFEV D FA S++++ P +V 
Sbjct  171  GLDTLTLNSLYDDGALRAAQQPAYGVPASNPFEVQDLFAFSDSVSPPSAVN  221



>emb|CAA71879.1| hypothetical protein 194 [Arabidopsis thaliana]
Length=584

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D  AI + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL G
Sbjct  282  DPLAILDQNALALALVSNDVDSSPFSFGQARDLDPSGWELALVTTPSNDISAATERQLAG  341

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
            GLD+LT NSLYD+GA RA+QQP YG PA NPFEV D FA S++++ P +V
Sbjct  342  GLDTLTLNSLYDDGALRAAQQPAYGVPASNPFEVQDLFAFSDSVSPPSAV  391



>ref|XP_003567959.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brachypodium 
distachyon]
Length=567

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 101/191 (53%), Gaps = 41/191 (21%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETV-----QPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            VSAIEESNALAL IV S A++ T      Q K FD TGWELALV+ P    S+  + QL 
Sbjct  390  VSAIEESNALALAIVTSDASTSTTSTTAWQDKGFDPTGWELALVTAPSNTNSSVADSQLG  449

Query  499  GGLDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
            GGLD L  +SLYDEGA  +  QQ +YG+ APNPF   DPFAMSN +A PP VQ+A     
Sbjct  450  GGLDKLILDSLYDEGAYRQRQQQQLYGSSAPNPFMTNDPFAMSNQVAPPPLVQMA-----  504

Query  322  xpfgpfhpaxaaypPQNPLMVGPH-----------------XPXGDTGXGAFPANNGDAA  194
                    A +   PQ P M+ P+                  P  DTG G FP  N    
Sbjct  505  --------AMSQQHPQIPTMMQPNPFGPPVQTQHAGPGPVTNPFLDTGFGPFPVANNS--  554

Query  193  GAHQQNTNPFG  161
               QQ  NPFG
Sbjct  555  ---QQQANPFG  562



>ref|NP_172944.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|P94017.2|CAP9_ARATH RecName: Full=Putative clathrin assembly protein At1g14910 [Arabidopsis 
thaliana]
 gb|AAM20134.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29241.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=692

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = -1

Query  658  AIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            AI + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL GGLD
Sbjct  393  AILDQNALALALVSNDVDSSPFSFGQARDLDPSGWELALVTTPSNDISAATERQLAGGLD  452

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
            +LT NSLYD+GA RA+QQP YG PA NPFEV D FA S++++ P +V
Sbjct  453  TLTLNSLYDDGALRAAQQPAYGVPASNPFEVQDLFAFSDSVSPPSAV  499



>ref|XP_010513887.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=573

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 71/111 (64%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL I+ +    +T    Q   +D TGWELALV+ P   +S   ER+L G
Sbjct  388  DASVIEDQNALALAIISTDVNPSTPRFGQANDYDPTGWELALVTAPSRDISAATERKLAG  447

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT +SLYD+GA  ASQ+P YGAPAPNPF   DPFA  N    PP  Q
Sbjct  448  GLDTLTLSSLYDDGAYIASQRPAYGAPAPNPFASHDPFASFNGTTPPPQQQ  498



>ref|XP_010424932.1| PREDICTED: putative clathrin assembly protein At2g01600 [Camelina 
sativa]
Length=576

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 71/111 (64%), Gaps = 3/111 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL I+ +    +T    Q   +D TGWELALV+ P   +S   ER+L G
Sbjct  391  DASVIEDQNALALAIISTDVNPSTPRFGQANDYDPTGWELALVTAPSRDISAATERKLAG  450

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            GLD+LT +SLYD+GA  ASQ+P YGAPAPNPF   DPFA  N    PP  Q
Sbjct  451  GLDTLTLSSLYDDGAYIASQRPAYGAPAPNPFASHDPFASFNGTTPPPQQQ  501



>ref|XP_006292297.1| hypothetical protein CARUB_v10018506mg [Capsella rubella]
 gb|EOA25195.1| hypothetical protein CARUB_v10018506mg [Capsella rubella]
Length=572

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 3/107 (3%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            D S IE+ NALAL I+ +    +T    +   +D TGWELALV+ P   +S   ER+L G
Sbjct  388  DASVIEDQNALALAIITTDDNPSTPRFGKANDYDPTGWELALVTAPSSDISAATERKLAG  447

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAP  356
            GLD+LT +SLYD+GA  ASQ+PVYGAPAPNPF   DPFA SN    P
Sbjct  448  GLDTLTLSSLYDDGAYIASQRPVYGAPAPNPFASHDPFASSNGTTPP  494



>emb|CDM83847.1| unnamed protein product [Triticum aestivum]
Length=558

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 94/180 (52%), Gaps = 24/180 (13%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA----TSETVQPKXFDRTGWELALVSTPGXXL-STPQERQLX  500
            VSAIEESNALAL I P+G     TS  +Q   FD TGWELALV+T      S   +  L 
Sbjct  388  VSAIEESNALALAITPTGVNTSTTSTAMQDIGFDPTGWELALVTTSSSNTNSLAVDSTLG  447

Query  499  GGLDSLTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpxp  323
            GG D LT +SLYD+G  R  QQ + YGA   NPF  +DPFA+SN +A+PPSVQ       
Sbjct  448  GGFDKLTLDSLYDDGTYRQMQQQLPYGAVPHNPFMASDPFAVSNQVASPPSVQ-------  500

Query  322  xpfgpfhpaxaaypPQNPLMVGPH-----XPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                            NP     H      P  D G G FPA NG+  G H Q  NPFG+
Sbjct  501  ---MAAMAQQPQQMQPNPFGPPSHPQPVPNPFLDAGFGPFPAANGN--GMHAQ-ANPFGT  554



>tpg|DAA51587.1| TPA: hypothetical protein ZEAMMB73_095588 [Zea mays]
Length=533

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 71/113 (63%), Gaps = 5/113 (4%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSET----VQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
             AIEESNALAL IVP+   S T     Q K FD TGWELALV+ P    S+    QL GG
Sbjct  58   KAIEESNALALAIVPTDGASTTGNTAFQDKGFDPTGWELALVTAPSNTTSSASVGQLGGG  117

Query  493  LDSLTXNSLYDEGAX-RASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +S YD+GA  +  QQ VYG+  PNPF   DPF MSN +A PPSVQ+A
Sbjct  118  FDKLILDSFYDDGAYRQRQQQQVYGSAMPNPFMTNDPFVMSNHVAPPPSVQMA  170



>dbj|BAK06048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 100/176 (57%), Gaps = 10/176 (6%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA-----TSETVQPKXFDRTGWELALVSTPGXXL-STPQERQL  503
            VS IEESNALAL I P+G      ++ T+Q   FD TGWELALV+T      S   +  L
Sbjct  388  VSMIEESNALALAITPTGVNTSTTSTATMQDIGFDPTGWELALVTTSSSDTNSLAVDSNL  447

Query  502  XGGLDSLTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPSVQLApmpx  326
             GG D LT +SLYD+G  R  QQ + YG+   NPF  +DPFA+SN IA+PPSVQ+A M  
Sbjct  448  GGGFDKLTLDSLYDDGTYRQMQQQLPYGSVPHNPFMASDPFAVSNQIASPPSVQMAAMAQ  507

Query  325  pxpfgpfhpaxaaypPQNPLMVGPHXPXGDTGXGAFPANNGDAAGAHQQNTNPFGS  158
                   +P      PQ+   +    P  D G G FPA NG+  G H Q  NPFG+
Sbjct  508  QPQQMQPNPFGPPSHPQHAGTMPVPNPFLDAGFGPFPAANGN--GMHAQ-ANPFGT  560



>ref|XP_006838117.1| hypothetical protein AMTR_s00106p00058730 [Amborella trichopoda]
 gb|ERN00686.1| hypothetical protein AMTR_s00106p00058730 [Amborella trichopoda]
Length=563

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGAT-----SETVQPKXFDRTGWELALVSTPGXXLSTPQERQL  503
            D SAIEE NALAL IVPS  +     S   Q K  D TGWELALV+T         E +L
Sbjct  384  DASAIEEQNALALAIVPSAGSDAVSDSHGAQTKGLDPTGWELALVTTASSNDKNLTESKL  443

Query  502  XGGLDSLTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPSV  347
             GG D LT  SLY++   R  QQ   YGAP PNPFE  DPFA++N I  PPSV
Sbjct  444  AGGFDKLTLESLYEDAVYRQQQQQFTYGAPPPNPFESHDPFAIANNIPPPPSV  496



>ref|XP_006416959.1| hypothetical protein EUTSA_v10007171mg [Eutrema salsugineum]
 gb|ESQ35312.1| hypothetical protein EUTSA_v10007171mg [Eutrema salsugineum]
Length=586

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 70/107 (65%), Gaps = 6/107 (6%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            I + NALAL +V +   S      Q +  D +GWELALV+TP   ++   ERQL GGLD+
Sbjct  394  ILDQNALALALVSTDVESSMFGFGQARALDPSGWELALVTTPSNDITAATERQLAGGLDT  453

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            LT NSLY++GA RA+Q   YG PAPNPFE  DPFA S+ +  PPS +
Sbjct  454  LTLNSLYEDGAFRAAQP--YGDPAPNPFEAQDPFAFSDNV-VPPSAE  497



>ref|XP_008811452.1| PREDICTED: putative clathrin assembly protein At5g57200 [Phoenix 
dactylifera]
Length=559

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE-----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +EESNALAL I+P G  S+      +     D +GWELALV+TP        + +L GG 
Sbjct  389  LEESNALALAIIPQGDDSKPSNTGGLVGSGIDSSGWELALVTTPSSNSDQLTDNKLAGGF  448

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  NSLYD+ A R      Y   A NPF+  DPFAMSN  AAPP+VQ+A
Sbjct  449  DKLLLNSLYDDAARRQQSTGAYSGFATNPFDSQDPFAMSNNFAAPPNVQMA  499



>ref|XP_010929366.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X5 [Elaeis guineensis]
Length=459

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE-----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +EESNALAL I+P G  S+      +     D +GWELALV+TP    +   E +L GG 
Sbjct  291  LEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTPSSNSNQLTENKLAGGF  350

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLYD+ A        Y   APNPF+  DPFAMS+  AAPP+VQ+A
Sbjct  351  DKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAAPPNVQMA  401



>gb|AAF79231.1|AC006917_16 F10B6.32 [Arabidopsis thaliana]
Length=813

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = -1

Query  658  AIEESNALALXIVPSGATSETV---QPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            AI + NALAL +V +   S      Q +  D +GWELALV+TP   +S   ERQL     
Sbjct  516  AILDQNALALALVSNDVDSSPFSFGQARDLDPSGWELALVTTPSNDISAATERQLVRY--  573

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
            +LT NSLYD+GA RA+QQP YG PA NPFEV D FA S++++ P +V
Sbjct  574  TLTLNSLYDDGALRAAQQPAYGVPASNPFEVQDLFAFSDSVSPPSAV  620



>ref|XP_010929365.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X4 [Elaeis guineensis]
Length=486

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE-----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +EESNALAL I+P G  S+      +     D +GWELALV+TP    +   E +L GG 
Sbjct  318  LEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTPSSNSNQLTENKLAGGF  377

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLYD+ A        Y   APNPF+  DPFAMS+  AAPP+VQ+A
Sbjct  378  DKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAAPPNVQMA  428



>ref|XP_010929364.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X3 [Elaeis guineensis]
Length=530

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE-----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +EESNALAL I+P G  S+      +     D +GWELALV+TP    +   E +L GG 
Sbjct  362  LEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTPSSNSNQLTENKLAGGF  421

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLYD+ A        Y   APNPF+  DPFAMS+  AAPP+VQ+A
Sbjct  422  DKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAAPPNVQMA  472



>ref|XP_010929363.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Elaeis guineensis]
Length=535

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE-----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +EESNALAL I+P G  S+      +     D +GWELALV+TP    +   E +L GG 
Sbjct  367  LEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTPSSNSNQLTENKLAGGF  426

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLYD+ A        Y   APNPF+  DPFAMS+  AAPP+VQ+A
Sbjct  427  DKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAAPPNVQMA  477



>ref|XP_010929362.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Elaeis guineensis]
Length=557

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 66/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE-----TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +EESNALAL I+P G  S+      +     D +GWELALV+TP    +   E +L GG 
Sbjct  389  LEESNALALAIIPQGDDSKPSNTGGLVGVGIDSSGWELALVTTPSSNSNQLTENKLAGGF  448

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLYD+ A        Y   APNPF+  DPFAMS+  AAPP+VQ+A
Sbjct  449  DKLLLDSLYDDAARWQQNTGAYNGFAPNPFDSQDPFAMSHNFAAPPNVQMA  499



>ref|XP_009390454.1| PREDICTED: putative clathrin assembly protein At4g25940 [Musa 
acuminata subsp. malaccensis]
Length=550

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 4/110 (4%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXF---DRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            ++E NALAL I P G +  T     F   D +GWELALV+T     + P E +L GG D 
Sbjct  390  LDEINALALAIPPGGDSISTATGDLFSPGDSSGWELALVTTSSNNNNQPTESKLAGGFDQ  449

Query  484  LTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            L  +SLYD+ A R     V +G  A NP+E  DPFAMSN IA PP+VQ+A
Sbjct  450  LLLDSLYDDAARRLQNTAVCHGGVAANPYESMDPFAMSNYIAPPPNVQMA  499



>ref|XP_004965651.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=575

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPK---XFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            +S +EE NALAL IV  G  ++T   +     D++GWELALV+ P    +   + QL GG
Sbjct  388  ISDLEERNALALAIVAPGNENKTSTSRDLFALDKSGWELALVTAPSNHTNQQMDNQLAGG  447

Query  493  LDSLTXNSLYDEGAXRASQQPVY--GAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R     V   G  A NPFE  DPFAMSN+ A P +VQLA
Sbjct  448  FDKLLLDSLYEDEARRQQIASVTYNGTIAANPFEFNDPFAMSNSFAPPSNVQLA  501



>gb|EYU30089.1| hypothetical protein MIMGU_mgv1a0050551mg, partial [Erythranthe 
guttata]
Length=175

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 70/130 (54%), Gaps = 15/130 (12%)
 Frame = -1

Query  586  KXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSLTXNSLYDEGAXR-ASQQPVYGAPAP  410
            K F+ +GWELAL STP   LST QERQL GGLDSL  +SLYD+GA R AS+Q     PAP
Sbjct  12   KKFEPSGWELALASTPSTNLSTVQERQLGGGLDSLILDSLYDDGAYRGASKQ-----PAP  66

Query  409  NPFEVADPF-AMSN----AIAAPPSVQLApmpxpxpfgpfhpaxaaypPQNPLMVGPHXP  245
            NPFEV DPF A+ N    A+  PP+ Q                      Q    V P  P
Sbjct  67   NPFEVNDPFAAVPNPPLAAVPNPPTGQ----TNNPFGPFEPVYPQPEQLQQQSFVSPQNP  122

Query  244  XGDTGXGAFP  215
             GDTG   FP
Sbjct  123  FGDTGFETFP  132



>ref|NP_001174939.1| Os06g0661400 [Oryza sativa Japonica Group]
 dbj|BAH93667.1| Os06g0661400 [Oryza sativa Japonica Group]
Length=342

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPK---XFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ IEESNALAL IV  G  ++    +     D++GWELALV+ P    S P + QL GG
Sbjct  153  IANIEESNALALAIVAPGNENKASASQDLFALDKSGWELALVTAPSTHTSRPVDNQLAGG  212

Query  493  LDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R   +     G+ A NPF+  DPFAMSN  A P +VQLA
Sbjct  213  FDKLLLDSLYEDEARRQQIASATYNGSVAGNPFDPNDPFAMSNNFAPPSNVQLA  266



>gb|EMT16298.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=657

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGA-----TSETVQPKXFDRTGWELALVSTPGXXL-STPQERQL  503
            VSAIEESNALAL I P+G      ++ T+Q   FD TGWELALV+T      S   +  L
Sbjct  440  VSAIEESNALALAIAPTGVNTSTTSTATMQDIGFDPTGWELALVTTSSSNTNSLAVDSNL  499

Query  502  XGGLDSLTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSN  371
             GG D LT +SLYD+G  R  QQ + YG+   NPF  +DPFA+SN
Sbjct  500  GGGFDKLTLDSLYDDGTYRQMQQQLPYGSVPHNPFMASDPFAVSN  544



>ref|XP_003569612.1| PREDICTED: putative clathrin assembly protein At2g01600 [Brachypodium 
distachyon]
Length=567

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 71/115 (62%), Gaps = 9/115 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSET-----VQPKXFDRTGWELALVSTPGXXLS-TPQERQL  503
            VSAIE +NALAL I+P+GA + T     +Q   FD +GWELALV+      +  P +  L
Sbjct  388  VSAIEANNALALAIIPTGANTSTSTTTTIQDIGFDPSGWELALVTASSSNTNPLPVDSNL  447

Query  502  XGGLDSLTXNSLYDEGAXRASQQ--PVYGAPAP-NPFEVADPFAMSNAIAAPPSV  347
             GG D L  +SLYDEG  R +QQ  P   APA  NPF  +DPF +SN +A PPSV
Sbjct  448  GGGFDKLILDSLYDEGTYRQNQQQQPYGSAPAHHNPFMASDPFTVSNQVAPPPSV  502



>gb|EAZ37894.1| hypothetical protein OsJ_22244 [Oryza sativa Japonica Group]
Length=531

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPK---XFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ IEESNALAL IV  G  ++    +     D++GWELALV+ P    S P + QL GG
Sbjct  342  IANIEESNALALAIVAPGNENKASASQDLFALDKSGWELALVTAPSTHTSRPVDNQLAGG  401

Query  493  LDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R   +     G+ A NPF+  DPFAMSN  A P +VQLA
Sbjct  402  FDKLLLDSLYEDEARRQQIASATYNGSVAGNPFDPNDPFAMSNNFAPPSNVQLA  455



>dbj|BAD46420.1| phosphoprotein-like [Oryza sativa Japonica Group]
Length=577

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPK---XFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ IEESNALAL IV  G  ++    +     D++GWELALV+ P    S P + QL GG
Sbjct  388  IANIEESNALALAIVAPGNENKASASQDLFALDKSGWELALVTAPSTHTSRPVDNQLAGG  447

Query  493  LDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R   +     G+ A NPF+  DPFAMSN  A P +VQLA
Sbjct  448  FDKLLLDSLYEDEARRQQIASATYNGSVAGNPFDPNDPFAMSNNFAPPSNVQLA  501



>ref|XP_006656326.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Oryza brachyantha]
Length=575

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIV-PSGATSETVQPKXF--DRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ IEESNALAL IV P      +     F  D++GWELALV+ P    S P + QL GG
Sbjct  388  IADIEESNALALAIVAPGNENKASTSHDLFALDKSGWELALVTAPSTHTSQPVDNQLAGG  447

Query  493  LDSLTXNSLYDEGAXR--ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R   +     G+ A NPF+  DPFAMSN  A P +VQLA
Sbjct  448  FDKLLLDSLYEDEARRQQIASATYTGSLAGNPFDPNDPFAMSNNFAPPSNVQLA  501



>ref|XP_009408060.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa 
acuminata subsp. malaccensis]
Length=570

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 62/108 (57%), Gaps = 5/108 (5%)
 Frame = -1

Query  655  IEESNALALXIV-PSGATSETVQPKXF--DRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            +EESNALAL I+ P   T  +     F  D +GWELALV+TP    S   E QL GG D 
Sbjct  386  LEESNALALAIISPGNDTKASTAHDLFGTDSSGWELALVTTPSSNTSHLVESQLAGGFDR  445

Query  484  LTXNSLYDEGAXRASQQPVY--GAPAPNPFEVADPFAMSNAIAAPPSV  347
            L   SLY++ + R      Y  G    NPF+  DPFAMSN+IA PPSV
Sbjct  446  LLLESLYEDSSRRQQIAAAYSGGGMDANPFDFGDPFAMSNSIAPPPSV  493



>ref|XP_002437410.1| hypothetical protein SORBIDRAFT_10g026380 [Sorghum bicolor]
 gb|EER88777.1| hypothetical protein SORBIDRAFT_10g026380 [Sorghum bicolor]
Length=279

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPK---XFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ +EESNALAL IV  G  ++    +     D+ GWELALV+ P    +   + QL GG
Sbjct  88   IADLEESNALALAIVAPGNENKMSNSRDLFALDKAGWELALVTAPSNHTNQQVDNQLAGG  147

Query  493  LDSLTXNSLYDEGAXRASQQPV--YGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R     V   G+ A NPF  +DPFA SN+ A P +VQLA
Sbjct  148  FDKLLLDSLYEDEARRQQIASVTYTGSLAANPFATSDPFATSNSFAPPSNVQLA  201



>ref|XP_010913847.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Elaeis guineensis]
Length=561

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXF-----DRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +E+SNALAL I+  G  S+    +       D +GWELALV+TP    S   E +L GG 
Sbjct  391  LEQSNALALAIIQPGDDSKPTATRDLLGGGTDSSGWELALVTTPSSNTSYVVESKLAGGF  450

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLY++ + R  QQ   GA A NPF+  DPFAMSN+IA PP+VQ+A
Sbjct  451  DKLLLDSLYEDSSRR--QQ--IGA-AANPFDSRDPFAMSNSIAPPPNVQMA  496



>ref|NP_001151036.1| clathrin assembly protein [Zea mays]
 gb|ACG41378.1| clathrin assembly protein [Zea mays]
Length=575

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPK---XFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ +E SNALAL IV  G  ++    +     D+TGWELALV+ P    +   + QL GG
Sbjct  389  IADLEASNALALAIVAPGNENKMATSQDLFALDKTGWELALVTAPSNHTNQQVDNQLAGG  448

Query  493  LDSLTXNSLYDEGAXRASQQPV--YGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R     V   G+ A NPF+  DPFAMSN+ A P +VQLA
Sbjct  449  FDKLLLDSLYEDEARRQQIASVTYTGSTAANPFDHNDPFAMSNSFAPPSNVQLA  502



>ref|XP_002324695.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEF03260.1| clathrin assembly family protein [Populus trichocarpa]
Length=580

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 69/117 (59%), Gaps = 17/117 (15%)
 Frame = -1

Query  655  IEESNALALXIVP--------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            +EESNALAL IVP        S A SE  +P   + TGWELALV+TP    S P + ++ 
Sbjct  389  LEESNALALAIVPPGADPLSSSNALSELGKP---NATGWELALVTTPSNPTSQPAQNKMG  445

Query  499  GGLDSLTXNSLYDEGAXRASQQPV-----YGAPA-PNPFEVADPFAMSNAIAAPPSV  347
            GG D L  +SLY++ A R   Q       YGA A  NPFE  DPFAMSN+IA P +V
Sbjct  446  GGFDRLLLDSLYEDDAARRQIQLQNAGYGYGATAMNNPFEQPDPFAMSNSIAPPTNV  502



>ref|XP_011017657.1| PREDICTED: putative clathrin assembly protein At5g57200 [Populus 
euphratica]
Length=580

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 69/117 (59%), Gaps = 17/117 (15%)
 Frame = -1

Query  655  IEESNALALXIVP--------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            +EESNALAL IVP        S A SE  +P   + TGWELALV+TP    S P + ++ 
Sbjct  389  LEESNALALAIVPPGADPLSSSKALSELGKP---NATGWELALVTTPSNPTSQPAQNKMG  445

Query  499  GGLDSLTXNSLYDEGAXRASQQPV-----YGAPA-PNPFEVADPFAMSNAIAAPPSV  347
            GG D L  +SLY++ A R   Q       YGA A  NPFE  DPFAMSN+IA P +V
Sbjct  446  GGFDRLLLDSLYEDDAARRQIQLQNAGYGYGATAMNNPFEQPDPFAMSNSIAPPTNV  502



>ref|XP_008781765.1| PREDICTED: putative clathrin assembly protein At5g57200 [Phoenix 
dactylifera]
Length=565

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXF-----DRTGWELALVSTPGXXLSTPQERQLXGGL  491
            +E+SNALAL I+  G  S+    +       D +GWELALV+TP    S   E +L GG 
Sbjct  392  LEQSNALALAIIEPGDGSKPTATRDLLGGGTDSSGWELALVTTPSSNTSYVVESKLAGGF  451

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D L  +SLY++    AS++   GA A NPF   DPFAMSN+IA PP+VQ+A
Sbjct  452  DKLLLDSLYED----ASRRQQIGADA-NPFNSRDPFAMSNSIAPPPNVQMA  497



>ref|XP_006850889.1| hypothetical protein AMTR_s00025p00161520 [Amborella trichopoda]
 gb|ERN12470.1| hypothetical protein AMTR_s00025p00161520 [Amborella trichopoda]
Length=546

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 64/106 (60%), Gaps = 3/106 (3%)
 Frame = -1

Query  658  AIEESNALALXIVPSGAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            AIEESNALAL IVPS  T  SE       D +GWELALV+T     S   E +L GG D 
Sbjct  388  AIEESNALALAIVPSDGTKPSEGFLGNSTDPSGWELALVATASSNTSHVTESKLAGGFDK  447

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
            L  +SLYD+   R  QQ   G  A NPFE  DPFAMS+ +A PP+V
Sbjct  448  LLLDSLYDDAQTRRQQQQQSGY-ANNPFESQDPFAMSHNVAPPPNV  492



>gb|ACN36497.1| unknown [Zea mays]
Length=332

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPKX-----FDRTGWELALVSTPGXXLSTPQERQLX  500
            ++ +E SNALAL IV  G  +E   P        D+ GWELALV+ P    +   + QL 
Sbjct  146  IADLETSNALALAIVAPG--NENKMPTSQDLFALDKAGWELALVTAPSNHTNQQVDNQLA  203

Query  499  GGLDSLTXNSLYDEGAXRASQQPV--YGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            GG D L  +SLY++ A R     V   G+ A NPF+  DPFAMSN+ A P +VQLA
Sbjct  204  GGFDKLLLDSLYEDEARRQQIASVTYTGSTAANPFDHNDPFAMSNSFAPPSNVQLA  259



>ref|XP_008391574.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At5g57200 [Malus domestica]
Length=579

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 69/118 (58%), Gaps = 15/118 (13%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSET-VQPKXFDRT-GWELALVSTPGXXLS-TPQERQLXGGLDS  485
            IEE NALAL IVP G   ++      F  T GWELALV+TP    S  PQ+R+L GG D+
Sbjct  392  IEECNALALAIVPQGNXQKSGASFNDFAGTSGWELALVTTPSNHTSQAPQDRKLAGGFDN  451

Query  484  LTXNSLY-DEGAXRASQQPV----YGAPA-PNPFE------VADPFAMSNAIAAPPSV  347
            L  NSLY DEGA R  Q       YG  +  NPFE      V DPFAMSN+IA P +V
Sbjct  452  LLLNSLYEDEGARRQLQLQNAGYGYGTTSLQNPFEQAAQQPVQDPFAMSNSIAPPTNV  509



>ref|XP_007222299.1| hypothetical protein PRUPE_ppa003361mg [Prunus persica]
 gb|EMJ23498.1| hypothetical protein PRUPE_ppa003361mg [Prunus persica]
Length=581

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 71/123 (58%), Gaps = 19/123 (15%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFD----RTGWELALVSTPGXXLS-TPQERQLXGGL  491
            IEESNALAL IVP G  +E      F+     +GWELALV+TP    S  P +++  GG 
Sbjct  391  IEESNALALAIVPQG--NEQQSGASFNDLAGTSGWELALVTTPSNHTSQVPMDKKFAGGF  448

Query  490  DSLTXNSLY-DEGAXRASQQPV----YGAPA-PNPFE------VADPFAMSNAIAAPPSV  347
            D L  +SLY DEGA R  Q       YGA +  NPFE      V DPFAMSN IA P +V
Sbjct  449  DKLLLDSLYEDEGARRQIQLQNAGYGYGATSLHNPFEQQAQHPVQDPFAMSNNIAPPTNV  508

Query  346  QLA  338
            Q+A
Sbjct  509  QMA  511



>ref|XP_008223882.1| PREDICTED: putative clathrin assembly protein At5g57200 [Prunus 
mume]
Length=581

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 71/123 (58%), Gaps = 19/123 (15%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFD----RTGWELALVSTPGXXLS-TPQERQLXGGL  491
            IEESNALAL IVP G  +E      F+     +GWELALV+TP    S  P +++  GG 
Sbjct  391  IEESNALALAIVPQG--NEQQSGASFNDLAGTSGWELALVTTPSNHTSQVPMDKKFAGGF  448

Query  490  DSLTXNSLY-DEGAXRASQQPV----YGAPA-PNPFE------VADPFAMSNAIAAPPSV  347
            D L  +SLY DEGA R  Q       YGA +  NPFE      V DPFAMSN IA P +V
Sbjct  449  DKLLLDSLYEDEGARRQIQLQNAGYGYGATSLHNPFEQQAQHPVQDPFAMSNNIAPPTNV  508

Query  346  QLA  338
            Q+A
Sbjct  509  QMA  511



>emb|CDP10454.1| unnamed protein product [Coffea canephora]
Length=546

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 67/122 (55%), Gaps = 18/122 (15%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NA+AL IVP G   +       +  TGWELALV+ P    S     +L GGLD 
Sbjct  373  SELDEKNAMALAIVPVGVAEQPASTGLTNGTTGWELALVTAPSSNESATTASKLAGGLDK  432

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVA-------------DPFAMSNAIAAPPSVQ  344
            LT +SLYD+   R++QQ V    + NP+E A             DPF  SN +AAPPSVQ
Sbjct  433  LTLDSLYDDAIRRSNQQTV----SYNPWETAAPMGGPMMLPRAHDPFYASNTVAAPPSVQ  488

Query  343  LA  338
            +A
Sbjct  489  MA  490



>emb|CDP20659.1| unnamed protein product [Coffea canephora]
Length=570

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 67/118 (57%), Gaps = 12/118 (10%)
 Frame = -1

Query  655  IEESNALALXIVPSG---ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            +EESNALAL I+  G   ++S     +    +GWELALV+ P    S P ER++ GG DS
Sbjct  387  LEESNALALAIIQPGNDPSSSNYALTEIGQTSGWELALVAAPSNHTSKPPERKMAGGFDS  446

Query  484  LTXNSLYDEGAXRASQQPV---------YGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            L  +SLY++ A R   Q           Y   A +P +  DPFAMSNAIA P +VQ+A
Sbjct  447  LLLDSLYEDEAARRQLQLQNAGYNAGYGYQMTAQSPLDQHDPFAMSNAIAPPTNVQMA  504



>ref|XP_010057620.1| PREDICTED: putative clathrin assembly protein At5g35200 [Eucalyptus 
grandis]
 gb|KCW74805.1| hypothetical protein EUGRSUZ_E03535 [Eucalyptus grandis]
Length=556

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 65/121 (54%), Gaps = 16/121 (13%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKX--FDR----TGWELALVSTPGXXLSTPQERQLX  500
            S ++E NALAL IVP GA     QP    F+     TGWELALV+ P    +     +L 
Sbjct  379  SELDEKNALALAIVPVGAAD---QPSSTGFNHANGTTGWELALVTAPSSNETASAASKLA  435

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQL  341
            GGLD LT +SLYDEG  R+SQ   Y    P P           DPF  SNA+AAP  VQ+
Sbjct  436  GGLDKLTLDSLYDEGMRRSSQSSSYNPWEPAPMAGSMMQQPAHDPFFGSNAVAAPLQVQM  495

Query  340  A  338
            A
Sbjct  496  A  496



>ref|XP_002453380.1| hypothetical protein SORBIDRAFT_04g005060 [Sorghum bicolor]
 gb|EES06356.1| hypothetical protein SORBIDRAFT_04g005060 [Sorghum bicolor]
Length=570

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 66/116 (57%), Gaps = 7/116 (6%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPKXFD--RTGWELALVSTPGXXLSTPQERQLXGGL  491
            V+ +EESNALAL I+  G    +V    FD   +GWELALV+ P    S   +  L GG 
Sbjct  378  VAELEESNALALAIIAPGDCKASVSQSMFDVNSSGWELALVTAPSTHTSQAVQTNLAGGF  437

Query  490  DSLTXNSLYDEGAXR---ASQQPVYGAPAPNPFEV--ADPFAMSNAIAAPPSVQLA  338
            D L  +SLY++GA R   AS        A NPF V   DPFAMS++ A P +VQLA
Sbjct  438  DKLLLDSLYEDGARRQQIASVTYTGSLGAANPFSVNGNDPFAMSSSFAPPANVQLA  493



>ref|XP_010273537.1| PREDICTED: putative clathrin assembly protein At5g57200 [Nelumbo 
nucifera]
Length=581

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 65/115 (57%), Gaps = 12/115 (10%)
 Frame = -1

Query  655  IEESNALALXIV-PSGATSETVQPKXF------DRTGWELALVSTPGXXLSTPQERQLXG  497
            +EESNALAL I+ PSG    +   +        + TGWELALV+TP    S   E +L G
Sbjct  395  LEESNALALAIIDPSGLDPLSSTSRELAALGAPNATGWELALVTTPSNNTSHLTESKLAG  454

Query  496  GLDSLTXNSLY-DEGAXRASQQPV----YGAPAPNPFEVADPFAMSNAIAAPPSV  347
            G D L  +SLY D  A R  QQ V     G  APNPF+  DPF+MSN IA P SV
Sbjct  455  GFDRLLLDSLYEDAAARRQHQQQVAGYGVGMAAPNPFDPQDPFSMSNNIAPPTSV  509



>gb|AFW76126.1| clathrin assembly protein [Zea mays]
Length=575

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 66/116 (57%), Gaps = 9/116 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPKX-----FDRTGWELALVSTPGXXLSTPQERQLX  500
            ++ +E SNALAL IV  G  +E   P        D+ GWELALV+ P    +   + QL 
Sbjct  389  IADLETSNALALAIVAPG--NENKMPTSQDLFALDKAGWELALVTAPSNHTNQQVDNQLA  446

Query  499  GGLDSLTXNSLYDEGAXRASQQPV--YGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            GG D L  +SLY++ A R     V   G+ A NPF+  DPFAMSN+ A P +VQLA
Sbjct  447  GGFDKLLLDSLYEDEARRQQIASVTYTGSTAANPFDHNDPFAMSNSFAPPSNVQLA  502



>ref|XP_009359933.1| PREDICTED: putative clathrin assembly protein At5g57200 [Pyrus 
x bretschneideri]
Length=581

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 73/123 (59%), Gaps = 19/123 (15%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFD----RTGWELALVSTPGXXLS-TPQERQLXGGL  491
            IEESNALAL IVP G  +E      F+     +GWELALV+TP    S  P +R+L GG 
Sbjct  391  IEESNALALAIVPQG--NEQKPGACFNDFAGTSGWELALVTTPSNHTSQAPIDRKLAGGF  448

Query  490  DSLTXNSLY-DEGAXRASQQPV----YGAPA-PNPFE------VADPFAMSNAIAAPPSV  347
            D L  +SLY DEGA R  Q       YGA +  NPFE      V DPFA+SN++A P +V
Sbjct  449  DKLLLDSLYEDEGARRQLQLQNAGYGYGATSLQNPFEQQTQQPVHDPFAVSNSVAPPTNV  508

Query  346  QLA  338
            Q+A
Sbjct  509  QMA  511



>ref|XP_011020009.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Populus euphratica]
Length=577

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 67/117 (57%), Gaps = 17/117 (15%)
 Frame = -1

Query  655  IEESNALALXIVP--------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            +EESNA+AL IVP        S A SE  +P   + TGWELALV+TP    S P + ++ 
Sbjct  388  LEESNAMALAIVPPGADPLSSSNALSELGKP---NATGWELALVTTPSNPTSQPMQSKMG  444

Query  499  GGLDSLTXNSLYDEGAXRASQQPV-----YGAPA-PNPFEVADPFAMSNAIAAPPSV  347
            GG D L  +SLY++   R   Q       YGA A  NPFE  DPFA SN+IA P +V
Sbjct  445  GGFDRLLLDSLYEDDTARKQIQMQNAGYGYGATAVHNPFEQQDPFATSNSIAPPTNV  501



>ref|XP_003542645.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Glycine max]
Length=546

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE--TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EE NALAL IVP     +   V  +    TGWELALV+ P    S     +L GGLD L
Sbjct  376  LEEKNALALAIVPVAVEQQPSAVSNQANGTTGWELALVTAPSSNESATTASKLAGGLDKL  435

Query  481  TXNSLYDEGAXRASQQPVYG----APAPNPFE--VADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R +Q   Y     AP  N  +  + DPF  SN +AAPPSVQ+A
Sbjct  436  TLDSLYDDALRRNNQNVSYNPWEPAPGGNMMQPTMHDPFFASNTVAAPPSVQMA  489



>gb|KHN03612.1| Putative clathrin assembly protein [Glycine soja]
Length=546

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE--TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EE NALAL IVP     +   V  +    TGWELALV+ P    S     +L GGLD L
Sbjct  376  LEEKNALALAIVPVAVEQQPSAVSNQANGTTGWELALVTAPSSNESATTASKLAGGLDKL  435

Query  481  TXNSLYDEGAXRASQQPVYG----APAPNPFE--VADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R +Q   Y     AP  N  +  + DPF  SN +AAPPSVQ+A
Sbjct  436  TLDSLYDDALRRNNQNVSYNPWEPAPGGNMMQPTMHDPFFASNTVAAPPSVQMA  489



>ref|XP_002308116.2| hypothetical protein POPTR_0006s07540g [Populus trichocarpa]
 gb|EEE91639.2| hypothetical protein POPTR_0006s07540g [Populus trichocarpa]
Length=575

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 67/117 (57%), Gaps = 17/117 (15%)
 Frame = -1

Query  655  IEESNALALXIVP--------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLX  500
            +EESNA+AL IVP        S A SE  +P   + TGWELALV+TP    S P + ++ 
Sbjct  385  LEESNAMALAIVPPGADPLSSSKALSELGKP---NATGWELALVTTPSNPTSQPMQSKMG  441

Query  499  GGLDSLTXNSLYDEGAXRASQQPV-----YGAPA-PNPFEVADPFAMSNAIAAPPSV  347
            GG D L  +SLY++   R   Q       YGA A  NPFE  DPFA SN+IA P +V
Sbjct  442  GGFDRLLLDSLYEDDTARKQIQMQNAGYGYGATAVHNPFEQQDPFATSNSIAPPTNV  498



>ref|XP_010250225.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nelumbo 
nucifera]
Length=549

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 67/121 (55%), Gaps = 11/121 (9%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETV---QPKXFD-RTGWELALVSTPGXXLSTPQERQLX  500
            + S +++ NALAL IVP   +S T+    P   +  TGWELALV+ P    S     +L 
Sbjct  369  EASELDQKNALALAIVPVADSSTTIPSAAPNPMNGTTGWELALVTAPSSNESATAASKLA  428

Query  499  GGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQL  341
            GGLD LT +SLYD+   RA+Q   Y    P P           DPF  SNA++APPSVQ+
Sbjct  429  GGLDKLTLDSLYDDAIRRANQTASYNPWEPMPMTGPIMQQPAHDPFFASNAVSAPPSVQI  488

Query  340  A  338
            +
Sbjct  489  S  489



>ref|XP_003563341.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X2 [Brachypodium distachyon]
Length=573

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 5/111 (5%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPKXF---DRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ +E+SNALAL IV  G+ ++    +     D++GWELALVS P    S P   QL GG
Sbjct  388  IANLEQSNALALAIVAPGSENQASTSQDLFAIDKSGWELALVSAPSNHTSQPAGIQLAGG  447

Query  493  LDSLTXNSLYDEGAXRASQQPV--YGAPAPNPFEVADPFAMSNAIAAPPSV  347
             D L  +SLY++ A R     V   G    NPF+  DPFAMSN+ A P +V
Sbjct  448  FDKLLLDSLYEDEARRHQIASVTYTGGLVANPFDPKDPFAMSNSFAPPSNV  498



>ref|XP_010240260.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Brachypodium distachyon]
Length=578

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 5/111 (5%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPKXF---DRTGWELALVSTPGXXLSTPQERQLXGG  494
            ++ +E+SNALAL IV  G+ ++    +     D++GWELALVS P    S P   QL GG
Sbjct  393  IANLEQSNALALAIVAPGSENQASTSQDLFAIDKSGWELALVSAPSNHTSQPAGIQLAGG  452

Query  493  LDSLTXNSLYDEGAXRASQQPV--YGAPAPNPFEVADPFAMSNAIAAPPSV  347
             D L  +SLY++ A R     V   G    NPF+  DPFAMSN+ A P +V
Sbjct  453  FDKLLLDSLYEDEARRHQIASVTYTGGLVANPFDPKDPFAMSNSFAPPSNV  503



>ref|XP_002269299.1| PREDICTED: putative clathrin assembly protein At5g57200 [Vitis 
vinifera]
 emb|CBI40102.3| unnamed protein product [Vitis vinifera]
Length=591

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 67/120 (56%), Gaps = 14/120 (12%)
 Frame = -1

Query  655  IEESNALALXIVP------SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            +EESNALAL I+P      S   S        + +GWELALV+TP   +S   + +L GG
Sbjct  390  LEESNALALAIIPPGNDPASAVNSGLGDFGGLNASGWELALVTTPSPNISQATDNKLAGG  449

Query  493  LDSLTXNSLYDEGAXRAS---QQPVYG-----APAPNPFEVADPFAMSNAIAAPPSVQLA  338
             + L  +SLY++ A R     Q   YG       APNPFE  DPF+MSN+IA   +VQ+A
Sbjct  450  FNKLLLDSLYEDEAARMRLQQQNAGYGFGMTTQNAPNPFEANDPFSMSNSIAPSTNVQMA  509



>ref|XP_007013561.1| ENTH/ANTH/VHS superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31180.1| ENTH/ANTH/VHS superfamily protein isoform 1 [Theobroma cacao]
Length=538

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 63/116 (54%), Gaps = 8/116 (7%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP+   +    P   +  TGWELALV+ P    S     +L GGLD 
Sbjct  372  SELDEKNALALAIVPAEQMTSAAAPVQTNGTTGWELALVTAPSSNDSATAASKLAGGLDK  431

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVA-------DPFAMSNAIAAPPSVQLA  338
            LT +SLYD+   R++Q   Y    P P   A       DPF  SN + APPSVQ+A
Sbjct  432  LTLDSLYDDAIRRSNQSVTYNPWEPAPMSGAMMQQPAHDPFYASNMVPAPPSVQMA  487



>ref|XP_006597797.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=595

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 64/116 (55%), Gaps = 13/116 (11%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDSLT  479
            +EESNA+AL IVP G     +    FD  TGWEL+LV+TP    S   +R+L GG D L 
Sbjct  397  LEESNAMALAIVPPGNNPNNLALSNFDGTTGWELSLVTTPSNHSSQAPDRRLAGGFDKLL  456

Query  478  XNSLY-DEGAXR--ASQQPVYGAPAP------NPFEV---ADPFAMSNAIAAPPSV  347
             +SLY DE A R    Q   YG          NPF+     DPFAMSN IA PPSV
Sbjct  457  LDSLYEDENARRQLQLQNAGYGHSGTMDIQNNNPFDHYNQQDPFAMSNNIAPPPSV  512



>ref|XP_007014413.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOY32032.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=572

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSLTX  476
            +EESNALAL IVP G  S          TGWELALV+TP    +   E +L GG D L  
Sbjct  394  LEESNALALAIVPPGTDSRNHGISEIGGTGWELALVTTPSSHTAPVVESKLAGGFDKLLL  453

Query  475  NSLYDEGAXRASQQ----------PVYGAPAPNPF-EVADPFAMSNAIAAPPSVQLA  338
            +SLY++ A R   Q             G   PNPF +  DPF +SN IA P +VQ+A
Sbjct  454  DSLYEDEAARRQIQLTNAGYGYGYGYEGMAVPNPFQQQHDPFMLSNNIAPPTNVQMA  510



>ref|XP_010110275.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXC25759.1| Putative clathrin assembly protein [Morus notabilis]
Length=559

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 60/117 (51%), Gaps = 7/117 (6%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            D   ++E NALAL IVP          +    TGWELALV+ P    +     +L GGLD
Sbjct  386  DTKELDEKNALALAIVPITDQPSMASTQTNGTTGWELALVTAPSSNETATATSKLAGGLD  445

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQLA  338
             LT +SLYD+   R SQ   Y    P P         V DPF+ S A+AAP SVQ+A
Sbjct  446  KLTLDSLYDDAIRRNSQNVSYNPWEPAPVSGHMMQQPVPDPFSASRAVAAPHSVQMA  502



>gb|EMT24265.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=634

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 65/116 (56%), Gaps = 7/116 (6%)
 Frame = -1

Query  664  VSAIEESNALALXIVP--SGATSETVQPKXFDRT-GWELALVSTPGXXLSTPQERQLXGG  494
            V  ++E NALAL IV    G+ + T Q      T GWELALV+ P    S P E +L GG
Sbjct  430  VVDLDEHNALALAIVGPGDGSKASTCQDLFSGSTSGWELALVTAPSRYTSQPIETKLAGG  489

Query  493  LDSLTXNSLYDEGAXRASQQPV-YGAP---APNPFEVADPFAMSNAIAAPPSVQLA  338
             D +  +SLY++GA R     V Y      A NPFE  DPFAMSN+ A P + QLA
Sbjct  490  FDIMLLDSLYEDGARRQQIASVTYNGSLGQANNPFETNDPFAMSNSFAPPSNAQLA  545



>ref|XP_004287277.1| PREDICTED: putative clathrin assembly protein At5g35200 [Fragaria 
vesca subsp. vesca]
Length=543

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 66/119 (55%), Gaps = 19/119 (16%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            D +A++E NA+AL IVP  +   T QP+  + TGWELALV+ P    S     +L GGLD
Sbjct  371  DTAALDEKNAMALAIVPV-SDQPTAQPQA-NGTGWELALVTAPSSNESATAASKLAGGLD  428

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE------------VADPFAMSNAIAAPPSV  347
             LT +SLYD+   R +Q   Y     NP+E            + DPF  SN +AAPPSV
Sbjct  429  LLTLDSLYDDAIRRNNQNVSY-----NPWEQGPMNGGMMQQPIHDPFYASNTVAAPPSV  482



>gb|EYU34970.1| hypothetical protein MIMGU_mgv1a003922mg [Erythranthe guttata]
Length=555

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 64/116 (55%), Gaps = 12/116 (10%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            S ++E N+LAL I+P+     TVQ      TGWELALV+ P    S     +L GG D L
Sbjct  378  SELDEKNSLALAIIPAEQPGSTVQNLKNGATGWELALVTAPSSADSATAASKLAGGFDIL  437

Query  481  TXNSLYDEGAXRASQQPVYGAPAPNPFEV--------ADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R +Q  V    + NP+E          DPF  SN +AAPPSVQLA
Sbjct  438  TLDSLYDDAIRRTNQNNV----SYNPWEQQQQTTMMPHDPFYASNGVAAPPSVQLA  489



>ref|XP_003549739.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
isoform X1 [Glycine max]
 ref|XP_006600736.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
isoform X2 [Glycine max]
 gb|KHN15052.1| Putative clathrin assembly protein [Glycine soja]
Length=548

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 62/114 (54%), Gaps = 8/114 (7%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSE--TVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EE NALAL IVP     +      +    TGWELALV+ P    +     +L GGLD L
Sbjct  376  LEEKNALALAIVPVAVEQQPSAASNQANGTTGWELALVTAPSSNETATAASKLAGGLDKL  435

Query  481  TXNSLYDEGAXRASQQPVYG----APAPNPFE--VADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R +Q   Y     AP  N  +  + DPF  SN +AAPPSVQ+A
Sbjct  436  TLDSLYDDALRRNNQNVSYNPWEPAPGGNMMQPTMHDPFFASNTVAAPPSVQMA  489



>ref|XP_004297901.1| PREDICTED: putative clathrin assembly protein At5g57200 [Fragaria 
vesca subsp. vesca]
Length=582

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 68/121 (56%), Gaps = 15/121 (12%)
 Frame = -1

Query  655  IEESNALALXIVPSGAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            IEE NALAL IVP G    S +        +GWELALV+TP        +++L GG D L
Sbjct  390  IEERNALALAIVPEGTAPQSGSNLNDIGGTSGWELALVTTPSTNTGPVVDKKLAGGFDKL  449

Query  481  TXNSLY-DEGAXRASQQPV----YGAPA-PNPFE-------VADPFAMSNAIAAPPSVQL  341
              +SLY DEGA R  Q       YGA +  NPFE       V DPFAMSN+IA P +VQ+
Sbjct  450  LLDSLYEDEGARRHLQLQNAGYGYGATSVQNPFEQAQQQQPVLDPFAMSNSIAPPTNVQM  509

Query  340  A  338
            A
Sbjct  510  A  510



>ref|XP_007201932.1| hypothetical protein PRUPE_ppa003855mg [Prunus persica]
 gb|EMJ03131.1| hypothetical protein PRUPE_ppa003855mg [Prunus persica]
Length=544

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 63/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            D   ++E NA+AL IVP      +  P   +  TGWELALV+ P    S     +L GGL
Sbjct  369  DTKDLDEKNAMALAIVPVSDQPPSTAPIHANGTTGWELALVTAPSSNESATAASKLAGGL  428

Query  490  DSLTXNSLYDEGAXRASQQ---------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R  Q          PV GA    P  V DPF  SN +AAPPSVQ+A
Sbjct  429  DLLTLDSLYDDAIRRNHQNVSYNPWEPVPVAGAMMQQP--VHDPFYASNTMAAPPSVQMA  486



>ref|XP_004951735.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Setaria italica]
Length=573

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 66/117 (56%), Gaps = 8/117 (7%)
 Frame = -1

Query  664  VSAIEESNALALXIV-PSGATSETVQPKXFD--RTGWELALVSTPGXXLSTPQERQLXGG  494
            V+ +EESNALAL IV P      +     FD   +GWELALV+ P    S P +  L GG
Sbjct  378  VTELEESNALALAIVAPDDQNKGSASQNLFDVNSSGWELALVTAPSTHTSQPVKTNLAGG  437

Query  493  LDSLTXNSLYDEGAXR---ASQQPVYGAPAPNPFE--VADPFAMSNAIAAPPSVQLA  338
             D L  +SLY++ A R   AS        A NPFE   +DPFAMS++ A P +VQLA
Sbjct  438  FDKLLLDSLYEDEARRKQIASVTYTGSLGAANPFEANASDPFAMSSSFAPPSNVQLA  494



>ref|XP_008242823.1| PREDICTED: putative clathrin assembly protein At5g35200 [Prunus 
mume]
 ref|XP_008242824.1| PREDICTED: putative clathrin assembly protein At5g35200 [Prunus 
mume]
Length=544

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 63/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            D   ++E NA+AL IVP      +  P   +  TGWELALV+ P    S     +L GGL
Sbjct  369  DTKDLDEKNAMALAIVPVSDQPPSTAPIHANGTTGWELALVTAPSSNESATAASKLAGGL  428

Query  490  DSLTXNSLYDEGAXRASQQ---------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R  Q          PV GA    P  V DPF  SN +AAPPSVQ+A
Sbjct  429  DLLTLDSLYDDAIRRNHQNVSYNPWEPVPVAGAMMQQP--VHDPFYASNTMAAPPSVQMA  486



>gb|KHN15336.1| Putative clathrin assembly protein [Glycine soja]
Length=596

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = -1

Query  655  IEESNALALXIVPSGATS-ETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EESNA+AL IVP G  +   +    FD  TGWEL+LV+TP    S   +R+L GG D L
Sbjct  397  LEESNAMALAIVPPGGNNPNNLALSNFDGTTGWELSLVTTPSNHSSQAPDRRLAGGFDKL  456

Query  481  TXNSLY-DEGAXR--ASQQPVYGAPAP------NPFEV---ADPFAMSNAIAAPPSV  347
              +SLY DE A R    Q   YG          NPF+     DPFAMSN IA PPSV
Sbjct  457  LLDSLYEDENARRQLHLQNAGYGHSGTMDIQNNNPFDHYNQQDPFAMSNNIAPPPSV  513



>ref|XP_002324629.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
 gb|EEF03194.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
Length=563

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 63/113 (56%), Gaps = 11/113 (10%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            S ++E NALAL IVP G  +  V       TGWELALV+ P    ST    +L GGLD L
Sbjct  389  SELDEKNALALAIVPVG--NSPVPTHANGTTGWELALVTAPSSNESTAAASKLAGGLDKL  446

Query  481  TXNSLYDEGAXRASQQPV-YG----APAPNPF---EVADPFAMSNAIAAPPSV  347
            T +SLYD+ A R S QPV Y      P  NP     V DPF  SN +AAP SV
Sbjct  447  TLDSLYDD-AIRRSNQPVSYNPWEPVPVANPMMQAAVHDPFFASNTVAAPHSV  498



>ref|XP_002982426.1| hypothetical protein SELMODRAFT_268581 [Selaginella moellendorffii]
 gb|EFJ16671.1| hypothetical protein SELMODRAFT_268581 [Selaginella moellendorffii]
Length=553

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 64/125 (51%), Gaps = 17/125 (14%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPK------XFDRTGWELALVSTPGXXLSTPQERQLX  500
            SA++ESNALAL IVPSG T+                TGWELALV+ P    +     +L 
Sbjct  378  SALDESNALALAIVPSGPTANGTSESNGAWAPQSGTTGWELALVTNPSSNENAVSSSRLA  437

Query  499  GGLDSLTXNSLYDEGAXRASQQPV-------YGAP--APNPFEVA--DPFAMSNAIAAPP  353
            GG D LT +SLYD+   R  QQ         YG P    NPF+    DPF  S   A PP
Sbjct  438  GGFDKLTLDSLYDDALSRRPQQQYAGGAGTSYGGPPQMMNPFDTMNHDPFMASGKFAPPP  497

Query  352  SVQLA  338
            +VQ+A
Sbjct  498  NVQMA  502



>ref|XP_009400569.1| PREDICTED: putative clathrin assembly protein At5g57200 [Musa 
acuminata subsp. malaccensis]
Length=585

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -1

Query  655  IEESNALALXIV-PSGATSETVQPKXF--DRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            +E+SNALAL I+ P   T  +     F  D +GWELALV+T     S   E +L GG D 
Sbjct  401  LEQSNALALAIISPGDDTKPSSTHDLFGTDSSGWELALVTTASSNTSQLVESKLAGGFDR  460

Query  484  LTXNSLYDEGAXRASQQPVY--GAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            L   SLY++ A        Y  G    NP +  DPFAMSN+IA PPSVQ+A
Sbjct  461  LLLESLYEDSARSQQIAGAYSSGGLDANPSDYNDPFAMSNSIAPPPSVQMA  511



>ref|XP_009403215.1| PREDICTED: putative clathrin assembly protein At5g35200 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009403216.1| PREDICTED: putative clathrin assembly protein At5g35200 [Musa 
acuminata subsp. malaccensis]
Length=547

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 65/122 (53%), Gaps = 23/122 (19%)
 Frame = -1

Query  661  SAIEESNALALXIVP-----SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXG  497
            S ++  NA+AL IVP     S ATS ++ P+    TGWELALV+TP    S     +L G
Sbjct  374  SELDNKNAMALAIVPVDNVPSSATSSSLNPEN-GTTGWELALVTTPSSNESAVTSSKLGG  432

Query  496  GLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFE------------VADPFAMSNAIAAPP  353
            G D LT +SLYD+   RA+Q   Y     NP+E            V DPF  SNA+AAP 
Sbjct  433  GFDKLTLDSLYDDAERRANQNVSY-----NPWEMGRMAGPMMQPVVHDPFYASNAVAAPH  487

Query  352  SV  347
             V
Sbjct  488  FV  489



>ref|XP_002966589.1| hypothetical protein SELMODRAFT_230819 [Selaginella moellendorffii]
 gb|EFJ32616.1| hypothetical protein SELMODRAFT_230819 [Selaginella moellendorffii]
Length=547

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 63/119 (53%), Gaps = 21/119 (18%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            SA++ESNALAL IVPS + +          TGWELALV+ P    +     +L GG D L
Sbjct  386  SALDESNALALAIVPSESGT----------TGWELALVTNPSSNENAVSSSRLAGGFDKL  435

Query  481  TXNSLYDEGAXRASQQPV-------YGAP--APNPFEVA--DPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R  QQ         YG P    NPF+    DPF  S   A PP+VQ+A
Sbjct  436  TLDSLYDDALSRRPQQQYAGGAGTSYGGPPQMMNPFDTMNHDPFMASGKFAPPPNVQMA  494



>ref|XP_006372154.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
 gb|ERP49951.1| hypothetical protein POPTR_0018s12580g [Populus trichocarpa]
Length=566

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 63/114 (55%), Gaps = 10/114 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP      +  P   +  TGWELALV+ P    ST    +L GGLD 
Sbjct  389  SELDEKNALALAIVPVAEQQSSPVPTHANGTTGWELALVTAPSSNESTAAASKLAGGLDK  448

Query  484  LTXNSLYDEGAXRASQQPV-YG----APAPNPF---EVADPFAMSNAIAAPPSV  347
            LT +SLYD+ A R S QPV Y      P  NP     V DPF  SN +AAP SV
Sbjct  449  LTLDSLYDD-AIRRSNQPVSYNPWEPVPVANPMMQAAVHDPFFASNTVAAPHSV  501



>ref|XP_008443941.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Cucumis melo]
Length=433

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 62/119 (52%), Gaps = 11/119 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD---RTGWELALVSTPGXXLSTPQERQLXGGL  491
            S ++E N+LAL IVP      +  P   +    TGWELALV+ P    S     +L GGL
Sbjct  257  SNLDEKNSLALAIVPVADQQTSSAPSQVNGTTTTGWELALVTAPSSNESVAATSKLAGGL  316

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFE--------VADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P          + DPF  S+A+AAP SVQ+A
Sbjct  317  DLLTLDSLYDDAIRRNNQNASYNPWEPVPMHGAMMQQQPIHDPFFASSAVAAPHSVQMA  375



>ref|XP_008443942.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Cucumis melo]
Length=555

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 62/119 (52%), Gaps = 11/119 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD---RTGWELALVSTPGXXLSTPQERQLXGGL  491
            S ++E N+LAL IVP      +  P   +    TGWELALV+ P    S     +L GGL
Sbjct  379  SNLDEKNSLALAIVPVADQQTSSAPSQVNGTTTTGWELALVTAPSSNESVAATSKLAGGL  438

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFE--------VADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P          + DPF  S+A+AAP SVQ+A
Sbjct  439  DLLTLDSLYDDAIRRNNQNASYNPWEPVPMHGAMMQQQPIHDPFFASSAVAAPHSVQMA  497



>emb|CAN83852.1| hypothetical protein VITISV_037564 [Vitis vinifera]
Length=588

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 64/118 (54%), Gaps = 8/118 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            + + ++E NA+AL IVP   T  +  P   +  TGWELALV+ P    +     +L GGL
Sbjct  368  NTAELDEKNAMALAIVPVAETPPSAGPNPANGTTGWELALVTAPSSNENATAASKLAGGL  427

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P           DPF  SNA+AAPP+VQ+A
Sbjct  428  DMLTLDSLYDDAIRRNNQNVSYNPWQPVPMGGPMMQQTAHDPFFASNAVAAPPNVQMA  485



>ref|XP_002531947.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF30429.1| clathrin assembly protein, putative [Ricinus communis]
Length=548

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP      T  P   +  TGWELALV+ P    S     +L GGLD 
Sbjct  371  SQLDEKNALALAIVPVTDQPSTTFPSQANGTTGWELALVTAPSSNESAAAASKLAGGLDK  430

Query  484  LTXNSLYDEGAXRASQQPVYGAP-------APNPFEVADPFAMSNAIAAPPSVQLA  338
            LT +SLYD+ A R S QPV   P       AP      DPF  SNA+AAP SVQ+A
Sbjct  431  LTLDSLYDD-AIRRSNQPVSYNPWEPAPMNAPMTQTAHDPFFASNAVAAPHSVQMA  485



>emb|CBI28256.3| unnamed protein product [Vitis vinifera]
Length=505

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 64/118 (54%), Gaps = 8/118 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            + + ++E NA+AL IVP   T  +  P   +  TGWELALV+ P    +     +L GGL
Sbjct  374  NTAELDEKNAMALAIVPVAETPPSAGPNPANGTTGWELALVTAPSSNENATAASKLAGGL  433

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P           DPF  SNA+AAPP+VQ+A
Sbjct  434  DMLTLDSLYDDAIRRNNQNVSYNPWQPVPMGGPMMQQTAHDPFFASNAVAAPPNVQMA  491



>ref|XP_011017841.1| PREDICTED: putative clathrin assembly protein At5g35200 [Populus 
euphratica]
Length=549

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP         P   +  TGWELALV+ P    ST    +L GGLD 
Sbjct  372  SELDEKNALALAIVPVAEQQSAPVPTHANGTTGWELALVTAPSSNESTTAASKLAGGLDK  431

Query  484  LTXNSLYDEGAXRASQQPV-YG----APAPNPF---EVADPFAMSNAIAAPPSV  347
            LT +SLYD+ A R S QPV Y      P  NP     V DPF  SN +AAP SV
Sbjct  432  LTLDSLYDD-AIRRSNQPVSYNPWEPVPVANPMMQTAVHDPFFASNTVAAPHSV  484



>ref|XP_010906894.1| PREDICTED: putative clathrin assembly protein At5g35200 [Elaeis 
guineensis]
Length=547

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 63/129 (49%), Gaps = 33/129 (26%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP----------SGATSETVQPKXFDRTGWELALVSTPGXXLSTP  518
            D S +E  NALAL IVP           G +SE         TGWELALV+ P    S  
Sbjct  369  DTSELENKNALALAIVPVDTVPTTAPSGGLSSEN------GTTGWELALVTAPSSNESAV  422

Query  517  QERQLXGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFE------------VADPFAMS  374
               +L GGLD LT +SLYD+   RA+Q   Y     NP+E            V DPF  S
Sbjct  423  ASSKLGGGLDKLTLDSLYDDADRRANQNTSY-----NPWEMTSMAGPVMQPVVHDPFYAS  477

Query  373  NAIAAPPSV  347
            NAIAAP SV
Sbjct  478  NAIAAPHSV  486



>ref|XP_002285448.2| PREDICTED: putative clathrin assembly protein At5g35200 [Vitis 
vinifera]
 ref|XP_003633084.1| PREDICTED: putative clathrin assembly protein At5g35200 [Vitis 
vinifera]
Length=555

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 64/118 (54%), Gaps = 8/118 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            + + ++E NA+AL IVP   T  +  P   +  TGWELALV+ P    +     +L GGL
Sbjct  374  NTAELDEKNAMALAIVPVAETPPSAGPNPANGTTGWELALVTAPSSNENATAASKLAGGL  433

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P           DPF  SNA+AAPP+VQ+A
Sbjct  434  DMLTLDSLYDDAIRRNNQNVSYNPWQPVPMGGPMMQQTAHDPFFASNAVAAPPNVQMA  491



>ref|XP_010687911.1| PREDICTED: putative clathrin assembly protein At5g35200 [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 67/126 (53%), Gaps = 18/126 (14%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETV-QPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLD  488
            S +EE NALAL IVP    S T   PK  +  TGWELALV+ P    S+    +L GGLD
Sbjct  372  SELEEKNALALAIVPIDDLSTTTPAPKLQNGTTGWELALVTAPSSNESSIATNKLAGGLD  431

Query  487  SLTXNSLYDEGAXRASQQPVYG--APAP-----------NPFE---VADPFAMSNAIAAP  356
             LT +SLYD+   R +Q   Y    PAP           NP     V +P+  SNA+ AP
Sbjct  432  MLTLDSLYDDAMRRTNQTVSYNPWEPAPLTNSMMQQPVHNPMMQQPVHNPYYASNAMVAP  491

Query  355  PSVQLA  338
             SVQ+A
Sbjct  492  ASVQMA  497



>gb|KDP30243.1| hypothetical protein JCGZ_17025 [Jatropha curcas]
Length=547

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 66/121 (55%), Gaps = 18/121 (15%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP      T  P   +  TGWELALV  P    S     +L GGLD 
Sbjct  372  SELDEKNALALAIVPVADQPSTTAPIQANGTTGWELALVMAPSSNESAAAASKLAGGLDK  431

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFEVA------------DPFAMSNAIAAPPSVQL  341
            LT +SLYD+ A R S QPV    + NP+E A            DPF  S+ +AAPPSVQ+
Sbjct  432  LTLDSLYDD-AIRRSNQPV----SYNPWEAAPMAGPTMQTTAHDPFFASHVVAAPPSVQM  486

Query  340  A  338
            A
Sbjct  487  A  487



>ref|XP_007213050.1| hypothetical protein PRUPE_ppa020397mg, partial [Prunus persica]
 gb|EMJ14249.1| hypothetical protein PRUPE_ppa020397mg, partial [Prunus persica]
Length=283

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 57/108 (53%), Gaps = 28/108 (26%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLS-TPQERQLXGGLDSLT  479
            IEESNALAL IVP G               WELALV+TP    S  P +++  GG D L 
Sbjct  144  IEESNALALAIVPQG---------------WELALVTTPSNHTSQVPMDKKFAGGFDKLL  188

Query  478  XNSLY-DEGAXRASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
             +SLY DEGA R +Q               DPFAMSN IA P +VQ+A
Sbjct  189  LDSLYEDEGARRQTQA-----------MATDPFAMSNNIAPPTNVQMA  225



>ref|XP_006403061.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
 ref|XP_006403062.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
 gb|ESQ44514.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
 gb|ESQ44515.1| hypothetical protein EUTSA_v10003447mg [Eutrema salsugineum]
Length=543

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 62/117 (53%), Gaps = 9/117 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            VS +EE NAL L IVP      + T+     + TGWELALV+ P          +L GGL
Sbjct  367  VSELEEKNALVLAIVPVSVEPPASTIDITNGNSTGWELALVTAPSSNEGVAANSKLAGGL  426

Query  490  DSLTXNSLYDEGAXRASQQ------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLY E A RASQQ      P    P  N   +  PF  SN +AAP SVQ+A
Sbjct  427  DKLTLDSLY-EDAIRASQQQNRSHNPWEQYPVHNGPMMQHPFFASNGVAAPHSVQMA  482



>gb|KJB64693.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=385

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 9/117 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDR--TGWELALVSTPGXXLSTPQERQLXGGLD  488
            S ++E NALAL IVP    +            TGWELALV+ P    +     +L GGLD
Sbjct  208  SELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNENATAASKLAGGLD  267

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQLA  338
             LT +SLYD+   R++Q   Y    P P         + DPF  SN +AAP SVQ+A
Sbjct  268  KLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMVAAPHSVQIA  324



>ref|XP_008794954.1| PREDICTED: putative clathrin assembly protein At5g35200 [Phoenix 
dactylifera]
Length=547

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 66/124 (53%), Gaps = 23/124 (19%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP-----SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQL  503
            D S +E+ NALAL IVP     + A S ++  +    TGWELAL++TP    S     QL
Sbjct  369  DTSELEKQNALALAIVPVDTVPAAAPSGSLSSEN-GTTGWELALITTPSSNESAVASSQL  427

Query  502  XGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFE------------VADPFAMSNAIAA  359
             GGLD LT +SLY +   RA+Q   Y     NP+E            V DPF  SNAIAA
Sbjct  428  AGGLDRLTLDSLYADADRRANQNTSY-----NPWETTPMAGPVMQPVVHDPFYASNAIAA  482

Query  358  PPSV  347
            P SV
Sbjct  483  PHSV  486



>ref|XP_002308057.2| hypothetical protein POPTR_0006s06390g [Populus trichocarpa]
 gb|EEE91580.2| hypothetical protein POPTR_0006s06390g [Populus trichocarpa]
Length=549

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 63/114 (55%), Gaps = 10/114 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP      T  P   +  TGWELALV+ P    S     +L GGLD 
Sbjct  371  SELDEKNALALAIVPVAEQQSTAIPSHANGTTGWELALVTAPSSNESAAAASKLAGGLDK  430

Query  484  LTXNSLYDEGAXRASQQPV-YG----APAPNPF---EVADPFAMSNAIAAPPSV  347
            LT +SLYD+ A R S QPV Y     AP  NP     V DPF  SN +AAP SV
Sbjct  431  LTLDSLYDD-AIRRSNQPVSYNPWEPAPMANPMMQTAVHDPFFASNMVAAPHSV  483



>gb|KJB64689.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
 gb|KJB64694.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=547

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 9/117 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDR--TGWELALVSTPGXXLSTPQERQLXGGLD  488
            S ++E NALAL IVP    +            TGWELALV+ P    +     +L GGLD
Sbjct  370  SELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNENATAASKLAGGLD  429

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQLA  338
             LT +SLYD+   R++Q   Y    P P         + DPF  SN +AAP SVQ+A
Sbjct  430  KLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMVAAPHSVQIA  486



>gb|KJB64695.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=425

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 9/117 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDR--TGWELALVSTPGXXLSTPQERQLXGGLD  488
            S ++E NALAL IVP    +            TGWELALV+ P    +     +L GGLD
Sbjct  248  SELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNENATAASKLAGGLD  307

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQLA  338
             LT +SLYD+   R++Q   Y    P P         + DPF  SN +AAP SVQ+A
Sbjct  308  KLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMVAAPHSVQIA  364



>ref|XP_009785618.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785619.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785620.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785621.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785622.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785623.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785625.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785626.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785627.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785628.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
 ref|XP_009785629.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
sylvestris]
Length=552

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATS---ETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            V+ ++E N+LAL IVP G+++     V       TGWELALV  P    S     +L GG
Sbjct  374  VAELDEKNSLALAIVPVGSSNPPASAVSNLTNGATGWELALVEAPSSNESATTTSKLAGG  433

Query  493  LDSLTXNSLYDEGAXRASQQPVYG--APAPNPFEVA-----DPFAMSNAIAAPPSVQLA  338
            LD LT +SLYD+   + +Q   Y    PAP   ++      DPF +SN +AAP +VQ+A
Sbjct  434  LDKLTLDSLYDDAMRQTNQNVSYNPWEPAPVASQMMPNVGYDPFYVSNMVAAPTNVQMA  492



>gb|ABR16117.1| unknown [Picea sitchensis]
Length=547

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 62/119 (52%), Gaps = 12/119 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVP-----SGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQL  503
            D S++EE NALAL IVP     S  TS + +      TGWELALV+T     S   E +L
Sbjct  373  DPSSLEEKNALALAIVPTTDNSSNGTSNSARDIPNGATGWELALVTTSSSNSSVQAESKL  432

Query  502  XGGLDSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVA-------DPFAMSNAIAAPPSV  347
             GG D LT +SLY++   R       G  APNPFE +       DPF  S  +A P +V
Sbjct  433  AGGFDKLTLDSLYEDAMTRQVSSYHTGQVAPNPFEASPMMQPGHDPFYASQKVAPPSAV  491



>ref|XP_011020196.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Populus euphratica]
Length=545

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP      T  P   +  TGWELALV+ P    S     +L GGLD 
Sbjct  371  SELDEKNALALAIVPVAEQQSTAIPSHANGTTGWELALVTAPSSNESAAAASKLAGGLDK  430

Query  484  LTXNSLYDEGAXRASQQPVYG-----APAPNPF---EVADPFAMSNAIAAPPSV  347
            LT +SLYD+ A R S QPV       AP  NP     V DPF  SN +AAP SV
Sbjct  431  LTLDSLYDD-AIRRSNQPVSFNPWEPAPMANPMMQTAVYDPFFASNVVAAPHSV  483



>ref|XP_011020194.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Populus euphratica]
 ref|XP_011020195.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Populus euphratica]
Length=552

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            S ++E NALAL IVP      T  P   +  TGWELALV+ P    S     +L GGLD 
Sbjct  378  SELDEKNALALAIVPVAEQQSTAIPSHANGTTGWELALVTAPSSNESAAAASKLAGGLDK  437

Query  484  LTXNSLYDEGAXRASQQPVYG-----APAPNPF---EVADPFAMSNAIAAPPSV  347
            LT +SLYD+ A R S QPV       AP  NP     V DPF  SN +AAP SV
Sbjct  438  LTLDSLYDD-AIRRSNQPVSFNPWEPAPMANPMMQTAVYDPFFASNVVAAPHSV  490



>ref|NP_001143721.1| uncharacterized protein LOC100276465 [Zea mays]
 gb|ACG34610.1| hypothetical protein [Zea mays]
Length=124

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 65/135 (48%), Gaps = 35/135 (26%)
 Frame = -1

Query  514  ERQLXGGLDSLTXNSLYDEGAXR-ASQQPVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            E  L GG D LT +SLYD+G  R   QQ +YG+  PNPF  +DP A+SN +A PPSVQ+A
Sbjct  2    ESNLGGGFDKLTLDSLYDDGTYRQMQQQQLYGSAPPNPFMASDPLAVSNQVAPPPSVQMA  61

Query  337  pmpxpxpfgpfhpaxaaypPQNPLMVGPH----------------XPXGDTGXGAFPANN  206
             M                    P+M+ P+                 P  D G GAFPA N
Sbjct  62   AMATQPQHL-------------PMMIEPNPFGPPQQHHAGVAPAANPFLDAGFGAFPAVN  108

Query  205  GDAAGAHQQNTNPFG  161
                G H Q TNPFG
Sbjct  109  ----GMHPQ-TNPFG  118



>gb|EMT14882.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=518

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 63/115 (55%), Gaps = 6/115 (5%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSETVQPKXF---DRTGWELALVSTPGXXLSTPQERQL-XG  497
            ++ +E+SNALAL IV  G+ +    P      D+ GWELALV+      S P   Q+  G
Sbjct  331  IANLEQSNALALAIVEPGSENNASAPLDLFAIDKAGWELALVTAQSNHASQPAVSQVQAG  390

Query  496  GLDSLTXNSLYDEGAXRASQQPVY--GAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            G D L  +SLY++ A R     V   G    NPF+  DPFAMSN+ A P +VQ A
Sbjct  391  GFDKLLLDSLYEDDARRQQIASVTYTGGVTVNPFDPNDPFAMSNSFAPPSNVQFA  445



>ref|XP_006586993.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=596

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 65/119 (55%), Gaps = 13/119 (11%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATS-ETVQPKXFDRT-GWELALVSTPGXXLSTPQERQLXGGL  491
            V  +EESNA+AL IVPSG  +   +     D T GWEL+LV+ P    S   +R++ GG 
Sbjct  395  VMELEESNAMALAIVPSGGNNPNNLALSNIDGTIGWELSLVTAPSNHSSQAPDRRMAGGF  454

Query  490  DSLTXNSLY-DEGAXR--ASQQPVYGA-----PAPNPFEV---ADPFAMSNAIAAPPSV  347
            D L  +SLY DE A R    Q   YG         NPF+     DPFAMSN IA PPSV
Sbjct  455  DKLLLDSLYEDENARRQLQLQNAGYGHGGTMDIHNNPFDHYNQHDPFAMSNNIAPPPSV  513



>ref|XP_004150528.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Cucumis sativus]
 ref|XP_004170238.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Cucumis sativus]
 gb|KGN65115.1| hypothetical protein Csa_1G226430 [Cucumis sativus]
Length=554

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 62/119 (52%), Gaps = 11/119 (9%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFD---RTGWELALVSTPGXXLSTPQERQLXGGL  491
            S ++E N+LAL IVP      +  P   +    TGWELALV+ P    S     +L GGL
Sbjct  379  SNLDEKNSLALAIVPVADQQTSSAPSQANGTTTTGWELALVTAPSSNESVAATSKLAGGL  438

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFE--------VADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P          + DPF  S+A+AAP SVQ+A
Sbjct  439  DLLTLDSLYDDAIRRNNQNVSYNPWEPVPMHGAMMQQQPMHDPFFASSAVAAPHSVQMA  497



>ref|XP_011078406.1| PREDICTED: putative clathrin assembly protein At5g35200 [Sesamum 
indicum]
Length=554

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 67/123 (54%), Gaps = 20/123 (16%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSE--TVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            + ++E NA+AL IVP G   +  +  P   +  TGWELALV+ P    S     +L GGL
Sbjct  379  TELDEKNAMALAIVPVGGAEQPGSTGPNLANGTTGWELALVTAPSSNESAASASKLAGGL  438

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPFEVA------------DPFAMSNAIAAPPSV  347
            D LT +SLYD+   R +Q   Y     NP+E A            DPF  SNA+AAPP+V
Sbjct  439  DKLTLDSLYDDAIRRNNQNVSY-----NPWEQAPMGNSMMPQIAHDPFYASNAVAAPPAV  493

Query  346  QLA  338
            Q+A
Sbjct  494  QMA  496



>gb|KHN35810.1| Putative clathrin assembly protein [Glycine soja]
Length=593

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 65/119 (55%), Gaps = 13/119 (11%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATS-ETVQPKXFDRT-GWELALVSTPGXXLSTPQERQLXGGL  491
            V  +EESNA+AL IVPSG  +   +     D T GWEL+LV+ P    S   +R++ GG 
Sbjct  392  VMELEESNAMALAIVPSGGNNPNNLALSNIDGTIGWELSLVTAPSNHSSQAPDRRMAGGF  451

Query  490  DSLTXNSLY-DEGAXR--ASQQPVYGA-----PAPNPFEV---ADPFAMSNAIAAPPSV  347
            D L  +SLY DE A R    Q   YG         NPF+     DPFAMSN IA PPSV
Sbjct  452  DKLLLDSLYEDENARRQLQLQNAGYGHGGTMDIHNNPFDHYNQHDPFAMSNNIAPPPSV  510



>ref|XP_007155057.1| hypothetical protein PHAVU_003G169400g [Phaseolus vulgaris]
 gb|ESW27051.1| hypothetical protein PHAVU_003G169400g [Phaseolus vulgaris]
Length=547

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFDR-----TGWELALVSTPGXXLSTPQERQLXGGL  491
            +EE NALAL IVP        QP          TGWELALV+ P    S     +L GGL
Sbjct  376  LEEKNALALAIVPIAVEQ---QPSAVSNPTNGTTGWELALVTAPSSNESAAAASKLAGGL  432

Query  490  DSLTXNSLYDEGAXRASQQPVYG----APAPNPFE--VADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y     APA N  +  + DPF  S A+AAP SVQ+A
Sbjct  433  DKLTLDSLYDDALRRNTQSVSYNPWESAPAGNAMQPTMHDPFFASTAVAAPHSVQMA  489



>ref|XP_009340644.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009340659.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
 ref|XP_009340660.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
 ref|XP_009340661.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
Length=544

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            +   +++ NALAL IVP      ++ P   +  TGWELALV+ P    S     +L GGL
Sbjct  368  NTKELDDKNALALAIVPVSDQPTSMAPTLANGATGWELALVTAPSSNESAVASSKLAGGL  427

Query  490  DSLTXNSLYDEGAXRASQQ---------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R++Q          P+ GA    P  V DPF  SN +AAP SVQ+A
Sbjct  428  DLLTLDSLYDDAIRRSNQNVSHNPWEPAPMTGAMIQQP--VHDPFYASNRMAAPHSVQMA  485



>ref|XP_009340645.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Pyrus x bretschneideri]
Length=549

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 65/120 (54%), Gaps = 12/120 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            +   +++ NALAL IVP      ++ P   +  TGWELALV+ P    S     +L GGL
Sbjct  368  NTKELDDKNALALAIVPVSDQPTSMAPTLANGATGWELALVTAPSSNESAVASSKLAGGL  427

Query  490  DSLTXNSLYDEGAXRASQQ---------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R++Q          P+ GA    P  V DPF  SN +AAP SVQ+A
Sbjct  428  DLLTLDSLYDDAIRRSNQNVSHNPWEPAPMTGAMIQQP--VHDPFYASNRMAAPHSVQMA  485



>gb|KJB64690.1| hypothetical protein B456_010G060800 [Gossypium raimondii]
Length=503

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 60/117 (51%), Gaps = 9/117 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDR--TGWELALVSTPGXXLSTPQERQLXGGLD  488
            S ++E NALAL IVP    +            TGWELALV+ P    +     +L GGLD
Sbjct  326  SELDEKNALALAIVPVAEQTTAAAAPIPANGTTGWELALVTAPSSNENATAASKLAGGLD  385

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSVQLA  338
             LT +SLYD+   R++Q   Y    P P         + DPF  SN +AAP SVQ+A
Sbjct  386  KLTLDSLYDDAIRRSNQNVSYNPWEPAPMSGAMMQQPMHDPFYASNMVAAPHSVQIA  442



>ref|XP_010533128.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X2 [Tarenaya hassleriana]
Length=577

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 67/122 (55%), Gaps = 22/122 (18%)
 Frame = -1

Query  655  IEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            IEE NA AL IVP  A   TS TV+    + TGWELALV+ P    S P   +L GGLD 
Sbjct  385  IEEKNAFALAIVPISAEEPTSTTVRSNG-NATGWELALVTAPSSNSSAPINSKLAGGLDK  443

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFE-------------VADPFAMSNAIAAPPSVQ  344
            LT +SLYD+ A RAS Q      + NP++             + DPF +SN   A PSVQ
Sbjct  444  LTLDSLYDD-AIRASNQ----TRSYNPWDQTLVHNGSMVQPGIPDPFFVSNPAMARPSVQ  498

Query  343  LA  338
            ++
Sbjct  499  MS  500



>ref|XP_010533127.1| PREDICTED: putative clathrin assembly protein At5g35200 isoform 
X1 [Tarenaya hassleriana]
Length=603

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 67/122 (55%), Gaps = 22/122 (18%)
 Frame = -1

Query  655  IEESNALALXIVPSGA---TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            IEE NA AL IVP  A   TS TV+    + TGWELALV+ P    S P   +L GGLD 
Sbjct  411  IEEKNAFALAIVPISAEEPTSTTVRSNG-NATGWELALVTAPSSNSSAPINSKLAGGLDK  469

Query  484  LTXNSLYDEGAXRASQQPVYGAPAPNPFE-------------VADPFAMSNAIAAPPSVQ  344
            LT +SLYD+ A RAS Q      + NP++             + DPF +SN   A PSVQ
Sbjct  470  LTLDSLYDD-AIRASNQ----TRSYNPWDQTLVHNGSMVQPGIPDPFFVSNPAMARPSVQ  524

Query  343  LA  338
            ++
Sbjct  525  MS  526



>gb|KJB53729.1| hypothetical protein B456_009G002600 [Gossypium raimondii]
Length=564

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 63/116 (54%), Gaps = 13/116 (11%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQ-PKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSLT  479
            +EESNALAL IVPSG  S T +       TGWELALV+ P    + P E +L GG D L 
Sbjct  397  LEESNALALAIVPSGNESTTNRGLNEISGTGWELALVTAPSNHTAPPVESKLGGGFDKLL  456

Query  478  XNSLYDEGAXRASQQPV-------YGA--PAPNPF---EVADPFAMSNAIAAPPSV  347
             +SLY++ A R   Q         YG+     NPF   +  DPF MSN IA P +V
Sbjct  457  LDSLYEDDAARRQLQLKNAGYGYGYGSMDVQQNPFHQYQHNDPFIMSNDIAPPTNV  512



>ref|XP_003609412.1| hypothetical protein MTR_4g115420 [Medicago truncatula]
 gb|AES91609.1| clathrin assembly plant-like protein, putative [Medicago truncatula]
Length=545

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 60/117 (51%), Gaps = 16/117 (14%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSLTX  476
            +EE NALAL IVP+      V        GWELALV+ P    S     +L GGLD LT 
Sbjct  375  LEEKNALALAIVPADQQPSAVSNHANGTAGWELALVTAPSSNESAAAASKLAGGLDMLTL  434

Query  475  NSLYDEGAXRASQQPVYGAPAPNPFEVA-----------DPFAMSNAIAAPPSVQLA  338
            +SLYD+   R +Q   Y     NP+E A           DPF  SN +AAP SVQ+A
Sbjct  435  DSLYDDALRRNNQNASY-----NPWEQAPAGGMMQPTMHDPFFASNTMAAPHSVQMA  486



>ref|XP_008361112.1| PREDICTED: putative clathrin assembly protein At5g35200 [Malus 
domestica]
 ref|XP_008361113.1| PREDICTED: putative clathrin assembly protein At5g35200 [Malus 
domestica]
Length=545

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            +   +++ NALAL IVP      +  P   +  TGWELALV+ P    S     +L GGL
Sbjct  368  NTKELDDKNALALAIVPVSDQPTSTAPTLANGATGWELALVTAPSSNESAVASSKLAGGL  427

Query  490  DSLTXNSLYDEGAXRASQQ---------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R++Q          P+ GA    P  V DPF  SN +AAP SVQ+A
Sbjct  428  DLLTLDSLYDDAIRRSNQNVSHNPWEPAPMTGAMMQQP--VHDPFYASNRMAAPHSVQMA  485



>ref|XP_008385249.1| PREDICTED: putative clathrin assembly protein At5g35200 [Malus 
domestica]
Length=549

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 8/118 (7%)
 Frame = -1

Query  667  DVSAIEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGL  491
            +   +++ NALAL IVP      +  P   +  TGWELALV+ P    S     +L GGL
Sbjct  368  NTKELDDKNALALAIVPVSDQPTSTAPTLENGATGWELALVTAPSSNESAVASSKLAGGL  427

Query  490  DSLTXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            D LT +SLYD+   R +Q   Y    P P        ++ DPF  SN +AAP SVQ+A
Sbjct  428  DLLTLDSLYDDAIRRNNQNVSYNPWEPAPVNGTMMQQQLHDPFYASNGMAAPHSVQMA  485



>ref|XP_006346667.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Solanum tuberosum]
Length=573

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 64/122 (52%), Gaps = 13/122 (11%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGAT--SETVQPKXFDRT-GWELALVSTPGXXLSTPQ-ERQLXG  497
            ++ +EESNALAL I+  G    S + Q      T GWELALV+      S    +++L G
Sbjct  384  IAELEESNALALAIIQPGKENPSASFQLSEIGSTSGWELALVTASSNNTSQVAPDKKLAG  443

Query  496  GLDSLTXNSLYDEGAXRASQQPV---------YGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            G D L  +SLY++ A R   Q           Y  P  NPF   DPFAMSN IA P +VQ
Sbjct  444  GFDKLLLDSLYEDDATRRQIQLQNAGYSAGCGYEIPGQNPFNQHDPFAMSNNIAPPTNVQ  503

Query  343  LA  338
            +A
Sbjct  504  MA  505



>ref|XP_009614798.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614799.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614800.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614801.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
 ref|XP_009614802.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nicotiana 
tomentosiformis]
Length=552

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATS---ETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGG  494
            V+ ++E N+LAL I+P G+++    T        TGWELALV  P    S     +L GG
Sbjct  374  VAELDEKNSLALAIIPVGSSNPPASTGSNFTNGATGWELALVEAPSSNESATTASKLAGG  433

Query  493  LDSLTXNSLYDEGAXRASQQPVYG--APAPNPFEVA-----DPFAMSNAIAAPPSVQLA  338
            LD LT +SLYD+   + +Q   Y    PAP   ++      DPF +SN +AAP +VQ+A
Sbjct  434  LDKLTLDSLYDDAMRQTNQNVSYNPWEPAPAASQMMPNVGYDPFYVSNMVAAPTNVQMA  492



>ref|XP_010323282.1| PREDICTED: putative clathrin assembly protein At5g35200 [Solanum 
lycopersicum]
 ref|XP_010323283.1| PREDICTED: putative clathrin assembly protein At5g35200 [Solanum 
lycopersicum]
Length=555

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATSE-TVQPKXFDR--TGWELALVSTPGXXLSTPQERQLXGG  494
            V+ ++E N+LAL I+P G+T+  T     F    +GWELALV  P    S     +L GG
Sbjct  374  VAELDEKNSLALAIIPVGSTNPPTSTGSNFTNGTSGWELALVEAPSSNESAATASKLGGG  433

Query  493  LDSLTXNSLYDEGAXRASQQPVYG----APAPNPFEV---ADPFAMSNAIAAPPSVQLA  338
            LD LT +SLYD+   + +Q   Y     APA  P       DPF +SN +AAP +VQ+A
Sbjct  434  LDKLTLDSLYDDAMRQTNQNVSYNPWEPAPAVAPMMQNVGYDPFYVSNMVAAPTNVQMA  492



>ref|XP_010241584.1| PREDICTED: putative clathrin assembly protein At5g35200 [Nelumbo 
nucifera]
Length=545

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = -1

Query  661  SAIEESNALALXIVPSG--ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            S ++E NALAL IVP    +T+    P     TGWELALV+ P    S     +L GGLD
Sbjct  371  SELDEQNALALAIVPVADPSTANPSGPPVNGTTGWELALVTAPSSNESATAASKLAGGLD  430

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFE-------VADPFAMSNAIAAPPSV  347
             LT +SLYD+   RA+Q   Y    P P           DPF  S A+A PPSV
Sbjct  431  KLTLDSLYDDALRRANQNVSYNPWEPMPMTGPMMQRPAHDPFLASGAVATPPSV  484



>gb|AFK40929.1| unknown [Lotus japonicus]
Length=548

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSET-VQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSLT  479
            +EE NALAL IV       T V       TGWELALV+ P    +     +L GG D LT
Sbjct  375  LEEKNALALAIVSVADQQPTAVSNHANGVTGWELALVTAPSSNENATTASKLAGGFDKLT  434

Query  478  XNSLYDEGAXRASQQPVYG----APAPNPFE--VADPFAMSNAIAAPPSVQLA  338
             +SLYD+   R +Q   Y     APA    +  + DPF  SNA+AAP SVQ+A
Sbjct  435  LDSLYDDALRRTNQNVSYNPWEPAPAGATMQPTMHDPFFASNAMAAPHSVQMA  487



>ref|XP_009398625.1| PREDICTED: putative clathrin assembly protein At4g25940 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=394

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = -1

Query  655  IEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            +EE+NALAL I+  G     S T      D +GWELALV+ P    S   E +L GG D 
Sbjct  224  LEENNALALAIISPGDNTNPSTTGDLLGTDSSGWELALVTAPSSNTSHLVESKLAGGFDM  283

Query  484  LTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPSV  347
            L  +SLY++ A R        G    NPF   DPFAMSN+IA PPSV
Sbjct  284  LLLDSLYEDSARRQQMASADSGGLDANPF---DPFAMSNSIAPPPSV  327



>ref|XP_009398623.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009398624.1| PREDICTED: putative clathrin assembly protein At5g57200 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=557

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = -1

Query  655  IEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            +EE+NALAL I+  G     S T      D +GWELALV+ P    S   E +L GG D 
Sbjct  387  LEENNALALAIISPGDNTNPSTTGDLLGTDSSGWELALVTAPSSNTSHLVESKLAGGFDM  446

Query  484  LTXNSLYDEGAXRASQQPV-YGAPAPNPFEVADPFAMSNAIAAPPSV  347
            L  +SLY++ A R        G    NPF   DPFAMSN+IA PPSV
Sbjct  447  LLLDSLYEDSARRQQMASADSGGLDANPF---DPFAMSNSIAPPPSV  490



>ref|XP_004231715.1| PREDICTED: putative clathrin assembly protein At5g57200 [Solanum 
lycopersicum]
Length=578

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 63/122 (52%), Gaps = 13/122 (11%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGAT--SETVQPKXFDRT-GWELALVSTPGXXLSTPQ-ERQLXG  497
            +  +EESNALAL I+  G    S + Q      T GWELALV+      S    +++L G
Sbjct  386  IVELEESNALALAIIQPGKENPSASFQLSEIGSTSGWELALVTASSSNTSQVAPDKKLAG  445

Query  496  GLDSLTXNSLYDEGAXRASQQPV---------YGAPAPNPFEVADPFAMSNAIAAPPSVQ  344
            G D L  +SLY++ A R   Q           Y  P  NPF   DPFAMSN IA P +VQ
Sbjct  446  GFDKLLLDSLYEDDATRRQIQLQTAGYSAGYGYEIPGQNPFNQHDPFAMSNNIAPPTNVQ  505

Query  343  LA  338
            +A
Sbjct  506  MA  507



>ref|XP_009363972.1| PREDICTED: putative clathrin assembly protein At5g35200 [Pyrus 
x bretschneideri]
Length=548

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 60/114 (53%), Gaps = 8/114 (7%)
 Frame = -1

Query  655  IEESNALALXIVPSGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDSLT  479
            +++ NALAL IVP      +  P   +  TGWELALV+ P    S     +L GGLD LT
Sbjct  372  LDDKNALALAIVPVSDQPTSTAPTLENGATGWELALVTAPSSNESAVASSKLAGGLDLLT  431

Query  478  XNSLYDEGAXRASQQPVYGAPAPNPFEVA-------DPFAMSNAIAAPPSVQLA  338
             +SLYD+   R +Q   Y    P P   A       DPF  SN +AAP SVQ+A
Sbjct  432  LDSLYDDAIRRNNQNVSYNPWEPAPVNGAMMQQPPHDPFYASNRMAAPHSVQMA  485



>ref|XP_010087990.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB31000.1| Putative clathrin assembly protein [Morus notabilis]
Length=577

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 65/117 (56%), Gaps = 12/117 (10%)
 Frame = -1

Query  655  IEESNALALXIVPSG----ATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLD  488
            IEESNALAL I+  G    +T++ +       +GWELALV+ P    S   E +L GG +
Sbjct  394  IEESNALALAIIQPGNNPPSTNQGLN-DLLGSSGWELALVTAPSNNTSHAVESKLAGGFN  452

Query  487  SLTXNSLYDEGAXRAS---QQPVY---GAPAPNPFE-VADPFAMSNAIAAPPSVQLA  338
             L  +SLY++ A R     Q   Y   G    NPF+   DPF MSN IA PP+VQ+A
Sbjct  453  KLLLDSLYEDDAARRQIQLQNAGYGHGGMSVQNPFDGQQDPFMMSNNIAPPPNVQMA  509



>gb|KHG16288.1| hypothetical protein F383_00250 [Gossypium arboreum]
Length=547

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 61/122 (50%), Gaps = 19/122 (16%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDR--TGWELALVSTPGXXLSTPQERQLXGGLD  488
            S ++E NALAL IVP    +            T WELALV+ P    +     +L GGLD
Sbjct  370  SELDEKNALALAIVPVAEQTTAAAAPIPANGNTSWELALVTAPSSNENATAASKLAGGLD  429

Query  487  SLTXNSLYDEGAXRASQQPVYGAPAPNPFEVA------------DPFAMSNAIAAPPSVQ  344
             LT +SLYD+   R++Q   Y     NP+E A            DPF  SN +AAP SVQ
Sbjct  430  KLTLDSLYDDAIRRSNQNVSY-----NPWEAAPMSGAMMQQPMHDPFYASNMVAAPHSVQ  484

Query  343  LA  338
            +A
Sbjct  485  MA  486



>dbj|BAH20213.1| AT5G35200 [Arabidopsis thaliana]
Length=363

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 59/117 (50%), Gaps = 9/117 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGATS--ETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            VS +EE NALAL IVP        T      + TGWELALV+ P        + +L GGL
Sbjct  189  VSELEEKNALALAIVPVSVEQPHSTTDFTNGNSTGWELALVTAPSSNEGAAADSKLAGGL  248

Query  490  DSLTXNSLYDEGAXRASQQ------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLY E A R SQQ      P    P  N   +  PF  SN +AAP   Q+A
Sbjct  249  DKLTLDSLY-EDAIRVSQQQNRSYNPWEQNPVHNGHMMHQPFYASNGVAAPQPFQMA  304



>gb|KHN17630.1| Putative clathrin assembly protein [Glycine soja]
Length=574

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 61/114 (54%), Gaps = 11/114 (10%)
 Frame = -1

Query  655  IEESNALALXIVP-SGATSETVQPKXFDRT-GWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EESNALAL IVP  G  S  +       T GWELALV+TP    S   +R++ GG D L
Sbjct  391  LEESNALALAIVPPGGHYSNNLALTNISGTSGWELALVTTPSNHTSQAPDRRMAGGFDKL  450

Query  481  TXNSLY-DEGAXRASQQP-----VYGAPAPNPFE---VADPFAMSNAIAAPPSV  347
              +SLY DE A R  Q         G    NPF+     DPFAMSN IA P +V
Sbjct  451  LLDSLYEDENARRQLQLRNAGYGYEGMDTHNPFDHYNQQDPFAMSNNIAPPANV  504



>ref|XP_006600479.1| PREDICTED: putative clathrin assembly protein At5g57200-like 
[Glycine max]
Length=574

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 61/114 (54%), Gaps = 11/114 (10%)
 Frame = -1

Query  655  IEESNALALXIVP-SGATSETVQPKXFDRT-GWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EESNALAL IVP  G  S  +       T GWELALV+TP    S   +R++ GG D L
Sbjct  391  LEESNALALAIVPPGGHYSNNLALTNISGTSGWELALVTTPSNHTSQAPDRRMAGGFDKL  450

Query  481  TXNSLY-DEGAXRASQQP-----VYGAPAPNPFEV---ADPFAMSNAIAAPPSV  347
              +SLY DE A R  Q         G    NPF+     DPFAMSN IA P +V
Sbjct  451  LLDSLYEDENARRQLQLRNAGYGYEGMDTHNPFDHYNQQDPFAMSNNIAPPANV  504



>gb|KGN61174.1| hypothetical protein Csa_2G061530 [Cucumis sativus]
Length=596

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 60/112 (54%), Gaps = 9/112 (8%)
 Frame = -1

Query  655  IEESNALALXIVPSGA--TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            IEESNALAL I+ +G   +S          +GWELALV+TP        E +L GG D L
Sbjct  396  IEESNALALAIITNGNDPSSSNRALSEIGGSGWELALVTTPSNNAGPSVEGKLAGGFDKL  455

Query  481  TXNSLY-DEGAXRASQQ------PVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
              +SLY DE A R  Q       P       NPFE  DPF++S+ IA PPSV
Sbjct  456  LLDSLYEDEHARRHLQLQNAGYGPYGEMMVHNPFEQHDPFSLSSNIAPPPSV  507



>ref|XP_004167932.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At4g25940-like [Cucumis sativus]
Length=596

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 60/112 (54%), Gaps = 9/112 (8%)
 Frame = -1

Query  655  IEESNALALXIVPSGA--TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            IEESNALAL I+ +G   +S          +GWELALV+TP        E +L GG D L
Sbjct  396  IEESNALALAIITNGNDPSSSNRALSEIGGSGWELALVTTPSNNAGPSVEGKLAGGFDKL  455

Query  481  TXNSLY-DEGAXRASQQ------PVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
              +SLY DE A R  Q       P       NPFE  DPF++S+ IA PPSV
Sbjct  456  LLDSLYEDEHARRHLQLQNAGYGPYGEMMVHNPFEQHDPFSLSSNIAPPPSV  507



>gb|KDO73480.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
Length=543

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 57/115 (50%), Gaps = 7/115 (6%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            S ++E NALAL IVP    +     +     GWELALV+ P    +     +L GGLD L
Sbjct  371  SELDEKNALALAIVPVEQPTSVAPTQGNGTAGWELALVTAPSSNENATAASKLAGGLDKL  430

Query  481  TXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R SQ   Y    P P           DPF  S  ++AP SVQ+A
Sbjct  431  TLDSLYDDALRRNSQNASYSTWGPQPIAGPTMQPNGHDPFYASGMVSAPHSVQMA  485



>ref|XP_007154718.1| hypothetical protein PHAVU_003G141500g [Phaseolus vulgaris]
 gb|ESW26712.1| hypothetical protein PHAVU_003G141500g [Phaseolus vulgaris]
Length=569

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = -1

Query  655  IEESNALALXIVPSGA--TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +EESNALAL IVP G   +S          +GWELALV+TP    S    R++ GG D+L
Sbjct  394  LEESNALALAIVPPGGNNSSNLALANINGTSGWELALVTTPSTHTSQAPVRKMAGGFDNL  453

Query  481  TXNSLY-DEGAXRASQ--QPVYG---APAPNPFEVA---DPFAMSNAIAAPPSVQLA  338
              +SLY DE A R  Q     YG       NPF      DPFAMSN I  P +VQ+A
Sbjct  454  LLDSLYEDENARRQLQLRNAGYGYGDMDTHNPFNHHNQQDPFAMSNNIPPPANVQMA  510



>gb|KDO73477.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
 gb|KDO73478.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
 gb|KDO73479.1| hypothetical protein CISIN_1g009078mg [Citrus sinensis]
Length=544

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 57/115 (50%), Gaps = 7/115 (6%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            S ++E NALAL IVP    +     +     GWELALV+ P    +     +L GGLD L
Sbjct  372  SELDEKNALALAIVPVEQPTSVAPTQGNGTAGWELALVTAPSSNENATAASKLAGGLDKL  431

Query  481  TXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R SQ   Y    P P           DPF  S  ++AP SVQ+A
Sbjct  432  TLDSLYDDALRRNSQNASYSTWGPQPIAGPTMQPNGHDPFYASGMVSAPHSVQMA  486



>ref|XP_006453089.1| hypothetical protein CICLE_v10007931mg [Citrus clementina]
 ref|XP_006474412.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
[Citrus sinensis]
 gb|ESR66329.1| hypothetical protein CICLE_v10007931mg [Citrus clementina]
Length=544

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 57/115 (50%), Gaps = 7/115 (6%)
 Frame = -1

Query  661  SAIEESNALALXIVPSGATSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            S ++E NALAL IVP    +     +     GWELALV+ P    +     +L GGLD L
Sbjct  372  SELDEKNALALAIVPVEQPTSVAPTQGNGTAGWELALVTAPSSNENATAASKLAGGLDKL  431

Query  481  TXNSLYDEGAXRASQQPVYGAPAPNPF-------EVADPFAMSNAIAAPPSVQLA  338
            T +SLYD+   R SQ   Y    P P           DPF  S  ++AP SVQ+A
Sbjct  432  TLDSLYDDALRRNSQNASYSTWGPQPIAGPTMQPNGHDPFYASGMVSAPHSVQMA  486



>gb|AES92253.2| clathrin assembly plant-like protein [Medicago truncatula]
Length=579

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 61/116 (53%), Gaps = 11/116 (9%)
 Frame = -1

Query  655  IEESNALALXIVP-SGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +E+SNALAL I+P  G  S  +        TGWELALV+TP        ++ + GG D L
Sbjct  392  LEDSNALALAIIPPDGNNSNNLALTNITGTTGWELALVTTPSNHTCQASDQNMAGGFDKL  451

Query  481  TXNSLY-DEGAXRASQQP-----VYGAPAPNPFEV---ADPFAMSNAIAAPPSVQL  341
              NSLY DE A R  Q         GA   NPF      DPFA+SN +A P +VQ+
Sbjct  452  LLNSLYEDENARRQLQLQNAGYGYGGAATHNPFNSYNQHDPFAVSNNVALPSNVQI  507



>ref|XP_006358316.1| PREDICTED: putative clathrin assembly protein At5g35200-like 
isoform X1 [Solanum tuberosum]
Length=556

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 10/116 (9%)
 Frame = -1

Query  655  IEESNALALXIVPSGAT---SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDS  485
            ++E N+LAL I+P G+T   + T        +GWELALV  P    S     +L GGLD 
Sbjct  377  LDEKNSLALAIIPVGSTYPPTSTGSNLTNGTSGWELALVEAPSSNESATTASKLGGGLDK  436

Query  484  LTXNSLYDEGAXRASQQPVYG----APAPNPFEV---ADPFAMSNAIAAPPSVQLA  338
            LT +SLYD+   + +Q   Y     APA  P       DPF +SN +AAP +VQ+A
Sbjct  437  LTLDSLYDDAMRQTNQNVSYNPWEPAPAVAPMMQNVGYDPFYVSNMVAAPTNVQMA  492



>ref|XP_004149514.1| PREDICTED: putative clathrin assembly protein At4g25940-like 
[Cucumis sativus]
Length=581

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 60/112 (54%), Gaps = 9/112 (8%)
 Frame = -1

Query  655  IEESNALALXIVPSGA--TSETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            IEESNALAL I+ +G   +S          +GWELALV+TP        E +L GG D L
Sbjct  381  IEESNALALAIITNGNDPSSSNRALSEIGGSGWELALVTTPSNNAGPSVEGKLAGGFDKL  440

Query  481  TXNSLY-DEGAXRASQQ------PVYGAPAPNPFEVADPFAMSNAIAAPPSV  347
              +SLY DE A R  Q       P       NPFE  DPF++S+ IA PPSV
Sbjct  441  LLDSLYEDEHARRHLQLQNAGYGPYGEMMVHNPFEQHDPFSLSSNIAPPPSV  492



>ref|NP_198370.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q9LHS0.1|CAP10_ARATH RecName: Full=Putative clathrin assembly protein At5g35200 [Arabidopsis 
thaliana]
 dbj|BAA98205.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL91173.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15694.1| unknown protein [Arabidopsis thaliana]
 gb|AED93944.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=544

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 59/117 (50%), Gaps = 9/117 (8%)
 Frame = -1

Query  664  VSAIEESNALALXIVPSGAT--SETVQPKXFDRTGWELALVSTPGXXLSTPQERQLXGGL  491
            VS +EE NALAL IVP        T      + TGWELALV+ P        + +L GGL
Sbjct  370  VSELEEKNALALAIVPVSVEQPHSTTDFTNGNSTGWELALVTAPSSNEGAAADSKLAGGL  429

Query  490  DSLTXNSLYDEGAXRASQQ------PVYGAPAPNPFEVADPFAMSNAIAAPPSVQLA  338
            D LT +SLY E A R SQQ      P    P  N   +  PF  SN +AAP   Q+A
Sbjct  430  DKLTLDSLY-EDAIRVSQQQNRSYNPWEQNPVHNGHMMHQPFYASNGVAAPQPFQMA  485



>ref|XP_003610056.1| Phosphoprotein-like protein [Medicago truncatula]
Length=584

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 61/116 (53%), Gaps = 11/116 (9%)
 Frame = -1

Query  655  IEESNALALXIVP-SGATSETVQPKXFD-RTGWELALVSTPGXXLSTPQERQLXGGLDSL  482
            +E+SNALAL I+P  G  S  +        TGWELALV+TP        ++ + GG D L
Sbjct  397  LEDSNALALAIIPPDGNNSNNLALTNITGTTGWELALVTTPSNHTCQASDQNMAGGFDKL  456

Query  481  TXNSLY-DEGAXRASQQP-----VYGAPAPNPFEV---ADPFAMSNAIAAPPSVQL  341
              NSLY DE A R  Q         GA   NPF      DPFA+SN +A P +VQ+
Sbjct  457  LLNSLYEDENARRQLQLQNAGYGYGGAATHNPFNSYNQHDPFAVSNNVALPSNVQI  512



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780