BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025D10

Length=814
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587286.1|  PREDICTED: tubby-like F-box protein 3              244   2e-74   Nicotiana tomentosiformis
ref|XP_009796557.1|  PREDICTED: tubby-like F-box protein 3              244   2e-74   Nicotiana sylvestris
ref|XP_004247460.1|  PREDICTED: tubby-like F-box protein 3              235   4e-71   
ref|XP_006359433.1|  PREDICTED: tubby-like F-box protein 3-like         235   6e-71   Solanum tuberosum [potatoes]
ref|XP_002269323.1|  PREDICTED: tubby-like F-box protein 3              229   2e-68   Vitis vinifera
ref|XP_011082500.1|  PREDICTED: tubby-like F-box protein 3              221   3e-65   Sesamum indicum [beniseed]
ref|XP_007050787.1|  Tubby like protein 3 isoform 2                     220   3e-65   
ref|XP_007050786.1|  Tubby like protein 3 isoform 1                     220   3e-65   
gb|KDP28083.1|  hypothetical protein JCGZ_13854                         220   6e-65   Jatropha curcas
ref|XP_010545046.1|  PREDICTED: tubby-like F-box protein 3 isofor...    218   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_010545048.1|  PREDICTED: tubby-like F-box protein 3 isofor...    218   3e-64   Tarenaya hassleriana [spider flower]
gb|KDO75058.1|  hypothetical protein CISIN_1g0164722mg                  211   8e-64   Citrus sinensis [apfelsine]
gb|KHN47289.1|  Tubby-like F-box protein 6                              214   1e-63   Glycine soja [wild soybean]
gb|KDO75060.1|  hypothetical protein CISIN_1g0164722mg                  211   2e-63   Citrus sinensis [apfelsine]
gb|KJB41989.1|  hypothetical protein B456_007G131500                    216   2e-63   Gossypium raimondii
ref|XP_003542914.1|  PREDICTED: tubby-like F-box protein 3-like         214   5e-63   Glycine max [soybeans]
emb|CAJ91134.1|  tubby protein                                          209   6e-63   Platanus x hispanica [London plane tree]
ref|XP_011471001.1|  PREDICTED: tubby-like F-box protein 3              214   7e-63   Fragaria vesca subsp. vesca
ref|XP_006419672.1|  hypothetical protein CICLE_v10005517mg             211   7e-63   
ref|XP_007147863.1|  hypothetical protein PHAVU_006G161100g             213   2e-62   Phaseolus vulgaris [French bean]
gb|KHF99338.1|  Tubby-like F-box protein 3                              213   2e-62   Gossypium arboreum [tree cotton]
gb|KCW58547.1|  hypothetical protein EUGRSUZ_H01209                     211   5e-62   Eucalyptus grandis [rose gum]
ref|XP_006419673.1|  hypothetical protein CICLE_v10005517mg             211   5e-62   Citrus clementina [clementine]
ref|XP_010069992.1|  PREDICTED: tubby-like F-box protein 3              210   5e-62   Eucalyptus grandis [rose gum]
gb|KDO75053.1|  hypothetical protein CISIN_1g0164722mg                  211   5e-62   Citrus sinensis [apfelsine]
gb|KDO75054.1|  hypothetical protein CISIN_1g0164722mg                  211   6e-62   Citrus sinensis [apfelsine]
gb|KDO87397.1|  hypothetical protein CISIN_1g015792mg                   207   7e-62   Citrus sinensis [apfelsine]
ref|XP_010245367.1|  PREDICTED: tubby-like F-box protein 3              211   1e-61   Nelumbo nucifera [Indian lotus]
gb|KDO87396.1|  hypothetical protein CISIN_1g015792mg                   207   2e-61   Citrus sinensis [apfelsine]
ref|XP_006380027.1|  putative Tub family protein                        210   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010523995.1|  PREDICTED: tubby-like F-box protein 3              210   4e-61   Tarenaya hassleriana [spider flower]
gb|ABK94895.1|  unknown                                                 209   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009352325.1|  PREDICTED: tubby-like F-box protein 3              207   5e-61   Pyrus x bretschneideri [bai li]
ref|XP_009346672.1|  PREDICTED: tubby-like F-box protein 3              207   6e-61   Pyrus x bretschneideri [bai li]
ref|XP_004486066.1|  PREDICTED: tubby-like F-box protein 3-like i...    209   7e-61   
gb|KHN33114.1|  Tubby-like F-box protein 6                              207   7e-61   Glycine soja [wild soybean]
gb|KHN46381.1|  Tubby-like F-box protein 3                              205   9e-61   Glycine soja [wild soybean]
ref|XP_010105019.1|  hypothetical protein L484_008460                   208   1e-60   
ref|XP_009346673.1|  PREDICTED: tubby-like F-box protein 3              208   1e-60   
ref|XP_002516864.1|  phosphoric diester hydrolase, putative             208   1e-60   Ricinus communis
ref|XP_008234991.1|  PREDICTED: tubby-like F-box protein 3              208   1e-60   Prunus mume [ume]
ref|XP_009378902.1|  PREDICTED: tubby-like F-box protein 3              208   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_007199898.1|  hypothetical protein PRUPE_ppa006662mg             208   1e-60   Prunus persica
gb|EYU46657.1|  hypothetical protein MIMGU_mgv1a007454mg                208   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_011034217.1|  PREDICTED: tubby-like F-box protein 3 isofor...    207   2e-60   Populus euphratica
ref|XP_011034223.1|  PREDICTED: tubby-like F-box protein 3 isofor...    207   2e-60   Populus euphratica
ref|XP_003546101.1|  PREDICTED: tubby-like F-box protein 3-like         207   3e-60   Glycine max [soybeans]
ref|XP_010921732.1|  PREDICTED: tubby-like F-box protein 3 isofor...    207   3e-60   Elaeis guineensis
ref|XP_002882136.1|  hypothetical protein ARALYDRAFT_322431             207   4e-60   Arabidopsis lyrata subsp. lyrata
gb|KDO87393.1|  hypothetical protein CISIN_1g015792mg                   207   4e-60   Citrus sinensis [apfelsine]
ref|XP_006444230.1|  hypothetical protein CICLE_v10020468mg             207   4e-60   Citrus clementina [clementine]
ref|XP_006479875.1|  PREDICTED: tubby-like F-box protein 3-like i...    207   4e-60   
gb|KFK37542.1|  hypothetical protein AALP_AA4G270500                    207   4e-60   Arabis alpina [alpine rockcress]
ref|NP_001280806.1|  tubby-like F-box protein 3                         207   5e-60   Malus domestica [apple tree]
ref|XP_011009467.1|  PREDICTED: tubby-like F-box protein 3 isofor...    204   6e-60   Populus euphratica
ref|XP_002314408.1|  putative Tub family protein                        206   6e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010241159.1|  PREDICTED: tubby-like F-box protein 3              206   6e-60   Nelumbo nucifera [Indian lotus]
ref|XP_007035473.1|  Tubby like protein 3 isoform 2                     203   1e-59   
emb|CDP03548.1|  unnamed protein product                                206   1e-59   Coffea canephora [robusta coffee]
ref|XP_006574455.1|  PREDICTED: uncharacterized protein LOC100809...    206   1e-59   
gb|KHN46594.1|  Tubby-like F-box protein 3                              206   1e-59   Glycine soja [wild soybean]
ref|XP_010696418.1|  PREDICTED: tubby-like F-box protein 3              205   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011009466.1|  PREDICTED: tubby-like F-box protein 3 isofor...    204   4e-59   Populus euphratica
ref|XP_008390740.1|  PREDICTED: tubby-like F-box protein 3              203   8e-59   
ref|XP_007035474.1|  Tubby like protein 3 isoform 3                     203   9e-59   
gb|AFK43062.1|  unknown                                                 203   1e-58   Lotus japonicus
gb|KEH36706.1|  tubby-F-box-like protein                                200   1e-58   Medicago truncatula
ref|XP_007035472.1|  Tubby-like F-box protein 3 isoform 1               203   1e-58   
ref|XP_008812305.1|  PREDICTED: tubby-like F-box protein 11 isofo...    201   1e-58   
ref|XP_009624999.1|  PREDICTED: tubby-like F-box protein 3 isofor...    202   2e-58   Nicotiana tomentosiformis
ref|XP_008386616.1|  PREDICTED: tubby-like F-box protein 3              202   2e-58   Malus domestica [apple tree]
ref|XP_009624993.1|  PREDICTED: tubby-like F-box protein 3 isofor...    202   2e-58   Nicotiana tomentosiformis
gb|KEH43261.1|  tubby-F-box-like protein                                202   3e-58   Medicago truncatula
ref|XP_006397986.1|  hypothetical protein EUTSA_v10001474mg             202   4e-58   Eutrema salsugineum [saltwater cress]
ref|XP_006397985.1|  hypothetical protein EUTSA_v10001474mg             202   4e-58   Eutrema salsugineum [saltwater cress]
gb|KJB23182.1|  hypothetical protein B456_004G085800                    201   4e-58   Gossypium raimondii
ref|XP_010024560.1|  PREDICTED: tubby-like F-box protein 3 isofor...    201   5e-58   Eucalyptus grandis [rose gum]
ref|XP_009369102.1|  PREDICTED: tubby-like F-box protein 3              201   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_008812302.1|  PREDICTED: tubby-like F-box protein 6 isofor...    201   5e-58   Phoenix dactylifera
ref|NP_001280765.1|  tubby-like F-box protein 3                         201   6e-58   Malus domestica [apple tree]
ref|XP_004495994.1|  PREDICTED: tubby-like F-box protein 3-like         201   7e-58   Cicer arietinum [garbanzo]
ref|XP_011090855.1|  PREDICTED: tubby-like F-box protein 6              201   7e-58   Sesamum indicum [beniseed]
ref|XP_009118192.1|  PREDICTED: tubby-like F-box protein 3              201   7e-58   Brassica rapa
ref|XP_003594006.1|  Tubby-like F-box protein                           201   8e-58   Medicago truncatula
ref|XP_010541816.1|  PREDICTED: tubby-like F-box protein 3              193   9e-58   Tarenaya hassleriana [spider flower]
ref|XP_009792510.1|  PREDICTED: tubby-like F-box protein 3 isofor...    200   1e-57   Nicotiana sylvestris
ref|XP_009792511.1|  PREDICTED: tubby-like F-box protein 3 isofor...    200   2e-57   Nicotiana sylvestris
emb|CDY55525.1|  BnaA04g29500D                                          200   3e-57   Brassica napus [oilseed rape]
emb|CDY27467.1|  BnaC04g51080D                                          199   3e-57   Brassica napus [oilseed rape]
gb|EMS68726.1|  hypothetical protein TRIUR3_30361                       196   4e-57   Triticum urartu
dbj|BAJ95298.1|  predicted protein                                      198   1e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI26117.3|  unnamed protein product                                197   1e-56   Vitis vinifera
ref|XP_008438799.1|  PREDICTED: tubby-like F-box protein 3              197   1e-56   Cucumis melo [Oriental melon]
gb|KDP40026.1|  hypothetical protein JCGZ_02024                         197   1e-56   Jatropha curcas
ref|XP_004134184.1|  PREDICTED: tubby-like F-box protein 3-like         197   1e-56   
ref|XP_008223151.1|  PREDICTED: tubby-like F-box protein 3              196   2e-56   Prunus mume [ume]
ref|XP_002276906.1|  PREDICTED: tubby-like F-box protein 3              196   3e-56   Vitis vinifera
ref|XP_010024559.1|  PREDICTED: tubby-like F-box protein 3 isofor...    196   5e-56   Eucalyptus grandis [rose gum]
gb|KGN57066.1|  hypothetical protein Csa_3G151430                       197   8e-56   Cucumis sativus [cucumbers]
ref|XP_007223049.1|  hypothetical protein PRUPE_ppa006943mg             195   8e-56   Prunus persica
gb|EMT28122.1|  hypothetical protein F775_52580                         196   9e-56   
ref|XP_009405579.1|  PREDICTED: tubby-like F-box protein 6 isofor...    193   2e-55   
ref|XP_010552822.1|  PREDICTED: tubby-like F-box protein 3              193   2e-55   
gb|KJB34618.1|  hypothetical protein B456_006G075400                    194   3e-55   Gossypium raimondii
ref|XP_003557885.1|  PREDICTED: tubby-like F-box protein 6              194   4e-55   Brachypodium distachyon [annual false brome]
dbj|BAH20382.1|  AT2G47900                                              188   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405557.1|  PREDICTED: tubby-like F-box protein 6 isofor...    193   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011462689.1|  PREDICTED: tubby-like F-box protein 3 isofor...    193   8e-55   Fragaria vesca subsp. vesca
ref|XP_004296792.1|  PREDICTED: tubby-like F-box protein 3 isofor...    192   1e-54   Fragaria vesca subsp. vesca
gb|KHG15242.1|  Tubby-like F-box protein 3                              192   1e-54   Gossypium arboreum [tree cotton]
ref|XP_010321048.1|  PREDICTED: tubby-like F-box protein 6 isofor...    192   1e-54   Solanum lycopersicum
ref|XP_004229196.1|  PREDICTED: tubby-like F-box protein 6 isofor...    192   1e-54   Solanum lycopersicum
gb|ABF95934.1|  Tubby protein, putative, expressed                      187   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006342737.1|  PREDICTED: tubby-like F-box protein 6-like i...    192   2e-54   Solanum tuberosum [potatoes]
ref|XP_006342738.1|  PREDICTED: tubby-like F-box protein 6-like i...    192   2e-54   Solanum tuberosum [potatoes]
ref|XP_008458493.1|  PREDICTED: tubby-like F-box protein 3              190   7e-54   Cucumis melo [Oriental melon]
ref|NP_001050117.1|  Os03g0351400                                       187   9e-54   
gb|AAL66203.1|AF386521_1  putative Tub family protein                   184   3e-53   Pyrus communis
ref|XP_004166452.1|  PREDICTED: LOW QUALITY PROTEIN: tubby-like F...    189   3e-53   
ref|XP_004144973.1|  PREDICTED: tubby-like F-box protein 6-like         189   3e-53   
ref|XP_010507835.1|  PREDICTED: tubby-like F-box protein 3 isofor...    189   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010506830.1|  PREDICTED: tubby-like F-box protein 3 isofor...    189   3e-53   
ref|XP_010507836.1|  PREDICTED: tubby-like F-box protein 3 isofor...    189   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010506833.1|  PREDICTED: tubby-like F-box protein 3 isofor...    189   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010518508.1|  PREDICTED: tubby-like F-box protein 3 isofor...    189   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010518507.1|  PREDICTED: tubby-like F-box protein 3 isofor...    189   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004984381.1|  PREDICTED: tubby-like F-box protein 6-like i...    188   4e-53   
ref|XP_004984372.1|  PREDICTED: tubby-like F-box protein 6-like i...    189   4e-53   
ref|XP_006651378.1|  PREDICTED: tubby-like F-box protein 6-like         187   7e-53   Oryza brachyantha
ref|NP_850481.1|  Tubby-like F-box protein 3                            188   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189775.1|  Tubby-like F-box protein 3                         188   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658081.1|  PREDICTED: tubby-like F-box protein 11-like        185   9e-53   
ref|XP_006295942.1|  hypothetical protein CARUB_v10025079mg             188   9e-53   Capsella rubella
gb|KJB41991.1|  hypothetical protein B456_007G131500                    187   1e-52   Gossypium raimondii
sp|Q10LG8.1|TLP6_ORYSJ  RecName: Full=Tubby-like F-box protein 6;...    187   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392664.1|  PREDICTED: tubby-like F-box protein 6              186   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148856.1|  tubby protein                                      184   1e-51   Zea mays [maize]
emb|CDO98920.1|  unnamed protein product                                182   2e-51   Coffea canephora [robusta coffee]
ref|XP_008676416.1|  PREDICTED: tubby protein isoform X1                184   4e-51   
tpg|DAA45381.1|  TPA: hypothetical protein ZEAMMB73_557743              184   7e-51   
gb|EYU43888.1|  hypothetical protein MIMGU_mgv1a007913mg                178   3e-49   Erythranthe guttata [common monkey flower]
gb|EYU43889.1|  hypothetical protein MIMGU_mgv1a007913mg                178   4e-49   Erythranthe guttata [common monkey flower]
ref|NP_001060572.1|  Os07g0667000                                       178   6e-49   
ref|XP_007154224.1|  hypothetical protein PHAVU_003G100700g             173   1e-47   Phaseolus vulgaris [French bean]
ref|XP_003529593.1|  PREDICTED: tubby-like F-box protein 3-like i...    173   1e-47   Glycine max [soybeans]
gb|KHN03006.1|  Tubby-like F-box protein 3                              173   1e-47   Glycine soja [wild soybean]
gb|KHG04300.1|  Tubby-like F-box protein 6                              172   1e-47   Gossypium arboreum [tree cotton]
gb|KJB28589.1|  hypothetical protein B456_005G057200                    172   6e-47   Gossypium raimondii
ref|XP_004958613.1|  PREDICTED: tubby-like F-box protein 11-like        171   1e-46   Setaria italica
gb|KHN03393.1|  Tubby-like F-box protein 3                              170   2e-46   Glycine soja [wild soybean]
ref|NP_001239849.1|  uncharacterized protein LOC100805161               170   3e-46   Glycine max [soybeans]
ref|XP_006855409.1|  hypothetical protein AMTR_s00057p00153680          170   9e-46   Amborella trichopoda
gb|KHG16836.1|  Tubby-like F-box protein 3                              167   3e-45   Gossypium arboreum [tree cotton]
ref|XP_002461169.1|  hypothetical protein SORBIDRAFT_02g042210          167   5e-45   Sorghum bicolor [broomcorn]
gb|EMT05064.1|  hypothetical protein F775_14644                         164   8e-45   
gb|KJB72557.1|  hypothetical protein B456_011G185600                    165   2e-44   Gossypium raimondii
gb|KJB72558.1|  hypothetical protein B456_011G185600                    165   2e-44   Gossypium raimondii
gb|KJB71035.1|  hypothetical protein B456_011G101400                    165   5e-44   Gossypium raimondii
emb|CBI18204.3|  unnamed protein product                                161   7e-44   Vitis vinifera
ref|XP_006340635.1|  PREDICTED: tubby-like F-box protein 5-like i...    164   1e-43   Solanum tuberosum [potatoes]
ref|XP_008661891.1|  PREDICTED: LOC100281492 isoform X1                 164   2e-43   
gb|KHG30423.1|  Tubby-like F-box protein 5                              162   3e-43   Gossypium arboreum [tree cotton]
gb|KHN36105.1|  Tubby-like F-box protein 5                              162   3e-43   Glycine soja [wild soybean]
ref|XP_009120949.1|  PREDICTED: tubby-like F-box protein 11             162   3e-43   Brassica rapa
ref|XP_007156957.1|  hypothetical protein PHAVU_002G031500g             163   3e-43   Phaseolus vulgaris [French bean]
gb|AFK46698.1|  unknown                                                 156   3e-43   Lotus japonicus
ref|XP_009403904.1|  PREDICTED: tubby-like F-box protein 5              163   4e-43   
dbj|BAK08010.1|  predicted protein                                      162   4e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003517227.1|  PREDICTED: tubby-like F-box protein 5-like i...    162   4e-43   Glycine max [soybeans]
ref|NP_001266362.1|  uncharacterized protein LOC101202709               155   4e-43   
ref|XP_010489533.1|  PREDICTED: tubby-like F-box protein 2              162   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008452072.1|  PREDICTED: tubby-like F-box protein 5              162   6e-43   Cucumis melo [Oriental melon]
ref|XP_001776881.1|  tubby-like protein                                 162   6e-43   
ref|XP_004146502.1|  PREDICTED: tubby-like F-box protein 5-like         162   6e-43   Cucumis sativus [cucumbers]
gb|EMS56881.1|  hypothetical protein TRIUR3_17848                       160   7e-43   Triticum urartu
ref|XP_010414142.1|  PREDICTED: tubby-like F-box protein 2              161   7e-43   Camelina sativa [gold-of-pleasure]
dbj|BAJ95176.1|  predicted protein                                      160   7e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHZ96981.1|  TLP transcription factor 98                             154   7e-43   Saccharum hybrid cultivar CoC 671
ref|XP_006297853.1|  hypothetical protein CARUB_v10013894mg             161   8e-43   Capsella rubella
emb|CDY25159.1|  BnaC07g03480D                                          160   9e-43   Brassica napus [oilseed rape]
gb|EMT18456.1|  hypothetical protein F775_06966                         160   1e-42   
ref|XP_009102252.1|  PREDICTED: tubby-like F-box protein 2              160   1e-42   Brassica rapa
emb|CDY46301.1|  BnaA07g02000D                                          160   1e-42   Brassica napus [oilseed rape]
gb|KJB40194.1|  hypothetical protein B456_007G050300                    159   1e-42   Gossypium raimondii
ref|XP_002884125.1|  hypothetical protein ARALYDRAFT_480735             160   1e-42   
ref|XP_004147860.1|  PREDICTED: tubby-like F-box protein 5-like         160   1e-42   
ref|NP_849975.1|  Tubby-like F-box protein 2                            160   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466546.1|  PREDICTED: tubby-like F-box protein 5              161   1e-42   Cucumis melo [Oriental melon]
ref|XP_004232417.1|  PREDICTED: tubby-like F-box protein 5              161   1e-42   
ref|XP_001768253.1|  tubby-like protein                                 161   2e-42   
ref|XP_006432266.1|  hypothetical protein CICLE_v10001261mg             157   2e-42   
ref|XP_009603271.1|  PREDICTED: tubby-like F-box protein 5              160   2e-42   Nicotiana tomentosiformis
gb|KGN59979.1|  hypothetical protein Csa_3G859660                       160   2e-42   Cucumis sativus [cucumbers]
gb|AAD15508.1|  putative Tub family protein                             160   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58599.1|  hypothetical protein M569_16214                         159   2e-42   Genlisea aurea
gb|ABK24436.1|  unknown                                                 160   2e-42   Picea sitchensis
ref|XP_010467642.1|  PREDICTED: tubby-like F-box protein 2              160   2e-42   Camelina sativa [gold-of-pleasure]
ref|NP_197369.2|  Tubby-like F-box protein 11                           160   3e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82256.1|  hypothetical protein VITISV_009404                     159   3e-42   Vitis vinifera
gb|AAL03978.1|  tubby-like protein 12                                   159   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147882.1|  LOC100281492                                       160   3e-42   
gb|EYU25695.1|  hypothetical protein MIMGU_mgv1a024543mg                153   4e-42   Erythranthe guttata [common monkey flower]
ref|NP_001141728.2|  uncharacterized protein LOC100273859               160   4e-42   Zea mays [maize]
ref|XP_003562487.1|  PREDICTED: tubby-like F-box protein 11             159   6e-42   
dbj|BAJ93523.1|  predicted protein                                      159   6e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006878561.1|  hypothetical protein AMTR_s00011p00238180          157   6e-42   
gb|KJB40192.1|  hypothetical protein B456_007G050300                    159   6e-42   Gossypium raimondii
ref|XP_004953612.1|  PREDICTED: tubby-like F-box protein 5-like         159   6e-42   Setaria italica
ref|XP_002267914.1|  PREDICTED: tubby-like F-box protein 8              159   7e-42   Vitis vinifera
ref|XP_010546915.1|  PREDICTED: tubby-like F-box protein 11             158   8e-42   Tarenaya hassleriana [spider flower]
ref|XP_007046900.1|  Tubby-like F-box protein 5 isoform 1               159   8e-42   Theobroma cacao [chocolate]
ref|XP_006432270.1|  hypothetical protein CICLE_v10001261mg             157   1e-41   
ref|XP_010095256.1|  Tubby-like F-box protein 5                         159   1e-41   
ref|XP_010241698.1|  PREDICTED: tubby-like F-box protein 8              158   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_011099633.1|  PREDICTED: tubby-like F-box protein 5              158   2e-41   Sesamum indicum [beniseed]
ref|XP_007017568.1|  Tubby like protein 6                               158   2e-41   
ref|NP_001265963.1|  tubby-like F-box protein 5-like                    158   2e-41   Cicer arietinum [garbanzo]
ref|XP_006409171.1|  hypothetical protein EUTSA_v10022721mg             157   2e-41   Eutrema salsugineum [saltwater cress]
gb|ABR16075.1|  unknown                                                 158   2e-41   Picea sitchensis
ref|XP_010258386.1|  PREDICTED: tubby-like F-box protein 5              158   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010420648.1|  PREDICTED: tubby-like F-box protein 11             157   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009416896.1|  PREDICTED: tubby-like F-box protein 8              158   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006598751.1|  PREDICTED: uncharacterized protein LOC100803...    158   2e-41   Glycine max [soybeans]
ref|XP_006574698.1|  PREDICTED: tubby-like F-box protein 5-like         157   2e-41   Glycine max [soybeans]
gb|KHN00530.1|  Tubby-like F-box protein 2                              157   2e-41   Glycine soja [wild soybean]
ref|XP_010062111.1|  PREDICTED: tubby-like F-box protein 8              158   2e-41   Eucalyptus grandis [rose gum]
gb|KEH20427.1|  tubby-F-box-like protein                                157   3e-41   Medicago truncatula
ref|XP_002454421.1|  hypothetical protein SORBIDRAFT_04g030550          158   3e-41   Sorghum bicolor [broomcorn]
ref|XP_002306697.1|  hypothetical protein POPTR_0005s21450g             157   3e-41   Populus trichocarpa [western balsam poplar]
gb|ABK94204.1|  unknown                                                 157   3e-41   Populus trichocarpa [western balsam poplar]
gb|AAP40448.1|  putative F-box containing tubby family protein          157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786613.1|  PREDICTED: tubby-like F-box protein 5              157   3e-41   Nicotiana sylvestris
ref|XP_002984539.1|  hypothetical protein SELMODRAFT_181065             157   3e-41   Selaginella moellendorffii
ref|XP_002965452.1|  hypothetical protein SELMODRAFT_83983              157   3e-41   Selaginella moellendorffii
ref|XP_010531041.1|  PREDICTED: tubby-like F-box protein 2              157   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_009590675.1|  PREDICTED: tubby-like F-box protein 5              157   4e-41   Nicotiana tomentosiformis
ref|XP_011101573.1|  PREDICTED: tubby-like F-box protein 8              157   4e-41   Sesamum indicum [beniseed]
ref|XP_010260950.1|  PREDICTED: tubby-like F-box protein 8              157   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008440726.1|  PREDICTED: tubby-like F-box protein 5              157   4e-41   Cucumis melo [Oriental melon]
gb|EPS60718.1|  hypothetical protein M569_14084                         154   5e-41   Genlisea aurea
ref|XP_007156059.1|  hypothetical protein PHAVU_003G254900g             157   5e-41   Phaseolus vulgaris [French bean]
ref|NP_001242468.1|  uncharacterized protein LOC100803729               157   6e-41   
gb|KDP38521.1|  hypothetical protein JCGZ_04446                         159   6e-41   Jatropha curcas
ref|XP_002266692.1|  PREDICTED: tubby-like F-box protein 8              157   6e-41   Vitis vinifera
ref|XP_006647762.1|  PREDICTED: tubby-like F-box protein 5-like         156   6e-41   
ref|XP_004512053.1|  PREDICTED: tubby-like F-box protein 5-like         156   7e-41   
gb|KFK38076.1|  hypothetical protein AALP_AA3G066700                    156   7e-41   Arabis alpina [alpine rockcress]
ref|XP_010912431.1|  PREDICTED: tubby-like F-box protein 14             157   8e-41   Elaeis guineensis
ref|XP_002882466.1|  hypothetical protein ARALYDRAFT_477941             155   8e-41   
ref|XP_008218837.1|  PREDICTED: tubby-like F-box protein 8              152   8e-41   Prunus mume [ume]
gb|KDP30771.1|  hypothetical protein JCGZ_15200                         156   8e-41   Jatropha curcas
ref|XP_009616929.1|  PREDICTED: tubby-like F-box protein 5 isofor...    156   8e-41   
sp|Q6Z2G9.1|TLP5_ORYSJ  RecName: Full=Tubby-like F-box protein 5;...    156   8e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KDO50624.1|  hypothetical protein CISIN_1g014405mg                   156   8e-41   Citrus sinensis [apfelsine]
ref|XP_006432267.1|  hypothetical protein CICLE_v10001261mg             156   9e-41   
ref|XP_009616927.1|  PREDICTED: tubby-like F-box protein 5 isofor...    156   9e-41   Nicotiana tomentosiformis
gb|KDP31657.1|  hypothetical protein JCGZ_14973                         156   9e-41   Jatropha curcas
gb|EAY87217.1|  hypothetical protein OsI_08620                          156   9e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_002521568.1|  phosphoric diester hydrolase, putative             156   9e-41   
ref|XP_009616928.1|  PREDICTED: tubby-like F-box protein 5 isofor...    156   1e-40   Nicotiana tomentosiformis
ref|XP_009616926.1|  PREDICTED: tubby-like F-box protein 5 isofor...    156   1e-40   Nicotiana tomentosiformis
ref|XP_003612033.1|  Tubby-like F-box protein                           156   1e-40   Medicago truncatula
ref|XP_009615512.1|  PREDICTED: tubby-like F-box protein 8              156   1e-40   Nicotiana tomentosiformis
ref|NP_001130850.1|  hypothetical protein                               156   1e-40   Zea mays [maize]
gb|EEE57650.1|  hypothetical protein OsJ_08083                          156   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009390170.1|  PREDICTED: tubby-like F-box protein 5              156   1e-40   
ref|XP_006400420.1|  hypothetical protein EUTSA_v10013783mg             155   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_003544406.1|  PREDICTED: tubby-like F-box protein 5-like i...    156   1e-40   Glycine max [soybeans]
ref|XP_006849245.1|  hypothetical protein AMTR_s00027p00237390          156   1e-40   Amborella trichopoda
ref|XP_004162322.1|  PREDICTED: LOW QUALITY PROTEIN: tubby-like F...    155   1e-40   
emb|CDP02006.1|  unnamed protein product                                155   1e-40   Coffea canephora [robusta coffee]
ref|XP_002510406.1|  phosphoric diester hydrolase, putative             155   1e-40   Ricinus communis
ref|XP_004143519.1|  PREDICTED: tubby-like F-box protein 5-like         155   1e-40   Cucumis sativus [cucumbers]
gb|EYU40189.1|  hypothetical protein MIMGU_mgv1a007253mg                155   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_002524285.1|  phosphoric diester hydrolase, putative             155   2e-40   Ricinus communis
gb|AFK44234.1|  unknown                                                 154   2e-40   Medicago truncatula
gb|AFX97755.1|  f-box family protein                                    148   2e-40   Galium verum var. asiaticum
ref|XP_010930978.1|  PREDICTED: tubby-like F-box protein 14             155   2e-40   Elaeis guineensis
ref|XP_008781418.1|  PREDICTED: tubby-like F-box protein 8              155   2e-40   Phoenix dactylifera
ref|XP_007160744.1|  hypothetical protein PHAVU_001G013500g             155   2e-40   
gb|EYU40188.1|  hypothetical protein MIMGU_mgv1a007253mg                155   2e-40   
ref|XP_003518598.1|  PREDICTED: tubby-like F-box protein 8-like i...    155   2e-40   
ref|XP_003531569.1|  PREDICTED: tubby-like F-box protein 8-like i...    155   2e-40   
ref|XP_004163912.1|  PREDICTED: tubby-like F-box protein 8-like         155   2e-40   
ref|XP_004140690.1|  PREDICTED: tubby-like F-box protein 8-like         155   2e-40   
ref|XP_008456108.1|  PREDICTED: tubby-like F-box protein 8              155   3e-40   
ref|XP_006393597.1|  hypothetical protein EUTSA_v10011537mg             155   3e-40   
ref|XP_006346954.1|  PREDICTED: tubby-like F-box protein 5-like i...    155   3e-40   
ref|XP_003537592.1|  PREDICTED: tubby-like F-box protein 5-like i...    155   3e-40   
gb|KJB59395.1|  hypothetical protein B456_009G254100                    154   3e-40   
ref|XP_006287908.1|  hypothetical protein CARUB_v10001142mg             154   3e-40   
gb|KEH40162.1|  tubby-F-box-like protein                                155   3e-40   
ref|XP_002964280.1|  hypothetical protein SELMODRAFT_230435             154   3e-40   
ref|XP_011044224.1|  PREDICTED: tubby-like F-box protein 8 isofor...    153   3e-40   
ref|XP_011025813.1|  PREDICTED: tubby-like F-box protein 5              155   3e-40   
ref|XP_002310813.1|  hypothetical protein POPTR_0007s13040g             155   3e-40   
ref|XP_004287886.1|  PREDICTED: tubby-like F-box protein 5              155   3e-40   
ref|XP_003593111.1|  Tubby-like F-box protein                           155   4e-40   
ref|NP_001280988.1|  tubby-like F-box protein 5                         154   4e-40   
emb|CDX92589.1|  BnaA10g16280D                                          154   4e-40   
ref|XP_009341307.1|  PREDICTED: tubby-like F-box protein 8              155   4e-40   
gb|KHG03411.1|  Tubby-like F-box protein 8                              154   4e-40   
ref|XP_007148458.1|  hypothetical protein PHAVU_006G210500g             154   4e-40   
ref|XP_003550385.1|  PREDICTED: tubby-like F-box protein 5-like i...    155   4e-40   
emb|CDY42119.1|  BnaA09g28410D                                          155   4e-40   
gb|KJB59393.1|  hypothetical protein B456_009G254100                    154   4e-40   
ref|XP_002302178.1|  F-box family protein                               154   4e-40   
ref|XP_004499167.1|  PREDICTED: tubby-like F-box protein 5-like         154   5e-40   
ref|XP_009115300.1|  PREDICTED: tubby-like F-box protein 10             155   5e-40   
ref|XP_010679743.1|  PREDICTED: tubby-like F-box protein 5              154   5e-40   
ref|XP_001777504.1|  predicted protein                                  154   5e-40   
ref|XP_006601316.1|  PREDICTED: tubby-like F-box protein 5-like i...    155   5e-40   
ref|XP_006597337.1|  PREDICTED: tubby-like F-box protein 8-like i...    154   5e-40   
ref|XP_001777506.1|  predicted protein                                  154   5e-40   
ref|XP_011044217.1|  PREDICTED: tubby-like F-box protein 8 isofor...    154   5e-40   
ref|XP_011028857.1|  PREDICTED: tubby-like F-box protein 5              154   5e-40   
ref|XP_006601317.1|  PREDICTED: tubby-like F-box protein 5-like i...    155   5e-40   
ref|XP_004485526.1|  PREDICTED: tubby-like F-box protein 8-like         154   5e-40   
ref|XP_002306698.1|  hypothetical protein POPTR_0005s21460g             154   6e-40   
ref|XP_009779244.1|  PREDICTED: tubby-like F-box protein 5              154   6e-40   
ref|XP_002265804.1|  PREDICTED: tubby-like F-box protein 5              154   6e-40   
ref|XP_010526759.1|  PREDICTED: tubby-like F-box protein 2              153   6e-40   
ref|XP_010680670.1|  PREDICTED: tubby-like F-box protein 8              154   6e-40   
ref|XP_010492890.1|  PREDICTED: tubby-like F-box protein 11             154   6e-40   
ref|XP_003570189.1|  PREDICTED: tubby-like F-box protein 5              154   6e-40   
ref|XP_002300764.1|  F-box family protein                               154   6e-40   
gb|KHN12701.1|  Tubby-like F-box protein 5                              154   6e-40   
gb|KHN11108.1|  Tubby-like F-box protein 5                              154   6e-40   
ref|NP_001239813.1|  uncharacterized protein LOC100777506               154   6e-40   
ref|XP_008338328.1|  PREDICTED: tubby-like F-box protein 5              154   6e-40   
ref|XP_010926002.1|  PREDICTED: tubby-like F-box protein 5              154   6e-40   
emb|CDX84977.1|  BnaC05g20780D                                          154   7e-40   
ref|XP_009762099.1|  PREDICTED: tubby-like F-box protein 8 isofor...    154   7e-40   
ref|XP_001772602.1|  predicted protein                                  154   7e-40   
ref|XP_004233524.1|  PREDICTED: tubby-like F-box protein 5              154   7e-40   
ref|XP_009762107.1|  PREDICTED: tubby-like F-box protein 8 isofor...    152   7e-40   
emb|CDP07499.1|  unnamed protein product                                154   7e-40   
ref|XP_002989529.1|  hypothetical protein SELMODRAFT_160180             154   8e-40   
gb|KFK27521.1|  hypothetical protein AALP_AA8G394000                    153   8e-40   
ref|XP_002282152.1|  PREDICTED: tubby-like F-box protein 5              154   8e-40   
emb|CBI19713.3|  unnamed protein product                                152   8e-40   
ref|XP_010523605.1|  PREDICTED: tubby-like F-box protein 6 isofor...    154   8e-40   
ref|XP_010486146.1|  PREDICTED: tubby-like F-box protein 9              153   9e-40   
ref|XP_006473522.1|  PREDICTED: tubby-like F-box protein 5-like i...    154   9e-40   
ref|XP_006473523.1|  PREDICTED: tubby-like F-box protein 5-like i...    154   1e-39   
emb|CDY05258.1|  BnaC05g45450D                                          152   1e-39   
ref|XP_010102079.1|  Tubby-like F-box protein 5                         153   1e-39   
ref|XP_008784162.1|  PREDICTED: tubby-like F-box protein 8 isofor...    154   1e-39   
ref|XP_008784163.1|  PREDICTED: tubby-like F-box protein 8 isofor...    154   1e-39   
ref|XP_009783834.1|  PREDICTED: tubby-like F-box protein 8              153   1e-39   
ref|XP_011011733.1|  PREDICTED: tubby-like F-box protein 2              153   1e-39   
ref|XP_010439287.1|  PREDICTED: tubby-like F-box protein 9              152   1e-39   
ref|XP_002891342.1|  hypothetical protein ARALYDRAFT_473876             153   1e-39   
gb|KJB15992.1|  hypothetical protein B456_002G207100                    153   1e-39   
ref|XP_008793936.1|  PREDICTED: tubby-like F-box protein 8              153   1e-39   
gb|KDO84592.1|  hypothetical protein CISIN_1g014578mg                   153   1e-39   
ref|XP_006435014.1|  hypothetical protein CICLE_v10001275mg             153   1e-39   
ref|XP_004290516.1|  PREDICTED: tubby-like F-box protein 8              153   1e-39   
ref|XP_004291869.1|  PREDICTED: tubby-like F-box protein 2              153   1e-39   
ref|XP_006435015.1|  hypothetical protein CICLE_v10001275mg             153   1e-39   
ref|XP_009103059.1|  PREDICTED: tubby-like F-box protein 10             153   2e-39   
ref|XP_004237792.1|  PREDICTED: tubby-like F-box protein 8              153   2e-39   
ref|XP_009340733.1|  PREDICTED: tubby-like F-box protein 5              153   2e-39   
ref|XP_006359816.1|  PREDICTED: tubby-like F-box protein 8-like         153   2e-39   
gb|KDO84594.1|  hypothetical protein CISIN_1g014578mg                   153   2e-39   
ref|XP_006304986.1|  hypothetical protein CARUB_v10009350mg             152   2e-39   
ref|XP_008241696.1|  PREDICTED: tubby-like F-box protein 5              153   2e-39   
gb|KDO84593.1|  hypothetical protein CISIN_1g014578mg                   153   2e-39   
gb|KHG16429.1|  Tubby-like F-box protein 8                              153   2e-39   
gb|AAG52638.1|AC079677_2  unknown protein; 3155-1759                    152   2e-39   
emb|CDY66464.1|  BnaCnng51010D                                          153   2e-39   
ref|XP_010029781.1|  PREDICTED: tubby-like F-box protein 5              152   2e-39   
ref|XP_008784902.1|  PREDICTED: tubby-like F-box protein 5 isofor...    152   2e-39   
gb|KDO83735.1|  hypothetical protein CISIN_1g014365mg                   152   2e-39   
emb|CDY72036.1|  BnaA07g36880D                                          153   2e-39   
ref|XP_011007469.1|  PREDICTED: tubby-like F-box protein 5 isofor...    152   2e-39   
ref|XP_006407954.1|  hypothetical protein EUTSA_v10020909mg             152   2e-39   
ref|XP_008784901.1|  PREDICTED: tubby-like F-box protein 5 isofor...    153   2e-39   
ref|XP_007202166.1|  hypothetical protein PRUPE_ppa006428mg             152   2e-39   
ref|XP_002307662.2|  hypothetical protein POPTR_0005s25010g             152   2e-39   
ref|XP_011042854.1|  PREDICTED: tubby-like F-box protein 8              152   2e-39   
ref|XP_010464209.1|  PREDICTED: tubby-like F-box protein 9              152   2e-39   
ref|XP_002873910.1|  hypothetical protein ARALYDRAFT_909882             152   2e-39   
ref|XP_006297896.1|  hypothetical protein CARUB_v10013937mg             152   2e-39   
ref|XP_009351377.1|  PREDICTED: tubby-like F-box protein 8              152   2e-39   
ref|NP_001185159.1|  Tubby-like F-box protein 6                         152   2e-39   
ref|XP_011007470.1|  PREDICTED: tubby-like F-box protein 5 isofor...    152   2e-39   
ref|NP_175160.2|  Tubby-like F-box protein 6                            152   2e-39   
ref|XP_010254793.1|  PREDICTED: tubby-like F-box protein 5              152   2e-39   
ref|XP_006434458.1|  hypothetical protein CICLE_v10001251mg             152   2e-39   
gb|EPS72900.1|  hypothetical protein M569_01857                         152   2e-39   
ref|XP_006473057.1|  PREDICTED: tubby-like F-box protein 8-like i...    152   2e-39   
ref|XP_008237608.1|  PREDICTED: tubby-like F-box protein 8              149   3e-39   
ref|XP_004248812.1|  PREDICTED: tubby-like F-box protein 8              152   3e-39   
ref|XP_006307530.1|  hypothetical protein CARUB_v10009152mg             152   3e-39   
ref|XP_007222682.1|  hypothetical protein PRUPE_ppa006363mg             152   3e-39   
ref|XP_004234552.1|  PREDICTED: tubby-like F-box protein 5              152   3e-39   
ref|XP_008220821.1|  PREDICTED: tubby-like F-box protein 5              152   3e-39   
ref|XP_010530245.1|  PREDICTED: tubby-like F-box protein 8              152   3e-39   
ref|XP_010500248.1|  PREDICTED: tubby-like F-box protein 6              152   3e-39   
emb|CDP11400.1|  unnamed protein product                                152   3e-39   
gb|AED87506.1|  F-box protein                                           152   3e-39   
ref|XP_010461524.1|  PREDICTED: tubby-like F-box protein 6              152   3e-39   
ref|XP_008810717.1|  PREDICTED: tubby-like F-box protein 5              152   3e-39   
gb|KJB63638.1|  hypothetical protein B456_010G009400                    152   4e-39   
ref|XP_009371611.1|  PREDICTED: tubby-like F-box protein 5              152   4e-39   
gb|KHG22721.1|  Tubby-like F-box protein 5                              151   4e-39   
gb|KJB63639.1|  hypothetical protein B456_010G009400                    152   4e-39   
ref|XP_006425657.1|  hypothetical protein CICLE_v10025715mg             152   4e-39   
ref|XP_009118920.1|  PREDICTED: tubby-like F-box protein 6              152   4e-39   
gb|KDO70942.1|  hypothetical protein CISIN_1g014979mg                   152   4e-39   
emb|CDY36119.1|  BnaA08g19290D                                          152   4e-39   
gb|KHG21851.1|  Tubby-like F-box protein 5                              152   4e-39   
ref|XP_007019500.1|  Tubby like protein 10 isoform 1                    152   4e-39   
ref|XP_006663846.1|  PREDICTED: tubby-like F-box protein 14-like        152   5e-39   
ref|XP_008218843.1|  PREDICTED: tubby-like F-box protein 8              152   5e-39   
ref|XP_010454121.1|  PREDICTED: tubby-like F-box protein 11             151   5e-39   
ref|XP_010927387.1|  PREDICTED: tubby-like F-box protein 8              152   5e-39   
ref|XP_009380364.1|  PREDICTED: tubby-like F-box protein 5              152   5e-39   
emb|CDO97502.1|  unnamed protein product                                152   5e-39   
ref|NP_187289.1|  tubby-like F-box protein 9                            150   5e-39   
ref|XP_009414588.1|  PREDICTED: tubby-like F-box protein 8              152   5e-39   
ref|XP_004977310.1|  PREDICTED: tubby-like F-box protein 14-like ...    152   5e-39   
gb|KJB48406.1|  hypothetical protein B456_008G067400                    151   6e-39   
ref|XP_010479125.1|  PREDICTED: tubby-like F-box protein 6              151   6e-39   
ref|XP_007222448.1|  hypothetical protein PRUPE_ppa006177mg             151   6e-39   
gb|KJB48407.1|  hypothetical protein B456_008G067400                    151   6e-39   
ref|XP_004140966.1|  PREDICTED: tubby-like F-box protein 14-like        151   6e-39   
ref|XP_008441515.1|  PREDICTED: tubby-like F-box protein 8              151   6e-39   
ref|XP_011044216.1|  PREDICTED: tubby-like F-box protein 8 isofor...    151   6e-39   
ref|XP_009109870.1|  PREDICTED: tubby-like F-box protein 10             151   7e-39   
ref|XP_009365542.1|  PREDICTED: tubby-like F-box protein 5              151   7e-39   
ref|XP_010911994.1|  PREDICTED: tubby-like F-box protein 8 isofor...    149   7e-39   
emb|CDY51990.1|  BnaC03g75660D                                          151   7e-39   
ref|XP_004516626.1|  PREDICTED: tubby-like F-box protein 8-like i...    151   8e-39   
ref|XP_003592106.1|  Tubby-like F-box protein                           151   8e-39   
ref|XP_008388046.1|  PREDICTED: tubby-like F-box protein 5              151   8e-39   
ref|NP_973909.1|  tubby-like F-box protein 10                           147   8e-39   
emb|CDY24698.1|  BnaA05g30970D                                          149   9e-39   
ref|NP_001280861.1|  tubby-like F-box protein 8                         151   1e-38   
ref|XP_008237579.1|  PREDICTED: tubby-like F-box protein 8              151   1e-38   
ref|XP_002307367.2|  tubby-like protein 2                               150   1e-38   
emb|CDY17085.1|  BnaC06g00180D                                          150   1e-38   
dbj|BAJ88633.1|  predicted protein                                      147   1e-38   
gb|ACL52815.1|  unknown                                                 145   1e-38   
ref|XP_006363440.1|  PREDICTED: tubby-like F-box protein 5-like         150   1e-38   
ref|XP_004237815.1|  PREDICTED: tubby-like F-box protein 5              150   1e-38   
ref|XP_007201025.1|  hypothetical protein PRUPE_ppa006121mg             150   1e-38   
ref|XP_009629482.1|  PREDICTED: tubby-like F-box protein 8 isofor...    150   1e-38   
ref|XP_008365270.1|  PREDICTED: tubby-like F-box protein 8              150   1e-38   
ref|XP_009629484.1|  PREDICTED: tubby-like F-box protein 8 isofor...    149   1e-38   
dbj|BAA82866.1|  tubby-like protein                                     150   1e-38   
ref|XP_009336161.1|  PREDICTED: tubby-like F-box protein 5              150   1e-38   
ref|XP_009129663.1|  PREDICTED: tubby-like F-box protein 9              149   1e-38   
ref|XP_010108639.1|  Tubby-like F-box protein 8                         151   1e-38   
ref|XP_009771188.1|  PREDICTED: LOW QUALITY PROTEIN: tubby-like F...    150   2e-38   
ref|XP_009803929.1|  PREDICTED: tubby-like F-box protein 5              150   2e-38   
ref|XP_006339926.1|  PREDICTED: tubby-like F-box protein 8-like i...    150   2e-38   
tpg|DAA36762.1|  TPA: hypothetical protein ZEAMMB73_526243              147   2e-38   
ref|XP_007152022.1|  hypothetical protein PHAVU_004G095000g             150   2e-38   
ref|XP_004287069.1|  PREDICTED: tubby-like F-box protein 8              150   2e-38   
ref|XP_009610594.1|  PREDICTED: tubby-like F-box protein 5              149   2e-38   
ref|XP_009390188.1|  PREDICTED: tubby-like F-box protein 5              149   2e-38   
ref|XP_006588484.1|  PREDICTED: uncharacterized protein LOC100810...    150   3e-38   
emb|CAN68201.1|  hypothetical protein VITISV_003183                     151   3e-38   
ref|XP_009419406.1|  PREDICTED: tubby-like F-box protein 8 isofor...    147   3e-38   
gb|AEW07569.1|  hypothetical protein 0_5297_02                          142   3e-38   
gb|KJB32749.1|  hypothetical protein B456_005G259600                    149   3e-38   
ref|NP_001066230.1|  Os12g0163400                                       150   3e-38   
gb|EAY82366.1|  hypothetical protein OsI_37578                          150   3e-38   
gb|EYU18525.1|  hypothetical protein MIMGU_mgv1a006446mg                150   3e-38   
gb|KHG17863.1|  Tubby-like F-box protein 6                              149   3e-38   
dbj|BAH19883.1|  AT1G25280                                              147   3e-38   
ref|XP_009800903.1|  PREDICTED: tubby-like F-box protein 8              149   4e-38   
ref|XP_006351828.1|  PREDICTED: tubby-like F-box protein 8-like         149   4e-38   
ref|XP_009604537.1|  PREDICTED: tubby-like F-box protein 14             149   4e-38   
gb|KJB58253.1|  hypothetical protein B456_009G201100                    149   4e-38   
gb|KJB59796.1|  hypothetical protein B456_009G272900                    149   4e-38   
ref|XP_009364972.1|  PREDICTED: tubby-like F-box protein 5              149   4e-38   
gb|KJB58254.1|  hypothetical protein B456_009G201100                    149   4e-38   
ref|XP_010499129.1|  PREDICTED: tubby-like F-box protein 10             149   4e-38   
ref|XP_007041585.1|  Tubby like protein 10 isoform 1                    149   5e-38   
ref|XP_010911991.1|  PREDICTED: tubby-like F-box protein 8 isofor...    149   5e-38   
ref|XP_011092391.1|  PREDICTED: tubby-like F-box protein 8              149   5e-38   
ref|XP_008785830.1|  PREDICTED: tubby-like F-box protein 8              149   5e-38   
ref|XP_003568372.1|  PREDICTED: tubby-like F-box protein 8              149   6e-38   
gb|EMS62143.1|  Tubby-like F-box protein 14                             149   6e-38   
ref|XP_002893958.1|  hypothetical protein ARALYDRAFT_473770             149   6e-38   
gb|ACF82203.1|  unknown                                                 144   6e-38   
ref|XP_011087815.1|  PREDICTED: tubby-like F-box protein 8              149   6e-38   
ref|XP_010531933.1|  PREDICTED: tubby-like F-box protein 10             149   6e-38   
ref|XP_004230571.1|  PREDICTED: tubby-like F-box protein 8              149   7e-38   
gb|EYU17436.1|  hypothetical protein MIMGU_mgv1a007105mg                148   7e-38   
gb|KJB59798.1|  hypothetical protein B456_009G272900                    149   7e-38   
gb|EMT26507.1|  hypothetical protein F775_27998                         149   8e-38   
ref|XP_009393408.1|  PREDICTED: tubby-like F-box protein 8              149   8e-38   
ref|XP_007143538.1|  hypothetical protein PHAVU_007G079900g             149   8e-38   
gb|ABR18042.1|  unknown                                                 148   8e-38   
ref|XP_010539730.1|  PREDICTED: tubby-like F-box protein 1              149   8e-38   
ref|NP_001055656.1|  Os05g0437900                                       149   8e-38   



>ref|XP_009587286.1| PREDICTED: tubby-like F-box protein 3 [Nicotiana tomentosiformis]
Length=396

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+PVNIDSF + PFFRSKS RMDNF SGPL +QKDE+L+LKNKAP WHEQLQCWC
Sbjct  265  PTQTEFVPVNIDSFPSLPFFRSKSTRMDNFPSGPLPSQKDEVLSLKNKAPRWHEQLQCWC  324

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS GDG   EHENV+LQFGKVG+DVFTMDYQYPISAFQAFAI
Sbjct  325  LNFNGRVTVASVKNFQLVASQGDGAGQEHENVVLQFGKVGEDVFTMDYQYPISAFQAFAI  384

Query  432  CLSSFDTKIACE  397
            CLSSFDTKIACE
Sbjct  385  CLSSFDTKIACE  396



>ref|XP_009796557.1| PREDICTED: tubby-like F-box protein 3 [Nicotiana sylvestris]
Length=396

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+PVNIDSF + PFFRSKS RMDNF SGPL +QKDE+L+LKNKAP WHEQLQCWC
Sbjct  265  PTQTEFVPVNIDSFPSLPFFRSKSTRMDNFPSGPLPSQKDEVLSLKNKAPRWHEQLQCWC  324

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS GDG   EHENV+LQFGKVG+DVFTMDYQYPISAFQAFAI
Sbjct  325  LNFNGRVTVASVKNFQLVASRGDGAGQEHENVVLQFGKVGEDVFTMDYQYPISAFQAFAI  384

Query  432  CLSSFDTKIACE  397
            CLSSFDTKIACE
Sbjct  385  CLSSFDTKIACE  396



>ref|XP_004247460.1| PREDICTED: tubby-like F-box protein 3 [Solanum lycopersicum]
 ref|XP_010326607.1| PREDICTED: tubby-like F-box protein 3 [Solanum lycopersicum]
Length=396

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+PVN+DSF +  FFRSKS R+DNF SGPL + KDE+LTLKNKAP WHEQLQCWC
Sbjct  265  PTQTEFVPVNVDSFPSLHFFRSKSTRVDNFSSGPLPSPKDEVLTLKNKAPRWHEQLQCWC  324

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS+GDG   E+ENVILQFGKVG+D+FTMDYQYPISAFQAFAI
Sbjct  325  LNFNGRVTVASVKNFQLVASLGDGAGQENENVILQFGKVGEDLFTMDYQYPISAFQAFAI  384

Query  432  CLSSFDTKIACE  397
            CLSSFDTKIACE
Sbjct  385  CLSSFDTKIACE  396



>ref|XP_006359433.1| PREDICTED: tubby-like F-box protein 3-like [Solanum tuberosum]
Length=396

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+PVN+DSF +  FFRSKS R+DNF SGPL + KDE+LTLKNKAP WHEQLQCWC
Sbjct  265  PTQTEFVPVNVDSFPSLHFFRSKSTRVDNFSSGPLPSPKDEVLTLKNKAPRWHEQLQCWC  324

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS+GDG   E+ENVILQFGKVG+D+FTMDYQYPISAFQAFAI
Sbjct  325  LNFNGRVTVASVKNFQLVASLGDGAGQENENVILQFGKVGEDLFTMDYQYPISAFQAFAI  384

Query  432  CLSSFDTKIACE  397
            CLSSFDTKIACE
Sbjct  385  CLSSFDTKIACE  396



>ref|XP_002269323.1| PREDICTED: tubby-like F-box protein 3 [Vitis vinifera]
Length=405

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+  N+DSF +FPFFRSKSNR ++  SGPLS  KDE+L LKNKAP WHEQLQCWC
Sbjct  273  PTQTEFVLSNVDSFPSFPFFRSKSNRTESLHSGPLSGPKDEMLVLKNKAPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  333  LNFNGRVTVASVKNFQLVASAENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  393  ICLSSFDTKIACE  405



>ref|XP_011082500.1| PREDICTED: tubby-like F-box protein 3 [Sesamum indicum]
Length=406

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FLP N DSF + PFFRSKS R D+F+SGPL   KDE+L LKNKAP WHEQLQCWC
Sbjct  274  PTQTEFLPGNFDSFPSLPFFRSKSTRTDSFRSGPLLTPKDEMLVLKNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASM-GDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS+  +    E ENVILQFGKVGKD+FTMDYQYPISAFQAFA
Sbjct  334  LNFNGRVTVASVKNFQLVASLENEAGGQEQENVILQFGKVGKDIFTMDYQYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|XP_007050787.1| Tubby like protein 3 isoform 2 [Theobroma cacao]
 gb|EOX94944.1| Tubby like protein 3 isoform 2 [Theobroma cacao]
Length=402

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N+D+F + PFFRSKS R ++FQ GPLS QKD +L L+NKAP WHEQLQCWC
Sbjct  270  PTQTEFLHSNLDTFPSLPFFRSKSTRTESFQLGPLSGQKDGMLVLRNKAPRWHEQLQCWC  329

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +G    EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  330  LNFNGRVTVASVKNFQLVASPENGATGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  389

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  390  VCLSSFDTKIACE  402



>ref|XP_007050786.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
 ref|XP_007050788.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
 gb|EOX94943.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
 gb|EOX94945.1| Tubby like protein 3 isoform 1 [Theobroma cacao]
Length=405

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N+D+F + PFFRSKS R ++FQ GPLS QKD +L L+NKAP WHEQLQCWC
Sbjct  273  PTQTEFLHSNLDTFPSLPFFRSKSTRTESFQLGPLSGQKDGMLVLRNKAPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +G    EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  333  LNFNGRVTVASVKNFQLVASPENGATGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  393  VCLSSFDTKIACE  405



>gb|KDP28083.1| hypothetical protein JCGZ_13854 [Jatropha curcas]
Length=406

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N+DSF + PFFRSKS   +NFQSGPL+  KD +L L+NKAP WHEQLQCWC
Sbjct  274  PTQTEFLHSNLDSFPSLPFFRSKSTCTENFQSGPLTGYKDGMLVLRNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +GV   EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  334  LNFNGRVTVASVKNFQLVASPENGVGRQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|XP_010545046.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545047.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Tarenaya hassleriana]
Length=406

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  N+D+F +FPFFRSKS R D+  SGP  AQ++ +L LKNKAP WHEQLQCWC
Sbjct  274  PTQTELLHGNVDNFPSFPFFRSKSTRSDSLPSGPSPAQREGVLILKNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVAS+KNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  334  LNFNGRVTVASIKNFQLVATPENGPARPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|XP_010545048.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Tarenaya hassleriana]
Length=405

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  N+D+F +FPFFRSKS R D+  SGP  AQ++ +L LKNKAP WHEQLQCWC
Sbjct  273  PTQTELLHGNVDNFPSFPFFRSKSTRSDSLPSGPSPAQREGVLILKNKAPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVAS+KNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  333  LNFNGRVTVASIKNFQLVATPENGPARPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  393  ICLSSFDTKIACE  405



>gb|KDO75058.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
 gb|KDO75059.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
Length=229

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRSKSNR + F SGPL+ QKD  L L+NKAP WHEQLQCWC
Sbjct  97   PTQTEFLFSNADSFPSIPFFRSKSNRSEKFLSGPLACQKDGALVLRNKAPRWHEQLQCWC  156

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP-EHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A  EHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  157  LNFHGRVTVASVKNFQLVASPENGPAGLEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  216

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  217  ICLSSFDTKIACE  229



>gb|KHN47289.1| Tubby-like F-box protein 6, partial [Glycine soja]
Length=320

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   NID F +FPFFRSKSNR++N  SGPL  QKD +L LKNKAP WHEQLQCWC
Sbjct  188  PTQTEFSLNNIDMFPSFPFFRSKSNRVENSVSGPLVDQKDGMLVLKNKAPRWHEQLQCWC  247

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +G A PEH+ +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  248  LNFHGRVTIASVKNFQLVASAENGPAGPEHDKIILQFGKVGKDLFTMDYRYPISAFQAFA  307

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  308  ICLSSFDTKIACE  320



>gb|KDO75060.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
Length=237

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRSKSNR + F SGPL+ QKD  L L+NKAP WHEQLQCWC
Sbjct  105  PTQTEFLFSNADSFPSIPFFRSKSNRSEKFLSGPLACQKDGALVLRNKAPRWHEQLQCWC  164

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP-EHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A  EHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  165  LNFHGRVTVASVKNFQLVASPENGPAGLEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  224

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  225  ICLSSFDTKIACE  237



>gb|KJB41989.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
 gb|KJB41992.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
Length=405

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N+D+F +  FFRSKS R ++FQSGPLS QKD +L L+NK+P WHEQLQCWC
Sbjct  273  PTQTEFLHSNLDAFPSLLFFRSKSTRAESFQSGPLSDQKDGMLVLRNKSPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +  A  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  333  LNFNGRVTVASVKNFQLVASPENAAAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  393  ICLSSFDTKIACE  405



>ref|XP_003542914.1| PREDICTED: tubby-like F-box protein 3-like [Glycine max]
Length=389

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   NID F +FPFFRSKSNR +N  SGPL  QKD +L LKNKAP WHEQLQCWC
Sbjct  257  PTQTEFSLNNIDMFPSFPFFRSKSNRAENSMSGPLVDQKDGMLVLKNKAPRWHEQLQCWC  316

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +G A PEH+ +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  317  LNFHGRVTIASVKNFQLVASAENGPAGPEHDKIILQFGKVGKDLFTMDYRYPISAFQAFA  376

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  377  ICLSSFDTKIACE  389



>emb|CAJ91134.1| tubby protein [Platanus x acerifolia]
Length=222

 Score =   209 bits (531),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDN-FQSGPLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T     N DSF   PFFRSKS R +N  Q GPL +QKD +L LKNKAP WHEQLQCW
Sbjct  89   PTQTELPLSNADSFPLLPFFRSKSTRTENHLQPGPLVSQKDGVLVLKNKAPRWHEQLQCW  148

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF GRVTVASVKNFQLVAS G+G A  EHE VILQFGKVGKD+FTMDYQYPISAFQAF
Sbjct  149  CLNFRGRVTVASVKNFQLVASPGNGPAGQEHEEVILQFGKVGKDLFTMDYQYPISAFQAF  208

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  209  AICLSSFDTKIACE  222



>ref|XP_011471001.1| PREDICTED: tubby-like F-box protein 3 [Fragaria vesca subsp. 
vesca]
Length=404

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+  N+DS  + PFFRSKS R ++ QSG  S Q + +L L+NKAP WHEQLQCWC
Sbjct  271  PTQTEFVASNLDSIPSLPFFRSKSGRGESVQSGLQSGQNEGMLVLRNKAPRWHEQLQCWC  330

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA--PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            LNFNGRVTVASVKNFQLVAS  +GVA  PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  331  LNFNGRVTVASVKNFQLVASPENGVAAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  390

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  391  AICLSSFDTKIACE  404



>ref|XP_006419672.1| hypothetical protein CICLE_v10005517mg [Citrus clementina]
 gb|ESR32912.1| hypothetical protein CICLE_v10005517mg [Citrus clementina]
 gb|KDO75056.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
 gb|KDO75057.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
Length=301

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRSKSNR + F SGPL+ QKD  L L+NKAP WHEQLQCWC
Sbjct  169  PTQTEFLFSNADSFPSIPFFRSKSNRSEKFLSGPLACQKDGALVLRNKAPRWHEQLQCWC  228

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP-EHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A  EHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  229  LNFHGRVTVASVKNFQLVASPENGPAGLEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  288

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  289  ICLSSFDTKIACE  301



>ref|XP_007147863.1| hypothetical protein PHAVU_006G161100g [Phaseolus vulgaris]
 gb|ESW19857.1| hypothetical protein PHAVU_006G161100g [Phaseolus vulgaris]
Length=383

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   NID F +FPFFRSKSNR++N  SGPL  Q+D +L LKNKAP WHEQLQCWC
Sbjct  251  PTQTEFSLNNIDMFPSFPFFRSKSNRVENSMSGPLVDQRDGMLVLKNKAPRWHEQLQCWC  310

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +G A PEH+ +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  311  LNFHGRVTIASVKNFQLVASAENGPAGPEHDKIILQFGKVGKDLFTMDYRYPISAFQAFA  370

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  371  MCLSSFDTKIACE  383



>gb|KHF99338.1| Tubby-like F-box protein 3 [Gossypium arboreum]
Length=405

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N+D+F +  FFRSKS R ++FQSGPLS QKD +L L+NK+P WHEQLQCWC
Sbjct  273  PTQTEFLHSNLDTFPSLLFFRSKSTRSESFQSGPLSDQKDGMLVLRNKSPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +  A  EHENVILQFGKVGKDVFT+DYQYPISAFQAFA
Sbjct  333  LNFNGRVTVASVKNFQLVASPENAAAGQEHENVILQFGKVGKDVFTVDYQYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  393  ICLSSFDTKIACE  405



>gb|KCW58547.1| hypothetical protein EUGRSUZ_H01209 [Eucalyptus grandis]
Length=352

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSG-PLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T F+   +D+F +F FFRSKS R++N +SG P+SA KD +L LKNK+P WHEQLQCW
Sbjct  219  PTQTEFVSSTLDTFPSFSFFRSKSTRVENLESGRPMSAPKDGMLVLKNKSPRWHEQLQCW  278

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF+GRVTVASVKNFQLVAS   GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQ+F
Sbjct  279  CLNFHGRVTVASVKNFQLVASPEQGVAGTEHENVILQFGKVGKDVFTMDYQYPISAFQSF  338

Query  438  AICLSSFDTKIACE  397
            AICLSSFDT+IACE
Sbjct  339  AICLSSFDTRIACE  352



>ref|XP_006419673.1| hypothetical protein CICLE_v10005517mg [Citrus clementina]
 ref|XP_006419674.1| hypothetical protein CICLE_v10005517mg [Citrus clementina]
 ref|XP_006489161.1| PREDICTED: tubby-like F-box protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006489162.1| PREDICTED: tubby-like F-box protein 3-like isoform X2 [Citrus 
sinensis]
 gb|ESR32913.1| hypothetical protein CICLE_v10005517mg [Citrus clementina]
 gb|ESR32914.1| hypothetical protein CICLE_v10005517mg [Citrus clementina]
 gb|KDO75050.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
 gb|KDO75051.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
 gb|KDO75052.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
Length=389

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRSKSNR + F SGPL+ QKD  L L+NKAP WHEQLQCWC
Sbjct  257  PTQTEFLFSNADSFPSIPFFRSKSNRSEKFLSGPLACQKDGALVLRNKAPRWHEQLQCWC  316

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP-EHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A  EHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  317  LNFHGRVTVASVKNFQLVASPENGPAGLEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  376

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  377  ICLSSFDTKIACE  389



>ref|XP_010069992.1| PREDICTED: tubby-like F-box protein 3 [Eucalyptus grandis]
 ref|XP_010069993.1| PREDICTED: tubby-like F-box protein 3 [Eucalyptus grandis]
 gb|KCW58545.1| hypothetical protein EUGRSUZ_H01209 [Eucalyptus grandis]
 gb|KCW58546.1| hypothetical protein EUGRSUZ_H01209 [Eucalyptus grandis]
Length=351

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSG-PLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T F+   +D+F +F FFRSKS R++N +SG P+SA KD +L LKNK+P WHEQLQCW
Sbjct  218  PTQTEFVSSTLDTFPSFSFFRSKSTRVENLESGRPMSAPKDGMLVLKNKSPRWHEQLQCW  277

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF+GRVTVASVKNFQLVAS   GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQ+F
Sbjct  278  CLNFHGRVTVASVKNFQLVASPEQGVAGTEHENVILQFGKVGKDVFTMDYQYPISAFQSF  337

Query  438  AICLSSFDTKIACE  397
            AICLSSFDT+IACE
Sbjct  338  AICLSSFDTRIACE  351



>gb|KDO75053.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
Length=387

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRSKSNR + F SGPL+ QKD  L L+NKAP WHEQLQCWC
Sbjct  255  PTQTEFLFSNADSFPSIPFFRSKSNRSEKFLSGPLACQKDGALVLRNKAPRWHEQLQCWC  314

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP-EHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A  EHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  315  LNFHGRVTVASVKNFQLVASPENGPAGLEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  374

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  375  ICLSSFDTKIACE  387



>gb|KDO75054.1| hypothetical protein CISIN_1g0164722mg [Citrus sinensis]
Length=386

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRSKSNR + F SGPL+ QKD  L L+NKAP WHEQLQCWC
Sbjct  254  PTQTEFLFSNADSFPSIPFFRSKSNRSEKFLSGPLACQKDGALVLRNKAPRWHEQLQCWC  313

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP-EHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A  EHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  314  LNFHGRVTVASVKNFQLVASPENGPAGLEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  373

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  374  ICLSSFDTKIACE  386



>gb|KDO87397.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
Length=244

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 5/133 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F    +DSF + PFFRSKS R +NFQ+     QK+ +L L+NKAP WHEQLQCWC
Sbjct  116  PTQTEFHHSGLDSFPSIPFFRSKSIRAENFQND----QKEGLLVLRNKAPRWHEQLQCWC  171

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS+ +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  172  LNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  231

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  232  ICLSSFDTKIACE  244



>ref|XP_010245367.1| PREDICTED: tubby-like F-box protein 3 [Nelumbo nucifera]
Length=405

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   NIDSF + PFFRSKS R +NFQSGPL+  K+  L LKNKAP WHEQLQCWC
Sbjct  273  PTQTEFPLSNIDSFPSLPFFRSKSARTENFQSGPLATPKEGSLVLKNKAPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS  +G A  EHE V+LQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  333  LNFRGRVTVASVKNFQLVASPENGPAGQEHEKVLLQFGKVGKDLFTMDYRYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  393  ICLSSFDTKIACE  405



>gb|KDO87396.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
Length=292

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 5/133 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F    +DSF + PFFRSKS R +NFQ+     QK+ +L L+NKAP WHEQLQCWC
Sbjct  164  PTQTEFHHSGLDSFPSIPFFRSKSIRAENFQND----QKEGLLVLRNKAPRWHEQLQCWC  219

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS+ +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  220  LNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  279

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  280  ICLSSFDTKIACE  292



>ref|XP_006380027.1| putative Tub family protein [Populus trichocarpa]
 gb|ERP57824.1| putative Tub family protein [Populus trichocarpa]
Length=392

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   N+D   + PFFRSKSNR+++FQSG LS+Q++  L LKNKAP WHEQLQCWC
Sbjct  260  PTQTEFSHHNVDFLPSLPFFRSKSNRVESFQSGSLSSQREGALVLKNKAPRWHEQLQCWC  319

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLV S  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  320  LNFHGRVTVASVKNFQLVVSPENGPAGPEHENIILQFGKVGKDLFTMDYRYPISAFQAFA  379

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  380  LCLSSFDTKIACE  392



>ref|XP_010523995.1| PREDICTED: tubby-like F-box protein 3 [Tarenaya hassleriana]
Length=403

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 114/134 (85%), Gaps = 5/134 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSF-STFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+D+F S+FPFFRSKS R++ F   P  AQKD +L LKNKAP WHEQLQCW
Sbjct  273  PTQTELLHSNVDNFPSSFPFFRSKSTRLEGF---PSPAQKDGLLVLKNKAPRWHEQLQCW  329

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRV+VASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  330  CLNFNGRVSVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  389

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  390  AICLSSFDTKIACE  403



>gb|ABK94895.1| unknown [Populus trichocarpa]
Length=392

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   N+D   + PFFRSKS+R+++FQSG LS+Q++  L LKNKAP WHEQLQCWC
Sbjct  260  PTQTEFSHHNVDFLPSLPFFRSKSSRVESFQSGSLSSQRERALVLKNKAPRWHEQLQCWC  319

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLV S  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  320  LNFHGRVTVASVKNFQLVVSPENGPAGPEHENIILQFGKVGKDLFTMDYRYPISAFQAFA  379

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  380  LCLSSFDTKIACE  392



>ref|XP_009352325.1| PREDICTED: tubby-like F-box protein 3, partial [Pyrus x bretschneideri]
Length=325

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N + F + PFFRSKSNR+++F SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  193  PTQAEFSHNNAELFPSLPFFRSKSNRVESFLSGPLARQKDGVLVLRNKSPRWHEQLQCWC  252

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  253  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFS  312

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  313  ICLSSFDTKIACE  325



>ref|XP_009346672.1| PREDICTED: tubby-like F-box protein 3, partial [Pyrus x bretschneideri]
Length=322

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N + F + PFFRSKSNR+++F SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  190  PTQAEFSHNNAELFPSLPFFRSKSNRVESFLSGPLARQKDGVLVLRNKSPRWHEQLQCWC  249

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  250  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFS  309

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  310  ICLSSFDTKIACE  322



>ref|XP_004486066.1| PREDICTED: tubby-like F-box protein 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004486067.1| PREDICTED: tubby-like F-box protein 3-like isoform X2 [Cicer 
arietinum]
 ref|XP_004486068.1| PREDICTED: tubby-like F-box protein 3-like isoform X3 [Cicer 
arietinum]
Length=392

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   ++D F  FPFFRSKSNR+D   SGPL  QKD  L LKNKAP WHEQLQCWC
Sbjct  260  PTQTEFSFNSVDMFPLFPFFRSKSNRVDKSLSGPLGDQKDGKLVLKNKAPRWHEQLQCWC  319

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEH+ +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  320  LNFHGRVTVASVKNFQLVASAENGPAGPEHDKIILQFGKVGKDLFTMDYRYPISAFQAFA  379

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  380  ICLSSFDTKIACE  392



>gb|KHN33114.1| Tubby-like F-box protein 6, partial [Glycine soja]
Length=324

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T F   NID F +FPFFRSKSNR++N  SGPL  QKD +L LKNKAP WHEQLQCWC
Sbjct  192  PVQTEFSLNNIDMFPSFPFFRSKSNRVENSVSGPLVDQKDGMLVLKNKAPRWHEQLQCWC  251

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +  A PEH+ +ILQFGKVGKD+FTMDY++PISAFQAFA
Sbjct  252  LNFHGRVTIASVKNFQLVASAENRPAGPEHDKIILQFGKVGKDLFTMDYRFPISAFQAFA  311

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  312  ICLSSFDTKIACE  324



>gb|KHN46381.1| Tubby-like F-box protein 3 [Glycine soja]
Length=291

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL   ID+  + PFFRSKS RMDN  + PL+ Q +  L L+NK+P WHE LQCWC
Sbjct  159  PTQTQFLHSRIDTSPSIPFFRSKSTRMDNLPTVPLTCQNEGTLVLRNKSPRWHEHLQCWC  218

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +GV+ +  ENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  219  LNFNGRVTVASVKNFQLVASPKNGVSEQAQENVILQFGKVGKDVFTMDYQYPISAFQAFA  278

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  279  ICLSSFDTKIACE  291



>ref|XP_010105019.1| hypothetical protein L484_008460 [Morus notabilis]
 gb|EXC03128.1| hypothetical protein L484_008460 [Morus notabilis]
Length=382

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T F   N DSFS+  F RSKS RM+NF SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  250  PKQTEFSIGNPDSFSSLSFPRSKSTRMENFVSGPLAIQKDRVLVLRNKSPRWHEQLQCWC  309

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMD++YPISAFQAFA
Sbjct  310  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDFRYPISAFQAFA  369

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  370  ICLSSFDTKIACE  382



>ref|XP_009346673.1| PREDICTED: tubby-like F-box protein 3 [Pyrus x bretschneideri]
Length=377

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N + F + PFFRSKSNR+++F SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  245  PTQAEFSHNNAELFPSLPFFRSKSNRVESFLSGPLARQKDGVLVLRNKSPRWHEQLQCWC  304

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  305  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFS  364

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  365  ICLSSFDTKIACE  377



>ref|XP_002516864.1| phosphoric diester hydrolase, putative [Ricinus communis]
 gb|EEF45478.1| phosphoric diester hydrolase, putative [Ricinus communis]
Length=390

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   ++D   + PFFRSKSN ++NF SGPLS+QKD  L LKNK+P WHEQLQCWC
Sbjct  258  PTQTEFAHHSVDILPSLPFFRSKSNCVENFLSGPLSSQKDGALILKNKSPRWHEQLQCWC  317

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G   PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  318  LNFHGRVTVASVKNFQLVASPENGPPGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  377

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  378  ICLSSFDTKIACE  390



>ref|XP_008234991.1| PREDICTED: tubby-like F-box protein 3 [Prunus mume]
Length=401

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 111/134 (83%), Gaps = 6/134 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRS S RM+NF+SG    +   +L L+NKAP WHEQLQCWC
Sbjct  272  PTQTEFLHSNPDSFPSLPFFRSTSTRMENFESG----ENGGMLVLRNKAPRWHEQLQCWC  327

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP--EHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            LNFNGRVTVASVKNFQLVAS  +GVA   EHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  328  LNFNGRVTVASVKNFQLVASPENGVAAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAF  387

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  388  AICLSSFDTKIACE  401



>ref|XP_009378902.1| PREDICTED: tubby-like F-box protein 3 [Pyrus x bretschneideri]
Length=401

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N+DSF + PFFRS S R +NF S   S + + +L L+NKAP WHEQLQCWC
Sbjct  269  PTQTEFLHSNLDSFPSVPFFRSTSTRTENFLSPLESGENEGMLALRNKAPRWHEQLQCWC  328

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLV+S  +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  329  LNFNGRVTVASVKNFQLVSSSENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  388

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  389  ICLSSFDTKIACE  401



>ref|XP_007199898.1| hypothetical protein PRUPE_ppa006662mg [Prunus persica]
 gb|EMJ01097.1| hypothetical protein PRUPE_ppa006662mg [Prunus persica]
Length=401

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 111/134 (83%), Gaps = 6/134 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  N DSF + PFFRS S RM+NF+SG    +   +L L+NKAP WHEQLQCWC
Sbjct  272  PTQTEFLHSNPDSFPSLPFFRSTSTRMENFESG----ENGGMLVLRNKAPRWHEQLQCWC  327

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP--EHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            LNFNGRVTVASVKNFQLVAS  +GVA   EHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  328  LNFNGRVTVASVKNFQLVASPENGVAAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAF  387

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  388  AICLSSFDTKIACE  401



>gb|EYU46657.1| hypothetical protein MIMGU_mgv1a007454mg [Erythranthe guttata]
Length=407

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  N+DSF +  FFRSKS+R D+ + G LS +K+E+L LKNKAP WHEQLQCWC
Sbjct  274  PTQTRLLSGNLDSFPSISFFRSKSSRADSLRLGNLSTEKEEMLVLKNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASMGD--GVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            LNFNGRVTVASVKNFQLVAS+ +  G   + ENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  LNFNGRVTVASVKNFQLVASVENEGGGQEQQENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  394  AICLSSFDTKIACE  407



>ref|XP_011034217.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Populus euphratica]
 ref|XP_011034219.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Populus euphratica]
 ref|XP_011034220.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Populus euphratica]
 ref|XP_011034221.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Populus euphratica]
 ref|XP_011034222.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Populus euphratica]
Length=393

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   ++D   + PFFRSKSNR+++F+SG LS+Q++  L LKNKAP WHEQLQCWC
Sbjct  261  PTQTEFSHHSVDFLPSLPFFRSKSNRVESFRSGSLSSQREGALVLKNKAPRWHEQLQCWC  320

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLV S  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  321  LNFHGRVTVASVKNFQLVVSPENGPAGPEHENIILQFGKVGKDLFTMDYRYPISAFQAFA  380

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  381  LCLSSFDTKIACE  393



>ref|XP_011034223.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Populus euphratica]
Length=392

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   ++D   + PFFRSKSNR+++F+SG LS+Q++  L LKNKAP WHEQLQCWC
Sbjct  260  PTQTEFSHHSVDFLPSLPFFRSKSNRVESFRSGSLSSQREGALVLKNKAPRWHEQLQCWC  319

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLV S  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  320  LNFHGRVTVASVKNFQLVVSPENGPAGPEHENIILQFGKVGKDLFTMDYRYPISAFQAFA  379

Query  435  ICLSSFDTKIACE  397
            +CLSSFDTKIACE
Sbjct  380  LCLSSFDTKIACE  392



>ref|XP_003546101.1| PREDICTED: tubby-like F-box protein 3-like [Glycine max]
Length=385

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T F   NID F +FPFFRSKSNR++N  SGPL  QKD +L LKNKAP WHEQLQCWC
Sbjct  253  PVQTEFSLNNIDMFPSFPFFRSKSNRVENSVSGPLVDQKDGMLVLKNKAPRWHEQLQCWC  312

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +  A PEH+ +ILQFGKVGKD+FTMDY++PISAFQAFA
Sbjct  313  LNFHGRVTIASVKNFQLVASAENRPAGPEHDKIILQFGKVGKDLFTMDYRFPISAFQAFA  372

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  373  ICLSSFDTKIACE  385



>ref|XP_010921732.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010921733.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Elaeis guineensis]
Length=406

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FLP ++DSF + PFFRSKS+R +N  SGP S+QK+  L LKNKAP WHEQLQCWC
Sbjct  275  PTPTEFLPSSLDSFPSIPFFRSKSSRSENL-SGPFSSQKEGKLVLKNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS  +G A  EH+ VILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  334  LNFRGRVTVASVKNFQLVASEENGPAGQEHDKVILQFGKVGKDLFTMDYRYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|XP_002882136.1| hypothetical protein ARALYDRAFT_322431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58395.1| hypothetical protein ARALYDRAFT_322431 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  +  N+++F +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  274  PTQTELIHSNLENFPSFSFFRSKSIRAESLSSGPASAAQKEGLLVLKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  394  TICLSSFDTKIACE  407



>gb|KDO87393.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
Length=398

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 5/133 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F    +DSF + PFFRSKS R +NFQ+     QK+ +L L+NKAP WHEQLQCWC
Sbjct  270  PTQTEFHHSGLDSFPSIPFFRSKSIRAENFQND----QKEGLLVLRNKAPRWHEQLQCWC  325

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS+ +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  326  LNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  385

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  386  ICLSSFDTKIACE  398



>ref|XP_006444230.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 ref|XP_006444231.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 gb|ESR57470.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 gb|ESR57471.1| hypothetical protein CICLE_v10020468mg [Citrus clementina]
 gb|KDO87394.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
 gb|KDO87395.1| hypothetical protein CISIN_1g015792mg [Citrus sinensis]
Length=400

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 5/133 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F    +DSF + PFFRSKS R +NFQ+     QK+ +L L+NKAP WHEQLQCWC
Sbjct  272  PTQTEFHHSGLDSFPSIPFFRSKSIRAENFQND----QKEGLLVLRNKAPRWHEQLQCWC  327

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS+ +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  328  LNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  387

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  388  ICLSSFDTKIACE  400



>ref|XP_006479875.1| PREDICTED: tubby-like F-box protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006479876.1| PREDICTED: tubby-like F-box protein 3-like isoform X2 [Citrus 
sinensis]
Length=400

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 112/133 (84%), Gaps = 5/133 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F    +DSF + PFFRSKS R +NFQ+     QK+ +L L+NKAP WHEQLQCWC
Sbjct  272  PTQTEFHHSGLDSFPSIPFFRSKSIRAENFQND----QKEGLLVLRNKAPRWHEQLQCWC  327

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS+ +GVA  EHENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  328  LNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  387

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  388  ICLSSFDTKIACE  400



>gb|KFK37542.1| hypothetical protein AALP_AA4G270500 [Arabis alpina]
Length=408

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGP-LSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T  +  N+D+F +F FFRSKS R ++  SGP  +AQK+ +L LKNKAP WHEQLQCW
Sbjct  275  PTQTELVHSNLDNFPSFSFFRSKSIRTESLPSGPSAAAQKEGLLVLKNKAPRWHEQLQCW  334

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  335  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  394

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  395  TICLSSFDTKIACE  408



>ref|NP_001280806.1| tubby-like F-box protein 3 [Malus domestica]
 gb|ADL36841.1| TLP domain class transcription factor [Malus domestica]
Length=401

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+  N DSF + PFFRSKS R +NF S   S + + +L L+NKAP WHEQLQCWC
Sbjct  269  PTQTEFMHSNTDSFPSVPFFRSKSTRTENFPSPLESGENEGMLVLRNKAPRWHEQLQCWC  328

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLV+S  +GVA  EHENVILQFGKVGKDVFTMDY+YPISAFQAFA
Sbjct  329  LNFNGRVTVASVKNFQLVSSPENGVAGQEHENVILQFGKVGKDVFTMDYRYPISAFQAFA  388

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  389  ICLSSFDTKIACE  401



>ref|XP_011009467.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Populus euphratica]
Length=301

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSN---RMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQ  622
            PT T F   + D F +  FFRSKSN   R+++FQSGPL +Q++  L L+NKAP WHEQLQ
Sbjct  166  PTQTEFYHHSADFFPSLLFFRSKSNHVERVESFQSGPLCSQREGALVLRNKAPRWHEQLQ  225

Query  621  CWCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQ  445
            CWCLNF+GRVTVASVKNFQLVAS  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQ
Sbjct  226  CWCLNFHGRVTVASVKNFQLVASQENGPARPEHENIILQFGKVGKDLFTMDYRYPISAFQ  285

Query  444  AFAICLSSFDTKIACE  397
            AFAICLSSFDTKIACE
Sbjct  286  AFAICLSSFDTKIACE  301



>ref|XP_002314408.1| putative Tub family protein [Populus trichocarpa]
 gb|EEF00579.1| putative Tub family protein [Populus trichocarpa]
Length=395

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMD---NFQSGPLSAQKDEILTLKNKAPGWHEQLQ  622
            PT T F   + D F +  FFRSKSNR++   +FQSGPLS+Q++  L L+NKAP WHEQLQ
Sbjct  260  PTQTEFYHHSADFFPSLLFFRSKSNRVERVESFQSGPLSSQREGALVLRNKAPRWHEQLQ  319

Query  621  CWCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQ  445
            CWCLNF+GRVTVASVKNFQLVAS  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQ
Sbjct  320  CWCLNFHGRVTVASVKNFQLVASQENGPAGPEHENIILQFGKVGKDLFTMDYRYPISAFQ  379

Query  444  AFAICLSSFDTKIACE  397
            AFAICLSSFDTKIACE
Sbjct  380  AFAICLSSFDTKIACE  395



>ref|XP_010241159.1| PREDICTED: tubby-like F-box protein 3 [Nelumbo nucifera]
Length=405

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   N+DSF + PFFRSKS R + F SGPL+  K+  L LKNKAP WHEQLQCWC
Sbjct  273  PTQTEFPLSNVDSFPSLPFFRSKSTRTETFHSGPLTNPKEGSLVLKNKAPRWHEQLQCWC  332

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVA+  +G A  EHE V+LQFGKVGKD+FTMDYQYPISAFQAFA
Sbjct  333  LNFRGRVTVASVKNFQLVAAPENGSAGQEHEKVLLQFGKVGKDLFTMDYQYPISAFQAFA  392

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  393  ICLSSFDTKIACE  405



>ref|XP_007035473.1| Tubby like protein 3 isoform 2, partial [Theobroma cacao]
 ref|XP_007035475.1| Tubby like protein 3 isoform 2, partial [Theobroma cacao]
 gb|EOY06399.1| Tubby like protein 3 isoform 2, partial [Theobroma cacao]
 gb|EOY06401.1| Tubby like protein 3 isoform 2, partial [Theobroma cacao]
Length=297

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F    +D F + P F SKS  M+NF SGPLS QKD  L L+NKAP WHEQLQCWC
Sbjct  165  PTQAEFSFSKVDLFPSIPIFHSKSAGMENFLSGPLSGQKDGALVLRNKAPRWHEQLQCWC  224

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  225  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  284

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  285  ICLSSFDTKIACE  297



>emb|CDP03548.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSN-RMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T FLP   DSF + PFFRSKS+ R D F + P+S  KD++L LKNKAP WHEQLQCW
Sbjct  274  PTQTEFLPGVSDSFPSLPFFRSKSSSRTDIFHARPMSTDKDDMLALKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGV-APEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVAS+  GV   E ++VILQFGKVGKDVFTMDY+YPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVASVDSGVGGQEQDDVILQFGKVGKDVFTMDYKYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  394  AICLSSFDTKIACE  407



>ref|XP_006574455.1| PREDICTED: uncharacterized protein LOC100809257 isoform X1 [Glycine 
max]
Length=400

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL   ID+  + PFFRSKS RMDN  + PL+ Q +  L L+NK+P WHE LQCWC
Sbjct  268  PTQTQFLHSRIDTSPSIPFFRSKSTRMDNLPTVPLTCQNEGTLVLRNKSPRWHEHLQCWC  327

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +GV+ +  ENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  328  LNFNGRVTVASVKNFQLVASPKNGVSEQAQENVILQFGKVGKDVFTMDYQYPISAFQAFA  387

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  388  ICLSSFDTKIACE  400



>gb|KHN46594.1| Tubby-like F-box protein 3 [Glycine soja]
Length=400

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL   ID+  + PFFRSKS RMDN  + PL+ Q +  L L+NK+P WHE LQCWC
Sbjct  268  PTQTQFLHSRIDTSPSIPFFRSKSTRMDNLPTVPLTCQNEGTLVLRNKSPRWHEHLQCWC  327

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +GV+ +  ENVILQFGKVGKDVFTMDYQYPISAFQAFA
Sbjct  328  LNFNGRVTVASVKNFQLVASPKNGVSEQAQENVILQFGKVGKDVFTMDYQYPISAFQAFA  387

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  388  ICLSSFDTKIACE  400



>ref|XP_010696418.1| PREDICTED: tubby-like F-box protein 3 [Beta vulgaris subsp. vulgaris]
Length=393

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F+  ++DSF +  FFRSKS R+DN +S  +  QK+ IL L+NKAP WHEQLQCWC
Sbjct  264  PTQTEFVINSVDSFPSISFFRSKSIRVDNCRSEIVPTQKEGILVLRNKAPRWHEQLQCWC  323

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS+ DG   EH++VILQFGKVGKDVFTMDYQYPISAFQAFAI
Sbjct  324  LNFNGRVTVASVKNFQLVASLEDG--SEHDSVILQFGKVGKDVFTMDYQYPISAFQAFAI  381

Query  432  CLSSFDTKIACE  397
            CLSSFDTKIACE
Sbjct  382  CLSSFDTKIACE  393



>ref|XP_011009466.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Populus euphratica]
Length=395

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSN---RMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQ  622
            PT T F   + D F +  FFRSKSN   R+++FQSGPL +Q++  L L+NKAP WHEQLQ
Sbjct  260  PTQTEFYHHSADFFPSLLFFRSKSNHVERVESFQSGPLCSQREGALVLRNKAPRWHEQLQ  319

Query  621  CWCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQ  445
            CWCLNF+GRVTVASVKNFQLVAS  +G A PEHEN+ILQFGKVGKD+FTMDY+YPISAFQ
Sbjct  320  CWCLNFHGRVTVASVKNFQLVASQENGPARPEHENIILQFGKVGKDLFTMDYRYPISAFQ  379

Query  444  AFAICLSSFDTKIACE  397
            AFAICLSSFDTKIACE
Sbjct  380  AFAICLSSFDTKIACE  395



>ref|XP_008390740.1| PREDICTED: tubby-like F-box protein 3 [Malus domestica]
Length=392

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = -2

Query  789  TXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCL  610
            T   F   N + F + PFFRSKSNR+++F SGPL+  KD +L L+NK+P WHEQLQCWCL
Sbjct  261  TQAEFSHNNAELFPSLPFFRSKSNRVESFLSGPLARXKDGVLVLRNKSPRWHEQLQCWCL  320

Query  609  NFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            NF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF+I
Sbjct  321  NFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFSI  380

Query  432  CLSSFDTKIACE  397
            CLSSFDTKIACE
Sbjct  381  CLSSFDTKIACE  392



>ref|XP_007035474.1| Tubby like protein 3 isoform 3 [Theobroma cacao]
 gb|EOY06400.1| Tubby like protein 3 isoform 3 [Theobroma cacao]
Length=385

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F    +D F + P F SKS  M+NF SGPLS QKD  L L+NKAP WHEQLQCWC
Sbjct  253  PTQAEFSFSKVDLFPSIPIFHSKSAGMENFLSGPLSGQKDGALVLRNKAPRWHEQLQCWC  312

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  313  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  372

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  373  ICLSSFDTKIACE  385



>gb|AFK43062.1| unknown [Lotus japonicus]
Length=402

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL   ID+  + PFFRSKS RM+N  S P + Q + +L LKNK+P WHEQLQCWC
Sbjct  270  PTQTQFLHSRIDASPSIPFFRSKSTRMENLPSVPSTCQNEGMLVLKNKSPRWHEQLQCWC  329

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVAS  +GV+ +  ENV+LQFGKVGKDVFTMDYQYPISAF+AFA
Sbjct  330  LNFNGRVTVASVKNFQLVASPRNGVSEQAQENVVLQFGKVGKDVFTMDYQYPISAFEAFA  389

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  390  ICLSSFDTKIACE  402



>gb|KEH36706.1| tubby-F-box-like protein [Medicago truncatula]
Length=294

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRM-DNFQSGPLSA-QKDEILTLKNKAPGWHEQLQC  619
            PT T F   NI+ F  FPFFRSKSNR+ +N  SGPL   +KD +L LKNKAP WHEQLQC
Sbjct  160  PTQTEFSLNNIEMFPLFPFFRSKSNRVVENSLSGPLVGDKKDGMLVLKNKAPRWHEQLQC  219

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF+GRVT+ASVKNFQLVAS  +G A PEH+ +ILQFGKVGKD+FTMD++YPISAFQA
Sbjct  220  WCLNFHGRVTIASVKNFQLVASAENGTAGPEHDKIILQFGKVGKDLFTMDFRYPISAFQA  279

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  280  FAICLSSFDTKIACE  294



>ref|XP_007035472.1| Tubby-like F-box protein 3 isoform 1 [Theobroma cacao]
 gb|EOY06398.1| Tubby-like F-box protein 3 isoform 1 [Theobroma cacao]
Length=397

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F    +D F + P F SKS  M+NF SGPLS QKD  L L+NKAP WHEQLQCWC
Sbjct  265  PTQAEFSFSKVDLFPSIPIFHSKSAGMENFLSGPLSGQKDGALVLRNKAPRWHEQLQCWC  324

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  325  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  384

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  385  ICLSSFDTKIACE  397



>ref|XP_008812305.1| PREDICTED: tubby-like F-box protein 11 isoform X2 [Phoenix dactylifera]
Length=346

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  ++DSF + PFF+SKS R +N  SGPLS QK+  L LKNKAP WHEQLQCWC
Sbjct  215  PTPTEFLLSSLDSFPSIPFFKSKSFRSENL-SGPLSGQKEGKLVLKNKAPRWHEQLQCWC  273

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS  +G A  EH+ VILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  274  LNFRGRVTVASVKNFQLVASEENGPAGQEHDKVILQFGKVGKDLFTMDYRYPISAFQAFA  333

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  334  ICLSSFDTKIACE  346



>ref|XP_009624999.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Nicotiana tomentosiformis]
Length=389

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N DS     F RSKSNRM+   SGPL  Q++  L LKNKAP WHEQLQCWC
Sbjct  257  PTQVDFPMGNSDSSLPLRFLRSKSNRMEKSLSGPLETQREGSLVLKNKAPRWHEQLQCWC  316

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +GVA PEHE VILQFGKVGKDVFTMDY+YP+SAFQAFA
Sbjct  317  LNFHGRVTVASVKNFQLVASPENGVAGPEHEKVILQFGKVGKDVFTMDYRYPLSAFQAFA  376

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  377  ICLSSFDTKIACE  389



>ref|XP_008386616.1| PREDICTED: tubby-like F-box protein 3 [Malus domestica]
Length=402

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  ++DSF + PF RS S R +NF S   S + + +L L+NKAP WHEQLQCWC
Sbjct  269  PTQTEFLHGSLDSFPSIPFSRSTSTRTENFSSPLESGENEGMLVLRNKAPRWHEQLQCWC  328

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP--EHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            LNFNGRVTVASVKNFQLVAS  +GVA   EHENVILQFGKVGKDVFTMDY+YPISAFQAF
Sbjct  329  LNFNGRVTVASVKNFQLVASPENGVAAGQEHENVILQFGKVGKDVFTMDYRYPISAFQAF  388

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  389  AICLSSFDTKIACE  402



>ref|XP_009624993.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Nicotiana tomentosiformis]
Length=390

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N DS     F RSKSNRM+   SGPL  Q++  L LKNKAP WHEQLQCWC
Sbjct  258  PTQVDFPMGNSDSSLPLRFLRSKSNRMEKSLSGPLETQREGSLVLKNKAPRWHEQLQCWC  317

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +GVA PEHE VILQFGKVGKDVFTMDY+YP+SAFQAFA
Sbjct  318  LNFHGRVTVASVKNFQLVASPENGVAGPEHEKVILQFGKVGKDVFTMDYRYPLSAFQAFA  377

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  378  ICLSSFDTKIACE  390



>gb|KEH43261.1| tubby-F-box-like protein [Medicago truncatula]
Length=402

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSG-PLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T FL    D+  + PFFRSKS R +N QS  PL +Q D  L LKNKAP WHEQLQCW
Sbjct  269  PTQTQFLHSRADTSPSIPFFRSKSTRSENLQSAAPLISQNDGELVLKNKAPRWHEQLQCW  328

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVAS  +GV+ E  ENVILQFGKVGKDVFTMDYQYPISAF+AF
Sbjct  329  CLNFNGRVTVASVKNFQLVASPKNGVSEEAQENVILQFGKVGKDVFTMDYQYPISAFEAF  388

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  389  AICLSSFDTKIACE  402



>ref|XP_006397986.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
 gb|ESQ39439.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
Length=403

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 4/133 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  ++D+F +F FFRSKS R ++    P +AQK+ +L LKNKAP WHEQLQCWC
Sbjct  274  PTQTELLHSSLDNFPSFSFFRSKSIRSESL---PSTAQKEGLLVLKNKAPRWHEQLQCWC  330

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF 
Sbjct  331  LNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAFT  390

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  391  ICLSSFDTKIACE  403



>ref|XP_006397985.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
 gb|ESQ39438.1| hypothetical protein EUTSA_v10001474mg [Eutrema salsugineum]
Length=402

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 4/133 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  ++D+F +F FFRSKS R ++    P +AQK+ +L LKNKAP WHEQLQCWC
Sbjct  273  PTQTELLHSSLDNFPSFSFFRSKSIRSESL---PSTAQKEGLLVLKNKAPRWHEQLQCWC  329

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF 
Sbjct  330  LNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAFT  389

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  390  ICLSSFDTKIACE  402



>gb|KJB23182.1| hypothetical protein B456_004G085800 [Gossypium raimondii]
Length=397

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T FL  N+D+F + PFFRSKS R  + Q GPLS+ +D +L LKNKAP WHEQLQCWC
Sbjct  264  PMQTEFLHSNLDTFPSLPFFRSKSTRTKSSQFGPLSSLRDGMLVLKNKAPRWHEQLQCWC  323

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA--PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            LNFNGRVTVASVKNFQLVA   + V    + ENVILQFGKVG DVFTMDYQYPISAFQAF
Sbjct  324  LNFNGRVTVASVKNFQLVAFAKNVVVRQEQQENVILQFGKVGNDVFTMDYQYPISAFQAF  383

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  384  AICLSSFDTKIACE  397



>ref|XP_010024560.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Eucalyptus 
grandis]
 gb|KCW61011.1| hypothetical protein EUGRSUZ_H03766 [Eucalyptus grandis]
Length=401

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     +++ F + PFFR+KSNR+++  SGPL +QKD  L L+NKAP WHEQLQCWC
Sbjct  269  PTQTELPLSSVEFFPSLPFFRTKSNRVESVSSGPLGSQKDGALVLRNKAPRWHEQLQCWC  328

Query  612  LNFNGRVTVASVKNFQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS   +   P+HE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  329  LNFHGRVTVASVKNFQLVASPENEPAGPQHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  388

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  389  ICLSSFDTKIACE  401



>ref|XP_009369102.1| PREDICTED: tubby-like F-box protein 3 [Pyrus x bretschneideri]
Length=392

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N + F +  F RSKSNRM++F SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  260  PTQAEFSHSNAELFPSLSFNRSKSNRMESFLSGPLARQKDGVLVLRNKSPRWHEQLQCWC  319

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G   PEHE +ILQFGKVGKD FTMDY+YPISAFQAF+
Sbjct  320  LNFHGRVTVASVKNFQLVASPENGPPGPEHEKIILQFGKVGKDQFTMDYRYPISAFQAFS  379

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  380  ICLSSFDTKIACE  392



>ref|XP_008812302.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Phoenix dactylifera]
 ref|XP_008812303.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Phoenix dactylifera]
Length=406

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  ++DSF + PFF+SKS R +N  SGPLS QK+  L LKNKAP WHEQLQCWC
Sbjct  275  PTPTEFLLSSLDSFPSIPFFKSKSFRSENL-SGPLSGQKEGKLVLKNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS  +G A  EH+ VILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  334  LNFRGRVTVASVKNFQLVASEENGPAGQEHDKVILQFGKVGKDLFTMDYRYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|NP_001280765.1| tubby-like F-box protein 3 [Malus domestica]
 ref|XP_008340846.1| PREDICTED: tubby-like F-box protein 3 [Malus domestica]
 gb|ADL36845.1| TLP domain class transcription factor [Malus domestica]
Length=392

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N + F +  F RSKSNRM++F SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  260  PTQAEFSHSNAELFPSLSFNRSKSNRMESFLSGPLARQKDGVLVLRNKSPRWHEQLQCWC  319

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G   PEHE +ILQFGKVGKD FTMDY+YPISAFQAF+
Sbjct  320  LNFHGRVTVASVKNFQLVASPENGPPGPEHEKIILQFGKVGKDQFTMDYRYPISAFQAFS  379

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  380  ICLSSFDTKIACE  392



>ref|XP_004495994.1| PREDICTED: tubby-like F-box protein 3-like [Cicer arietinum]
Length=401

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLS-AQKDEILTLKNKAPGWHEQLQCW  616
            PT T FL   ID+  + PFFRSKS R +N Q  P S +Q D +L L+NKAP WHEQLQCW
Sbjct  268  PTQTRFLHSRIDTSPSIPFFRSKSTRTENLQPVPSSPSQNDGMLVLRNKAPRWHEQLQCW  327

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVAS  +GV+ +  ENVILQFGKVGKDVFTMDYQYPISAF+AF
Sbjct  328  CLNFNGRVTVASVKNFQLVASPKNGVSEQAQENVILQFGKVGKDVFTMDYQYPISAFEAF  387

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  388  AICLSSFDTKIACE  401



>ref|XP_011090855.1| PREDICTED: tubby-like F-box protein 6 [Sesamum indicum]
Length=396

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   ++DS  T PFFR+KSN +D   SGPL  Q    L L+NK+P WHEQLQCWC
Sbjct  264  PTQTYFPITSVDSSPTLPFFRTKSNCLDKSFSGPLCNQGGSSLVLRNKSPRWHEQLQCWC  323

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G+A PEH+ VILQFGKVGKDVFTMDY+YPISAFQAFA
Sbjct  324  LNFHGRVTVASVKNFQLVASPENGIAGPEHDKVILQFGKVGKDVFTMDYRYPISAFQAFA  383

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  384  ICLSSFDTKIACE  396



>ref|XP_009118192.1| PREDICTED: tubby-like F-box protein 3 [Brassica rapa]
Length=402

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  +  N+D F +F FFRSKS R ++    P  AQKD +L LKNKAP WHEQLQCWC
Sbjct  273  PTQTELVHSNLDMFPSFSFFRSKSVRSESL---PQPAQKDGLLVLKNKAPRWHEQLQCWC  329

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMD+QYPISAFQAF 
Sbjct  330  LNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDFQYPISAFQAFT  389

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  390  ICLSSFDTKIACE  402



>ref|XP_003594006.1| Tubby-like F-box protein [Medicago truncatula]
 gb|AES64257.1| tubby-F-box-like protein [Medicago truncatula]
Length=393

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 3/135 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRM-DNFQSGPLSA-QKDEILTLKNKAPGWHEQLQC  619
            PT T F   NI+ F  FPFFRSKSNR+ +N  SGPL   +KD +L LKNKAP WHEQLQC
Sbjct  259  PTQTEFSLNNIEMFPLFPFFRSKSNRVVENSLSGPLVGDKKDGMLVLKNKAPRWHEQLQC  318

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF+GRVT+ASVKNFQLVAS  +G A PEH+ +ILQFGKVGKD+FTMD++YPISAFQA
Sbjct  319  WCLNFHGRVTIASVKNFQLVASAENGTAGPEHDKIILQFGKVGKDLFTMDFRYPISAFQA  378

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  379  FAICLSSFDTKIACE  393



>ref|XP_010541816.1| PREDICTED: tubby-like F-box protein 3, partial [Tarenaya hassleriana]
Length=149

 Score =   193 bits (490),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 13/132 (10%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  N++SF + P FRSKS R ++F S       DE+L LKNKAP WHEQLQCWC
Sbjct  31   PTQTELLHSNVESFPSIPSFRSKSTRSESFPS-------DELLVLKNKAPRWHEQLQCWC  83

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS      PE+E+VILQFGKVGKDVFTMDYQYPISAFQAFAI
Sbjct  84   LNFNGRVTVASVKNFQLVAS------PENESVILQFGKVGKDVFTMDYQYPISAFQAFAI  137

Query  432  CLSSFDTKIACE  397
            CLSSFDTK+ACE
Sbjct  138  CLSSFDTKLACE  149



>ref|XP_009792510.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Nicotiana sylvestris]
Length=390

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P    F   N DS     F RSKSNRM+   SGPL  Q++  L LKNKAP WHEQLQCWC
Sbjct  258  PIQVDFPMGNSDSSLPLRFLRSKSNRMEKSLSGPLETQREGSLVLKNKAPRWHEQLQCWC  317

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +GVA PEHE VILQFGKVGKDVFTMDY+YP+SAFQAFA
Sbjct  318  LNFHGRVTVASVKNFQLVASPENGVAGPEHEKVILQFGKVGKDVFTMDYRYPLSAFQAFA  377

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  378  ICLSSFDTKIACE  390



>ref|XP_009792511.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Nicotiana sylvestris]
Length=389

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P    F   N DS     F RSKSNRM+   SGPL  Q++  L LKNKAP WHEQLQCWC
Sbjct  257  PIQVDFPMGNSDSSLPLRFLRSKSNRMEKSLSGPLETQREGSLVLKNKAPRWHEQLQCWC  316

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +GVA PEHE VILQFGKVGKDVFTMDY+YP+SAFQAFA
Sbjct  317  LNFHGRVTVASVKNFQLVASPENGVAGPEHEKVILQFGKVGKDVFTMDYRYPLSAFQAFA  376

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  377  ICLSSFDTKIACE  389



>emb|CDY55525.1| BnaA04g29500D [Brassica napus]
Length=402

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 108/133 (81%), Gaps = 4/133 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  +  N+D F +F FFRSKS R ++    P  AQ D +L LKNKAP WHEQLQCWC
Sbjct  273  PTQTELVHTNLDMFPSFSFFRSKSVRSESL---PQPAQNDGLLVLKNKAPRWHEQLQCWC  329

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMD+QYPISAFQAF 
Sbjct  330  LNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDFQYPISAFQAFT  389

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  390  ICLSSFDTKIACE  402



>emb|CDY27467.1| BnaC04g51080D [Brassica napus]
Length=397

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  +  N+D F +F FFRSKS R ++    P  AQK+ +L LKNKAP WHEQLQCWC
Sbjct  268  PTQTELVHSNLDMFPSFSFFRSKSVRSESL---PQPAQKEGLLVLKNKAPRWHEQLQCWC  324

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMD+QYPISAFQAF 
Sbjct  325  LNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDFQYPISAFQAFT  384

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  385  ICLSSFDTKIACE  397



>gb|EMS68726.1| hypothetical protein TRIUR3_30361 [Triticum urartu]
Length=308

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   N+DSF + PFFRSKS R+D   S P  AQ  E L LKNK+P WHEQLQC
Sbjct  177  KAPTQTEFPLGNLDSFPSIPFFRSKSARID---SAPAQAQDKEKLVLKNKSPRWHEQLQC  233

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G A  EH+ VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  234  WCLNFRGRVTVASVKNFQLVASDENGAAGQEHDKVILQFGKIGKDLFTMDYRYPISAFQS  293

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  294  FAICLSSFDTKIACE  308



>dbj|BAJ95298.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 4/135 (3%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   N+DSF + PFFRSKS R+D   S P  AQ +E L LKNK+P WHEQLQC
Sbjct  269  KAPTQTEFPLSNLDSFPSIPFFRSKSARID---SAPAQAQDEEKLVLKNKSPRWHEQLQC  325

Query  618  WCLNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G V+ EH+ VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  326  WCLNFRGRVTVASVKNFQLVASDDNGPVSQEHDKVILQFGKIGKDLFTMDYRYPISAFQS  385

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  386  FAICLSSFDTKIACE  400



>emb|CBI26117.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     N D F +F FFRSKS+ ++N  S PL+ +KD  L LKNKAP WHEQLQCWC
Sbjct  218  PTQTEIRLSNPDVFPSFSFFRSKSHSVENSLSEPLADKKDGALVLKNKAPRWHEQLQCWC  277

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  DG A  +HE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  278  LNFHGRVTVASVKNFQLVASPEDGPAGQQHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  337

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  338  ICLSSFDTKIACE  350



>ref|XP_008438799.1| PREDICTED: tubby-like F-box protein 3 [Cucumis melo]
 ref|XP_008438800.1| PREDICTED: tubby-like F-box protein 3 [Cucumis melo]
Length=387

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T F P  ID   +  F  SKSN  DN  SG  + QKD +L L+NKAP WHEQLQCWC
Sbjct  255  PIQTEFSPSRIDFLPSLRFSWSKSNHTDNQPSGSSTNQKDGVLVLRNKAPRWHEQLQCWC  314

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +GVA PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  315  LNFHGRVTIASVKNFQLVASPENGVAGPEHEKIILQFGKVGKDIFTMDYRYPISAFQAFA  374

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  375  ICLSSFDTKIACE  387



>gb|KDP40026.1| hypothetical protein JCGZ_02024 [Jatropha curcas]
Length=388

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   ++DSF +FPFF SKSNR +NF SGPLS+QKD  L LKNK+P WHEQLQCWC
Sbjct  256  PTQTEFSHHSLDSFPSFPFFSSKSNRAENFLSGPLSSQKDGALILKNKSPRWHEQLQCWC  315

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  316  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  375

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  376  ICLSSFDTKIACE  388



>ref|XP_004134184.1| PREDICTED: tubby-like F-box protein 3-like [Cucumis sativus]
 ref|XP_004159828.1| PREDICTED: tubby-like F-box protein 3-like [Cucumis sativus]
Length=387

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T F P  ID   +  F  SKSN  DN  SG  + QKD +L L+NKAP WHEQLQCWC
Sbjct  255  PIQTEFSPSRIDFLPSLRFSWSKSNHADNQPSGSSTNQKDGVLVLRNKAPRWHEQLQCWC  314

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +GVA PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  315  LNFHGRVTIASVKNFQLVASPENGVAGPEHEKIILQFGKVGKDIFTMDYRYPISAFQAFA  374

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  375  ICLSSFDTKIACE  387



>ref|XP_008223151.1| PREDICTED: tubby-like F-box protein 3 [Prunus mume]
Length=357

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N +   + PFFRSKSN ++   SGPL++QK  +L L+NK+P WHEQLQCWC
Sbjct  226  PTQADFSYSNAEFLPSLPFFRSKSNHVERI-SGPLASQKSGVLVLRNKSPRWHEQLQCWC  284

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  285  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFS  344

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  345  ICLSSFDTKIACE  357



>ref|XP_002276906.1| PREDICTED: tubby-like F-box protein 3 [Vitis vinifera]
 ref|XP_010649787.1| PREDICTED: tubby-like F-box protein 3 [Vitis vinifera]
Length=374

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     N D F +F FFRSKS+ ++N  S PL+ +KD  L LKNKAP WHEQLQCWC
Sbjct  242  PTQTEIRLSNPDVFPSFSFFRSKSHSVENSLSEPLADKKDGALVLKNKAPRWHEQLQCWC  301

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  DG A  +HE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  302  LNFHGRVTVASVKNFQLVASPEDGPAGQQHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  361

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  362  ICLSSFDTKIACE  374



>ref|XP_010024559.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW61010.1| hypothetical protein EUGRSUZ_H03766 [Eucalyptus grandis]
Length=402

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     +++ F + PFFR+KSNR+++  SGPL +QKD  L L+NKAP WHEQLQCWC
Sbjct  269  PTQTELPLSSVEFFPSLPFFRTKSNRVESVSSGPLGSQKDGALVLRNKAPRWHEQLQCWC  328

Query  612  LNFNGRVTVASVKNFQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS   +   P+HE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  329  LNFHGRVTVASVKNFQLVASPENEPAGPQHEKIILQFGKVGKDLFTMDYRYPISAFQAFA  388

Query  435  ICLSSFDTKIA  403
            ICLSSFDTKIA
Sbjct  389  ICLSSFDTKIA  399



>gb|KGN57066.1| hypothetical protein Csa_3G151430 [Cucumis sativus]
Length=457

 Score =   197 bits (501),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P  T F P  ID   +  F  SKSN  DN  SG  + QKD +L L+NKAP WHEQLQCWC
Sbjct  325  PIQTEFSPSRIDFLPSLRFSWSKSNHADNQPSGSSTNQKDGVLVLRNKAPRWHEQLQCWC  384

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS  +GVA PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  385  LNFHGRVTIASVKNFQLVASPENGVAGPEHEKIILQFGKVGKDIFTMDYRYPISAFQAFA  444

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  445  ICLSSFDTKIACE  457



>ref|XP_007223049.1| hypothetical protein PRUPE_ppa006943mg [Prunus persica]
 gb|EMJ24248.1| hypothetical protein PRUPE_ppa006943mg [Prunus persica]
Length=389

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N +   + PFFRSKSN ++   SGPL++QK  +L L+NK+P WHEQLQCWC
Sbjct  258  PTQADFSYGNAEFLPSLPFFRSKSNHVERI-SGPLASQKSGVLVLRNKSPRWHEQLQCWC  316

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  317  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFS  376

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  377  ICLSSFDTKIACE  389



>gb|EMT28122.1| hypothetical protein F775_52580 [Aegilops tauschii]
Length=404

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 4/135 (3%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   N+DSF + PFFRSKS R+D   S P  AQ +E L LKNK+P WHEQLQC
Sbjct  273  KAPTQTEFPLGNLDSFPSIPFFRSKSARID---SAPAQAQDEEKLVLKNKSPRWHEQLQC  329

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G A  EH+ VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  330  WCLNFRGRVTVASVKNFQLVASDENGAAGQEHDMVILQFGKIGKDLFTMDYRYPISAFQS  389

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  390  FAICLSSFDTKIACE  404



>ref|XP_009405579.1| PREDICTED: tubby-like F-box protein 6 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  ++DSF + PFFRSKS R  +  SG +S  K+E+L LKNKAP WHEQLQCWC
Sbjct  215  PTQTEFLHNSLDSFPSVPFFRSKSYRTGSL-SGSVSGLKEEMLVLKNKAPRWHEQLQCWC  273

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS  +G +  E E VILQFGKVGKD+FTMDY YPISAFQAFA
Sbjct  274  LNFRGRVTVASVKNFQLVASEENGSSNQEEEKVILQFGKVGKDLFTMDYCYPISAFQAFA  333

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  334  ICLSSFDTKIACE  346



>ref|XP_010552822.1| PREDICTED: tubby-like F-box protein 3 [Tarenaya hassleriana]
Length=339

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 13/132 (10%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T  L  N++SF + P FRSKS R ++F S       DE+L LKNKAP WHEQLQCWC
Sbjct  221  PTQTELLHSNVESFPSIPSFRSKSTRSESFPS-------DELLVLKNKAPRWHEQLQCWC  273

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            LNFNGRVTVASVKNFQLVAS      PE+E+VILQFGKVGKDVFTMDYQYPISAFQAFAI
Sbjct  274  LNFNGRVTVASVKNFQLVAS------PENESVILQFGKVGKDVFTMDYQYPISAFQAFAI  327

Query  432  CLSSFDTKIACE  397
            CLSSFDTK+ACE
Sbjct  328  CLSSFDTKLACE  339



>gb|KJB34618.1| hypothetical protein B456_006G075400 [Gossypium raimondii]
Length=393

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDE-ILTLKNKAPGWHEQLQCW  616
            PT   F   N++ F + P F SKS  M NF SGPL+ QKD   L L+NK+P WHEQLQCW
Sbjct  260  PTPAEFSVNNVNVFPSIPSFHSKSASMKNFLSGPLTHQKDGGALVLRNKSPRWHEQLQCW  319

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF+GRVTVASVKNFQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY YPISAFQAF
Sbjct  320  CLNFHGRVTVASVKNFQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYGYPISAFQAF  379

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  380  AICLSSFDTKIACE  393



>ref|XP_003557885.1| PREDICTED: tubby-like F-box protein 6 [Brachypodium distachyon]
 ref|XP_010228625.1| PREDICTED: tubby-like F-box protein 6 [Brachypodium distachyon]
Length=404

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   N+DSF + PFFRSKS R+D+  S  L  Q +E L LKNK+P WHEQLQC
Sbjct  271  KAPTQTEFPRSNLDSFPSIPFFRSKSARIDSTAS-QLPTQMEEKLVLKNKSPRWHEQLQC  329

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G A  EH+ VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  330  WCLNFRGRVTVASVKNFQLVASDDNGPANQEHDKVILQFGKIGKDLFTMDYRYPISAFQS  389

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  390  FAICLSSFDTKIACE  404



>dbj|BAH20382.1| AT2G47900 [Arabidopsis thaliana]
Length=226

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  +  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  93   PTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCW  152

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  153  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  212

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  213  TICLSSFDTKIACE  226



>ref|XP_009405557.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405565.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405571.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T FL  ++DSF + PFFRSKS R  +  SG +S  K+E+L LKNKAP WHEQLQCWC
Sbjct  275  PTQTEFLHNSLDSFPSVPFFRSKSYRTGSL-SGSVSGLKEEMLVLKNKAPRWHEQLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS  +G +  E E VILQFGKVGKD+FTMDY YPISAFQAFA
Sbjct  334  LNFRGRVTVASVKNFQLVASEENGSSNQEEEKVILQFGKVGKDLFTMDYCYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|XP_011462689.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=395

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P    F     + F + PFFRSKS RM++F  GP +  KD ++ L+NKAP WHEQLQCWC
Sbjct  264  PMQAEFSSSTAEFFPSLPFFRSKSTRMESFL-GPSAKPKDGVIVLRNKAPRWHEQLQCWC  322

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE ++LQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  323  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIVLQFGKVGKDLFTMDYRYPISAFQAFS  382

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  383  ICLSSFDTKIACE  395



>ref|XP_004296792.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=390

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P    F     + F + PFFRSKS RM++F  GP +  KD ++ L+NKAP WHEQLQCWC
Sbjct  259  PMQAEFSSSTAEFFPSLPFFRSKSTRMESFL-GPSAKPKDGVIVLRNKAPRWHEQLQCWC  317

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE ++LQFGKVGKD+FTMDY+YPISAFQAF+
Sbjct  318  LNFHGRVTVASVKNFQLVASPENGPAGPEHEKIVLQFGKVGKDLFTMDYRYPISAFQAFS  377

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  378  ICLSSFDTKIACE  390



>gb|KHG15242.1| Tubby-like F-box protein 3 [Gossypium arboreum]
Length=393

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDE-ILTLKNKAPGWHEQLQCW  616
            PT   F   N++ F + P F SKS  M NF SGPL  QKD   L L+NK+P WHEQLQCW
Sbjct  260  PTPAEFSVNNVNVFPSIPSFHSKSASMKNFLSGPLPHQKDGGALVLRNKSPRWHEQLQCW  319

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF+GRVTVASVKNFQLV S  +G A PEHE +ILQFGKVGKD+FTMDY+YPISAFQAF
Sbjct  320  CLNFHGRVTVASVKNFQLVVSPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAF  379

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  380  AICLSSFDTKIACE  393



>ref|XP_010321048.1| PREDICTED: tubby-like F-box protein 6 isoform X1 [Solanum lycopersicum]
Length=388

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N  S     F RSKS+R++   SGP+  Q++  L LKNKAP WHEQLQCWC
Sbjct  256  PTQVDFPMGNSGSSLPMRFLRSKSSRLEKSLSGPIETQREGSLVLKNKAPRWHEQLQCWC  315

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE VILQFGKVGKD+FTMDY+YP+SAFQAFA
Sbjct  316  LNFHGRVTVASVKNFQLVASPENGAAGPEHEKVILQFGKVGKDMFTMDYRYPLSAFQAFA  375

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  376  ICLSSFDTKIACE  388



>ref|XP_004229196.1| PREDICTED: tubby-like F-box protein 6 isoform X2 [Solanum lycopersicum]
Length=387

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N  S     F RSKS+R++   SGP+  Q++  L LKNKAP WHEQLQCWC
Sbjct  255  PTQVDFPMGNSGSSLPMRFLRSKSSRLEKSLSGPIETQREGSLVLKNKAPRWHEQLQCWC  314

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE VILQFGKVGKD+FTMDY+YP+SAFQAFA
Sbjct  315  LNFHGRVTVASVKNFQLVASPENGAAGPEHEKVILQFGKVGKDMFTMDYRYPLSAFQAFA  374

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  375  ICLSSFDTKIACE  387



>gb|ABF95934.1| Tubby protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF95935.1| Tubby protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG95520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=231

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F    +DSF +  FFRSKS R+D+  S  LS QK+E L LKNK+P WHEQLQC
Sbjct  98   KAPTQTEFPLSGLDSFPSISFFRSKSARIDSATS-QLSTQKEEKLVLKNKSPRWHEQLQC  156

Query  618  WCLNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E + VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  157  WCLNFRGRVTVASVKNFQLVASDENGPTNQEQDKVILQFGKIGKDLFTMDYRYPISAFQS  216

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  217  FAICLSSFDTKIACE  231



>ref|XP_006342737.1| PREDICTED: tubby-like F-box protein 6-like isoform X1 [Solanum 
tuberosum]
Length=388

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N  S     F RSKS+R++   SGP+  Q++  L LKNKAP WHEQLQCWC
Sbjct  256  PTQVDFPMDNSGSSLPMRFLRSKSSRLEKSLSGPIETQREGSLVLKNKAPRWHEQLQCWC  315

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE VILQFGKVGKD+FTMDY+YP+SAFQAFA
Sbjct  316  LNFHGRVTVASVKNFQLVASPENGAAGPEHEKVILQFGKVGKDMFTMDYRYPLSAFQAFA  375

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  376  ICLSSFDTKIACE  388



>ref|XP_006342738.1| PREDICTED: tubby-like F-box protein 6-like isoform X2 [Solanum 
tuberosum]
Length=387

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N  S     F RSKS+R++   SGP+  Q++  L LKNKAP WHEQLQCWC
Sbjct  255  PTQVDFPMDNSGSSLPMRFLRSKSSRLEKSLSGPIETQREGSLVLKNKAPRWHEQLQCWC  314

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS  +G A PEHE VILQFGKVGKD+FTMDY+YP+SAFQAFA
Sbjct  315  LNFHGRVTVASVKNFQLVASPENGAAGPEHEKVILQFGKVGKDMFTMDYRYPLSAFQAFA  374

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  375  ICLSSFDTKIACE  387



>ref|XP_008458493.1| PREDICTED: tubby-like F-box protein 3 [Cucumis melo]
Length=386

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     N++ F +FPF RSKSN  D+  S PL +QKD +L L+NK P WHEQLQCWC
Sbjct  255  PTPTELSLSNVELFPSFPFLRSKSN-ADSLLSEPLGSQKDGMLVLRNKTPRWHEQLQCWC  313

Query  612  LNFNGRVTVASVKNFQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS   D    E+E +ILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  314  LNFHGRVTIASVKNFQLVASPENDPPTAENEKIILQFGKVGKDLFTMDYRYPISAFQAFA  373

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  374  ICLSSFDTKIACE  386



>ref|NP_001050117.1| Os03g0351400 [Oryza sativa Japonica Group]
 dbj|BAF12031.1| Os03g0351400, partial [Oryza sativa Japonica Group]
Length=296

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F    +DSF +  FFRSKS R+D+  S  LS QK+E L LKNK+P WHEQLQC
Sbjct  163  KAPTQTEFPLSGLDSFPSISFFRSKSARIDSATS-QLSTQKEEKLVLKNKSPRWHEQLQC  221

Query  618  WCLNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E + VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  222  WCLNFRGRVTVASVKNFQLVASDENGPTNQEQDKVILQFGKIGKDLFTMDYRYPISAFQS  281

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  282  FAICLSSFDTKIACE  296



>gb|AAL66203.1|AF386521_1 putative Tub family protein [Pyrus communis]
Length=219

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   F   N + F +  F RSKSNRM++F SGPL+ QKD +L L+NK+P WHEQLQCWC
Sbjct  88   PTQAEFSHNNAELFPSLSFNRSKSNRMESFLSGPLARQKDGVLVLRNKSPRWHEQLQCWC  147

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASV+   +    G+G   PEHE +ILQFGKVGKD FTMDY+YPISAFQAF+
Sbjct  148  LNFHGRVTVASVR-LSVGGFSGNGPPGPEHEKIILQFGKVGKDQFTMDYRYPISAFQAFS  206

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  207  ICLSSFDTKIACE  219



>ref|XP_004166452.1| PREDICTED: LOW QUALITY PROTEIN: tubby-like F-box protein 6-like 
[Cucumis sativus]
Length=386

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     N++ F +FPF RSKSN  D+  S PL +QKD +L L+NK P WHEQLQCWC
Sbjct  255  PTPTELSLSNVELFPSFPFLRSKSN-ADSLLSEPLGSQKDGMLVLRNKTPRWHEQLQCWC  313

Query  612  LNFNGRVTVASVKNFQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS   D    E+E +ILQFGKVGKD+FTMDY+YPISAFQAF 
Sbjct  314  LNFHGRVTIASVKNFQLVASPENDPPTAENEKIILQFGKVGKDLFTMDYRYPISAFQAFT  373

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  374  ICLSSFDTKIACE  386



>ref|XP_004144973.1| PREDICTED: tubby-like F-box protein 6-like [Cucumis sativus]
 ref|XP_004153139.1| PREDICTED: tubby-like F-box protein 6-like [Cucumis sativus]
 gb|KGN46192.1| hypothetical protein Csa_6G072980 [Cucumis sativus]
Length=386

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T     N++ F +FPF RSKSN  D+  S PL +QKD +L L+NK P WHEQLQCWC
Sbjct  255  PTPTELSLSNVELFPSFPFLRSKSN-ADSLLSEPLGSQKDGMLVLRNKTPRWHEQLQCWC  313

Query  612  LNFNGRVTVASVKNFQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQLVAS   D    E+E +ILQFGKVGKD+FTMDY+YPISAFQAF 
Sbjct  314  LNFHGRVTIASVKNFQLVASPENDPPTAENEKIILQFGKVGKDLFTMDYRYPISAFQAFT  373

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  374  ICLSSFDTKIACE  386



>ref|XP_010507835.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
Length=408

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  275  PTQTELLHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLALKNKAPRWHEQLQCW  334

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  335  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  394

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  395  TICLSSFDTKIACE  408



>ref|XP_010506830.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
 ref|XP_010506831.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
 ref|XP_010506832.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
Length=407

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  274  PTQTELLHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLALKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  394  TICLSSFDTKIACE  407



>ref|XP_010507836.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Camelina sativa]
Length=407

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  274  PTQTELLHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLALKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  394  TICLSSFDTKIACE  407



>ref|XP_010506833.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Camelina sativa]
Length=406

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  273  PTQTELLHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLALKNKAPRWHEQLQCW  332

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  333  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  392

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  393  TICLSSFDTKIACE  406



>ref|XP_010518508.1| PREDICTED: tubby-like F-box protein 3 isoform X2 [Camelina sativa]
Length=406

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGP-LSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+DSF +F FFRSKS R ++  SGP  +AQK+ +L LKNKAP WHEQLQCW
Sbjct  273  PTQTELLHSNLDSFPSFSFFRSKSIRAESLPSGPSAAAQKEGLLALKNKAPRWHEQLQCW  332

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  333  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  392

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  393  TICLSSFDTKIACE  406



>ref|XP_010518507.1| PREDICTED: tubby-like F-box protein 3 isoform X1 [Camelina sativa]
Length=407

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGP-LSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T  L  N+DSF +F FFRSKS R ++  SGP  +AQK+ +L LKNKAP WHEQLQCW
Sbjct  274  PTQTELLHSNLDSFPSFSFFRSKSIRAESLPSGPSAAAQKEGLLALKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  394  TICLSSFDTKIACE  407



>ref|XP_004984381.1| PREDICTED: tubby-like F-box protein 6-like isoform X10 [Setaria 
italica]
Length=397

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   ++DSF + PFFRSKS R+D       S QK++ L LKNK+P WHEQLQC
Sbjct  265  KAPTQTEFPLSSLDSFPSIPFFRSKSARIDTTSQS--STQKEDRLVLKNKSPRWHEQLQC  322

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E++ VILQFGK+GKD+FTMDY+YPISAFQA
Sbjct  323  WCLNFRGRVTVASVKNFQLVASEDNGSGNQENDKVILQFGKIGKDLFTMDYRYPISAFQA  382

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  383  FAICLSSFDTKIACE  397



>ref|XP_004984372.1| PREDICTED: tubby-like F-box protein 6-like isoform X1 [Setaria 
italica]
 ref|XP_004984373.1| PREDICTED: tubby-like F-box protein 6-like isoform X2 [Setaria 
italica]
 ref|XP_004984374.1| PREDICTED: tubby-like F-box protein 6-like isoform X3 [Setaria 
italica]
 ref|XP_004984375.1| PREDICTED: tubby-like F-box protein 6-like isoform X4 [Setaria 
italica]
 ref|XP_004984376.1| PREDICTED: tubby-like F-box protein 6-like isoform X5 [Setaria 
italica]
 ref|XP_004984377.1| PREDICTED: tubby-like F-box protein 6-like isoform X6 [Setaria 
italica]
 ref|XP_004984378.1| PREDICTED: tubby-like F-box protein 6-like isoform X7 [Setaria 
italica]
 ref|XP_004984379.1| PREDICTED: tubby-like F-box protein 6-like isoform X8 [Setaria 
italica]
 ref|XP_004984380.1| PREDICTED: tubby-like F-box protein 6-like isoform X9 [Setaria 
italica]
Length=400

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   ++DSF + PFFRSKS R+D       S QK++ L LKNK+P WHEQLQC
Sbjct  268  KAPTQTEFPLSSLDSFPSIPFFRSKSARIDTTSQS--STQKEDRLVLKNKSPRWHEQLQC  325

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E++ VILQFGK+GKD+FTMDY+YPISAFQA
Sbjct  326  WCLNFRGRVTVASVKNFQLVASEDNGSGNQENDKVILQFGKIGKDLFTMDYRYPISAFQA  385

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  386  FAICLSSFDTKIACE  400



>ref|XP_006651378.1| PREDICTED: tubby-like F-box protein 6-like [Oryza brachyantha]
Length=362

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F    +DSF +  FFRSKS R+D+  S  +SAQK+E L L+NK+P WHEQLQC
Sbjct  229  KAPTQTEFPLSGLDSFPSISFFRSKSARIDSATS-QISAQKEEKLVLRNKSPRWHEQLQC  287

Query  618  WCLNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E + VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  288  WCLNFRGRVTVASVKNFQLVASDENGPTNQEQDKVILQFGKIGKDLFTMDYRYPISAFQS  347

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  348  FAICLSSFDTKIACE  362



>ref|NP_850481.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 ref|NP_001031558.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 sp|Q8VY21.1|TLP3_ARATH RecName: Full=Tubby-like F-box protein 3; Short=AtTLP3 [Arabidopsis 
thaliana]
 gb|AAL66970.1| putative tubby protein [Arabidopsis thaliana]
 gb|AAM20254.1| putative tubby protein [Arabidopsis thaliana]
 gb|AAK98802.1| tubby-like protein 3 [Arabidopsis thaliana]
 gb|AEC10907.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 gb|AEC10908.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
Length=406

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  +  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  273  PTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCW  332

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  333  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  392

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  393  TICLSSFDTKIACE  406



>ref|NP_001189775.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
 gb|AAC63644.1| putative tubby protein [Arabidopsis thaliana]
 gb|AAM15124.1| putative tubby protein [Arabidopsis thaliana]
 dbj|BAH57076.1| AT2G47900 [Arabidopsis thaliana]
 gb|AEC10909.1| Tubby-like F-box protein 3 [Arabidopsis thaliana]
Length=407

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  +  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  274  PTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  394  TICLSSFDTKIACE  407



>ref|XP_006658081.1| PREDICTED: tubby-like F-box protein 11-like [Oryza brachyantha]
Length=290

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   N +SF++ PFF+SKS R+ N  +  L  Q +  L LKNK+P WHE LQCWC
Sbjct  159  PTQTEFPSSNHESFTSIPFFKSKSFRV-NSSAASLLTQNESKLVLKNKSPRWHEHLQCWC  217

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS   G    EHE+VILQFGKVGKD FTMDY+YPISAFQAFA
Sbjct  218  LNFHGRVTVASVKNFQLVASDESGPTNQEHEDVILQFGKVGKDTFTMDYRYPISAFQAFA  277

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  278  ICLSSFDTKIACE  290



>ref|XP_006295942.1| hypothetical protein CARUB_v10025079mg [Capsella rubella]
 gb|EOA28840.1| hypothetical protein CARUB_v10025079mg [Capsella rubella]
Length=407

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA-QKDEILTLKNKAPGWHEQLQCW  616
            PT T  +  N+DSF +F FFRSKS R ++  SGP SA QK+ +L LKNKAP WHEQLQCW
Sbjct  274  PTQTELVHSNLDSFPSFSFFRSKSIRAESLSSGPSSAAQKEGLLVLKNKAPRWHEQLQCW  333

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNFNGRVTVASVKNFQLVA+  +G A PEHENVILQFGKVGKDVFTMDYQYPISAFQAF
Sbjct  334  CLNFNGRVTVASVKNFQLVAAPLNGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAF  393

Query  438  AICLSSFDTKIACE  397
             ICLSSFDTKIACE
Sbjct  394  TICLSSFDTKIACE  407



>gb|KJB41991.1| hypothetical protein B456_007G131500 [Gossypium raimondii]
Length=375

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = -2

Query  711  DNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA-  535
            ++FQSGPLS QKD +L L+NK+P WHEQLQCWCLNFNGRVTVASVKNFQLVAS  +  A 
Sbjct  270  ESFQSGPLSDQKDGMLVLRNKSPRWHEQLQCWCLNFNGRVTVASVKNFQLVASPENAAAG  329

Query  534  PEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
Sbjct  330  QEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  375



>sp|Q10LG8.1|TLP6_ORYSJ RecName: Full=Tubby-like F-box protein 6; Short=OsTLP6; AltName: 
Full=Tubby-like F-box protein 14; Short=OsTLP14 [Oryza sativa 
Japonica Group]
 gb|ABF95936.1| Tubby protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAY90005.1| hypothetical protein OsI_11572 [Oryza sativa Indica Group]
 gb|EAZ26915.1| hypothetical protein OsJ_10842 [Oryza sativa Japonica Group]
Length=403

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F    +DSF +  FFRSKS R+D+  S  LS QK+E L LKNK+P WHEQLQC
Sbjct  270  KAPTQTEFPLSGLDSFPSISFFRSKSARIDSATS-QLSTQKEEKLVLKNKSPRWHEQLQC  328

Query  618  WCLNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E + VILQFGK+GKD+FTMDY+YPISAFQ+
Sbjct  329  WCLNFRGRVTVASVKNFQLVASDENGPTNQEQDKVILQFGKIGKDLFTMDYRYPISAFQS  388

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  389  FAICLSSFDTKIACE  403



>ref|XP_009392664.1| PREDICTED: tubby-like F-box protein 6 [Musa acuminata subsp. 
malaccensis]
Length=403

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT   FL  ++DSF + PFFRSKS+R++   SG  S   +E L LKNK P WH QLQCWC
Sbjct  272  PTQIEFLHASLDSFPSVPFFRSKSSRIECL-SGSFSGLNEEKLVLKNKNPRWHAQLQCWC  330

Query  612  LNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF GRVTVASVKNFQLVAS   G V+ E E VILQFGKVGKD+FTMDY YPISAFQAFA
Sbjct  331  LNFRGRVTVASVKNFQLVASDEIGSVSQEQEKVILQFGKVGKDLFTMDYSYPISAFQAFA  390

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  391  ICLSSFDTKIACE  403



>ref|NP_001148856.1| tubby protein [Zea mays]
 gb|ACG33159.1| tubby protein [Zea mays]
Length=401

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   ++DSF +FPFFRSKS R+D+  S   S ++D  L LKNK+P WHEQLQC
Sbjct  268  KTPTQTEFPLSSLDSFPSFPFFRSKSARIDSSTSQSSSQREDR-LVLKNKSPRWHEQLQC  326

Query  618  WCLNFNGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G  + E + VILQFGK+GKD+FTMDY YPISAFQA
Sbjct  327  WCLNFRGRVTVASVKNFQLVASEDNGPESQESDKVILQFGKIGKDLFTMDYGYPISAFQA  386

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  387  FAICLSSFDTKIACE  401



>emb|CDO98920.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = -2

Query  771  PVNID----SFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNF  604
            P  ID    S   FP FRSKS++ +   S P     +  L L+NKAP WHEQLQCWCLNF
Sbjct  219  PTQIDLPTGSADYFPLFRSKSSKFEKSVSSPSDDPTEGSLVLRNKAPRWHEQLQCWCLNF  278

Query  603  NGRVTVASVKNFQLVASMGDG-VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICL  427
            +GRVTVASVKNFQLVAS  +G   PEHE VILQFGKVGKDVFTMDY+YPISAFQAFAICL
Sbjct  279  HGRVTVASVKNFQLVASPENGQRGPEHEKVILQFGKVGKDVFTMDYRYPISAFQAFAICL  338

Query  426  SSFDTKIACE  397
            SSFDTKIACE
Sbjct  339  SSFDTKIACE  348



>ref|XP_008676416.1| PREDICTED: tubby protein isoform X1 [Zea mays]
 ref|XP_008676417.1| PREDICTED: tubby protein isoform X1 [Zea mays]
 tpg|DAA45380.1| TPA: tubby protein [Zea mays]
Length=401

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   ++DSF +FPFFRSKS R+D+  S   S ++D  L LKNK+P WHEQLQC
Sbjct  268  KTPTQTEFPLSSLDSFPSFPFFRSKSARIDSSTSQSSSQREDR-LVLKNKSPRWHEQLQC  326

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E + VILQFGK+GKD+FTMDY YPISAFQA
Sbjct  327  WCLNFRGRVTVASVKNFQLVASEDNGPENQESDKVILQFGKIGKDLFTMDYGYPISAFQA  386

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  387  FAICLSSFDTKIACE  401



>tpg|DAA45381.1| TPA: hypothetical protein ZEAMMB73_557743 [Zea mays]
 tpg|DAA45382.1| TPA: hypothetical protein ZEAMMB73_557743 [Zea mays]
Length=441

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 2/135 (1%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQC  619
            + PT T F   ++DSF +FPFFRSKS R+D+  S   S ++D  L LKNK+P WHEQLQC
Sbjct  308  KTPTQTEFPLSSLDSFPSFPFFRSKSARIDSSTSQSSSQREDR-LVLKNKSPRWHEQLQC  366

Query  618  WCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            WCLNF GRVTVASVKNFQLVAS  +G    E + VILQFGK+GKD+FTMDY YPISAFQA
Sbjct  367  WCLNFRGRVTVASVKNFQLVASEDNGPENQESDKVILQFGKIGKDLFTMDYGYPISAFQA  426

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  427  FAICLSSFDTKIACE  441



>gb|EYU43888.1| hypothetical protein MIMGU_mgv1a007913mg [Erythranthe guttata]
Length=391

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = -2

Query  771  PVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRV  592
            P ++D   T PFFR+KS++        L++Q+++ L L+NK+P WHEQLQCWCLNF+GRV
Sbjct  269  PTSLDYSPTNPFFRTKSDKSLAIH---LNSQQEDSLILRNKSPRWHEQLQCWCLNFHGRV  325

Query  591  TVASVKNFQLVASMGDGV-APEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFD  415
            T ASVKNFQLVAS  +G   PEH+ VILQFGKVGKDVFTMDY++P+SAFQAFAICLSSFD
Sbjct  326  TAASVKNFQLVASSENGAPGPEHDKVILQFGKVGKDVFTMDYRFPLSAFQAFAICLSSFD  385

Query  414  TKIACE  397
            TKIACE
Sbjct  386  TKIACE  391



>gb|EYU43889.1| hypothetical protein MIMGU_mgv1a007913mg [Erythranthe guttata]
Length=388

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = -2

Query  771  PVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRV  592
            P ++D   T PFFR+KS++        L++Q+++ L L+NK+P WHEQLQCWCLNF+GRV
Sbjct  266  PTSLDYSPTNPFFRTKSDKSLAIH---LNSQQEDSLILRNKSPRWHEQLQCWCLNFHGRV  322

Query  591  TVASVKNFQLVASMGDGV-APEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFD  415
            T ASVKNFQLVAS  +G   PEH+ VILQFGKVGKDVFTMDY++P+SAFQAFAICLSSFD
Sbjct  323  TAASVKNFQLVASSENGAPGPEHDKVILQFGKVGKDVFTMDYRFPLSAFQAFAICLSSFD  382

Query  414  TKIACE  397
            TKIACE
Sbjct  383  TKIACE  388



>ref|NP_001060572.1| Os07g0667000 [Oryza sativa Japonica Group]
 sp|Q8H485.1|TLP11_ORYSJ RecName: Full=Tubby-like F-box protein 11; Short=OsTLP11; AltName: 
Full=Tubby-like F-box protein 7; Short=OsTLP7 [Oryza sativa 
Japonica Group]
 dbj|BAC20077.1| putative tubby related protein [Oryza sativa Japonica Group]
 dbj|BAF22486.1| Os07g0667000 [Oryza sativa Japonica Group]
 dbj|BAG92344.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87505.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82646.1| hypothetical protein OsI_27251 [Oryza sativa Indica Group]
 gb|EEE67772.1| hypothetical protein OsJ_25493 [Oryza sativa Japonica Group]
Length=406

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F     +SF++ PFF+SKS R +N  +  L  Q    L LKNK+P WHE LQCWC
Sbjct  275  PTQTEFPLSYHESFTSIPFFKSKSVRANN-STASLLTQNGSKLVLKNKSPRWHEHLQCWC  333

Query  612  LNFNGRVTVASVKNFQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVTVASVKNFQLVAS   +    EH++VILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  334  LNFHGRVTVASVKNFQLVASDESNPTNQEHDDVILQFGKVGKDMFTMDYRYPISAFQAFA  393

Query  435  ICLSSFDTKIACE  397
            ICLSSFDTKIACE
Sbjct  394  ICLSSFDTKIACE  406



>ref|XP_007154224.1| hypothetical protein PHAVU_003G100700g [Phaseolus vulgaris]
 gb|ESW26218.1| hypothetical protein PHAVU_003G100700g [Phaseolus vulgaris]
Length=360

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 105/136 (77%), Gaps = 3/136 (2%)
 Frame = -2

Query  801  RRXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQ  622
            R  P+ T +   NI +  +FPFF++ S  ++N  SG  + +KD++L LKNKA  WHEQ+Q
Sbjct  227  RVAPSQTSYSTSNIGT--SFPFFQTNSTHLENSISGEQNNKKDDVLVLKNKAARWHEQMQ  284

Query  621  CWCLNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQ  445
            CWCLNF GRVT+ASVKNFQL A   +G A P+ ++VILQFGKVGKD+FTMDY+YPISAFQ
Sbjct  285  CWCLNFQGRVTIASVKNFQLAALTVNGHAEPQEDDVILQFGKVGKDMFTMDYRYPISAFQ  344

Query  444  AFAICLSSFDTKIACE  397
            AFAICLSSF T +ACE
Sbjct  345  AFAICLSSFATTVACE  360



>ref|XP_003529593.1| PREDICTED: tubby-like F-box protein 3-like isoform X1 [Glycine 
max]
 ref|XP_006584041.1| PREDICTED: tubby-like F-box protein 3-like isoform X2 [Glycine 
max]
Length=359

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P+ T F   NID+  +FPFF++ S  ++N  SG    +KD++L L+NKA  WHEQL+CWC
Sbjct  229  PSQTDFSVSNIDT--SFPFFQTNSTSLENSISGDQRNKKDDVLVLRNKAARWHEQLECWC  286

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQL  S  +G A P+ + VILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  287  LNFHGRVTIASVKNFQLAVSPENGHAGPQEDEVILQFGKVGKDLFTMDYRYPISAFQAFA  346

Query  435  ICLSSFDTKIACE  397
            ICLSSF T +ACE
Sbjct  347  ICLSSFATTVACE  359



>gb|KHN03006.1| Tubby-like F-box protein 3 [Glycine soja]
Length=359

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P+ T F   NID+  +FPFF++ S  ++N  SG    +KD++L L+NKA  WHEQL+CWC
Sbjct  229  PSQTDFSVSNIDT--SFPFFQTNSTSLENSISGDQRNKKDDVLVLRNKAARWHEQLECWC  286

Query  612  LNFNGRVTVASVKNFQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQL  S  +G A P+ + VILQFGKVGKD+FTMDY+YPISAFQAFA
Sbjct  287  LNFHGRVTIASVKNFQLAVSPENGHAGPQEDEVILQFGKVGKDLFTMDYRYPISAFQAFA  346

Query  435  ICLSSFDTKIACE  397
            ICLSSF T +ACE
Sbjct  347  ICLSSFATTVACE  359



>gb|KHG04300.1| Tubby-like F-box protein 6 [Gossypium arboreum]
Length=324

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 6/129 (5%)
 Frame = -2

Query  783  TXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNF  604
            + F  +N D F + P   S+   M NF SG L  QK+  L L NKAP W+EQL CWCLNF
Sbjct  202  SEFSGLNTDIFQSNPIAHSEPASMGNFLSGSLRGQKNGALVLINKAPRWNEQLHCWCLNF  261

Query  603  NGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLS  424
            +GRVTVASVKNFQLVAS      PE+  ++LQFGKVGKD+FTMDYQYPISAFQAFAICLS
Sbjct  262  HGRVTVASVKNFQLVAS------PENRKIVLQFGKVGKDLFTMDYQYPISAFQAFAICLS  315

Query  423  SFDTKIACE  397
            SFDTK+ACE
Sbjct  316  SFDTKVACE  324



>gb|KJB28589.1| hypothetical protein B456_005G057200 [Gossypium raimondii]
Length=384

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 94/123 (76%), Gaps = 6/123 (5%)
 Frame = -2

Query  765  NIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTV  586
            N D F + P   S+   M NF SG L  QK+  L L NKAP W+EQL CWCLNF+GRVTV
Sbjct  268  NTDIFQSNPIAHSEPASMGNFPSGSLCGQKNGALVLINKAPRWNEQLHCWCLNFHGRVTV  327

Query  585  ASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKI  406
            ASVKNFQLVAS      PE+  ++LQFGKVGKD+FTMDYQYPISAFQAFAICLSSFDTK+
Sbjct  328  ASVKNFQLVAS------PENRKIVLQFGKVGKDLFTMDYQYPISAFQAFAICLSSFDTKV  381

Query  405  ACE  397
            ACE
Sbjct  382  ACE  384



>ref|XP_004958613.1| PREDICTED: tubby-like F-box protein 11-like [Setaria italica]
Length=396

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 105/135 (78%), Gaps = 8/135 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   N  SF++ PFFRSKS ++D+  SG   AQ +  + LKNK+P WH+QLQCWC
Sbjct  267  PTQTEFPSSNSSSFASVPFFRSKSGQLDS--SG---AQNESKVALKNKSPSWHQQLQCWC  321

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP---EHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            LNF+GRVTVASVKNFQLVAS      P   E ++VILQFGKVGKD+FTMDY+YPISAFQA
Sbjct  322  LNFHGRVTVASVKNFQLVASGESAPTPSNQEDDDVILQFGKVGKDLFTMDYRYPISAFQA  381

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKI CE
Sbjct  382  FAICLSSFDTKIGCE  396



>gb|KHN03393.1| Tubby-like F-box protein 3 [Glycine soja]
Length=363

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P+ T F   N D+  +FPFF++ S  ++N  SG  S +KD++L L+NKA  WHEQLQCWC
Sbjct  233  PSQTDFSVSNRDT--SFPFFQTNSTSLENSISGDQSNKKDDVLVLRNKAARWHEQLQCWC  290

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHEN-VILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQL  S  +G A   E+ VILQFGK+GKD+FTMDY+YPISAFQAFA
Sbjct  291  LNFHGRVTIASVKNFQLAVSPENGHAGLQEDEVILQFGKIGKDLFTMDYRYPISAFQAFA  350

Query  435  ICLSSFDTKIACE  397
            ICLSSF T +ACE
Sbjct  351  ICLSSFATTVACE  363



>ref|NP_001239849.1| uncharacterized protein LOC100805161 [Glycine max]
 gb|ACU18136.1| unknown [Glycine max]
Length=362

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            P+ T F   N D+  +FPFF++ S  ++N  SG  S +KD++L L+NKA  WHEQLQCWC
Sbjct  232  PSQTDFSVSNRDT--SFPFFQTNSTSLENSISGDQSNKKDDVLVLRNKAARWHEQLQCWC  289

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEHEN-VILQFGKVGKDVFTMDYQYPISAFQAFA  436
            LNF+GRVT+ASVKNFQL  S  +G A   E+ VILQFGK+GKD+FTMDY+YPISAFQAFA
Sbjct  290  LNFHGRVTIASVKNFQLAVSPENGHAGLQEDEVILQFGKIGKDLFTMDYRYPISAFQAFA  349

Query  435  ICLSSFDTKIACE  397
            ICLSSF T +ACE
Sbjct  350  ICLSSFATTVACE  362



>ref|XP_006855409.1| hypothetical protein AMTR_s00057p00153680 [Amborella trichopoda]
 gb|ERN16876.1| hypothetical protein AMTR_s00057p00153680 [Amborella trichopoda]
Length=421

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 103/147 (70%), Gaps = 15/147 (10%)
 Frame = -2

Query  792  PTXTXFLPVNIDS-FSTFPFFRSKSNRMDNFQSGPLSA--QKDEILTLKNKAPGWHEQLQ  622
            PT + F    +DS F   PFFRSKS R +   SGPL    QKD +L L+NKAP WH+QLQ
Sbjct  275  PTQSEFPLSTLDSSFQALPFFRSKSVRSNASFSGPLDGGPQKDGMLVLRNKAPRWHDQLQ  334

Query  621  CWCLNFNGRVTVASVKNFQLVASMGDGVAP------------EHENVILQFGKVGKDVFT  478
            CWCLNF GRVTVASVKNFQLVA+                   + + V+LQFGKVGKD+FT
Sbjct  335  CWCLNFRGRVTVASVKNFQLVAATSSSSENGNGNGNGNTNSHDSDTVLLQFGKVGKDMFT  394

Query  477  MDYQYPISAFQAFAICLSSFDTKIACE  397
            MD++YP+SAFQAFAICLSSFDTKIACE
Sbjct  395  MDFRYPLSAFQAFAICLSSFDTKIACE  421



>gb|KHG16836.1| Tubby-like F-box protein 3 [Gossypium arboreum]
Length=376

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKN  571
            ST   F SKS  M+N     +S QK+  L L NKAP WHEQLQCWCLNF+GRVT+ASVKN
Sbjct  262  STPTSFLSKSASMEN----SVSDQKNGGLVLINKAPRWHEQLQCWCLNFHGRVTIASVKN  317

Query  570  FQLVASMGDGVA-PEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FQLVAS  +G A PEHE +ILQFGKVGKD+FTMDY+YPIS FQAFAICLSSF+T+IACE
Sbjct  318  FQLVASPENGPAGPEHEKIILQFGKVGKDLFTMDYRYPISVFQAFAICLSSFETRIACE  376



>ref|XP_002461169.1| hypothetical protein SORBIDRAFT_02g042210 [Sorghum bicolor]
 gb|EER97690.1| hypothetical protein SORBIDRAFT_02g042210 [Sorghum bicolor]
Length=399

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 5/134 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSG-PLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T F  +N +SF++ PFFR KS R+D+  SG  L+ Q +  + LKNK+P WHE LQCW
Sbjct  269  PTQTEFPSINSNSFASVPFFR-KSGRLDS--SGVQLATQNEAKMVLKNKSPNWHEPLQCW  325

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF+GRVTVASVKNFQLVAS    +  +  ++VILQFGKVGKD+FTMDY+YPISAFQAF
Sbjct  326  CLNFHGRVTVASVKNFQLVASGESDLNNQGDDDVILQFGKVGKDLFTMDYRYPISAFQAF  385

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKI  E
Sbjct  386  AICLSSFDTKITRE  399



>gb|EMT05064.1| hypothetical protein F775_14644 [Aegilops tauschii]
Length=294

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 6/121 (5%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKN  571
            + FPFF  KS+RMD+  + PLS+Q +  L LKNK+P WHE L+CWCLNF+GRVTVASVKN
Sbjct  177  TAFPFFNPKSSRMDSSIT-PLSSQVESKLVLKNKSPRWHEHLRCWCLNFHGRVTVASVKN  235

Query  570  FQLVASMGDGVAP---EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIAC  400
            FQLVAS  D  AP   E+++  LQFGK+GKD+FT+DY+YP+SAFQAFAICLSSFDTK+A 
Sbjct  236  FQLVAS--DESAPANEENDDTTLQFGKIGKDLFTLDYRYPVSAFQAFAICLSSFDTKLAR  293

Query  399  E  397
            E
Sbjct  294  E  294



>gb|KJB72557.1| hypothetical protein B456_011G185600 [Gossypium raimondii]
Length=376

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 5/119 (4%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKN  571
            ST   F SKS  M+N     +S QK+  L L NKAP WHEQLQCWCLNF+GRVT+ASVKN
Sbjct  262  STPTSFLSKSASMEN----SVSDQKNGGLVLINKAPRWHEQLQCWCLNFHGRVTIASVKN  317

Query  570  FQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FQLVAS   +   PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFAICLSSF+T+IACE
Sbjct  318  FQLVASPENEPGGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFETRIACE  376



>gb|KJB72558.1| hypothetical protein B456_011G185600 [Gossypium raimondii]
Length=375

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 5/119 (4%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKN  571
            ST   F SKS  M+N     +S QK+  L L NKAP WHEQLQCWCLNF+GRVT+ASVKN
Sbjct  261  STPTSFLSKSASMEN----SVSDQKNGGLVLINKAPRWHEQLQCWCLNFHGRVTIASVKN  316

Query  570  FQLVAS-MGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FQLVAS   +   PEHE +ILQFGKVGKD+FTMDY+YPISAFQAFAICLSSF+T+IACE
Sbjct  317  FQLVASPENEPGGPEHEKIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFETRIACE  375



>gb|KJB71035.1| hypothetical protein B456_011G101400 [Gossypium raimondii]
 gb|KJB71036.1| hypothetical protein B456_011G101400 [Gossypium raimondii]
Length=409

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 95/139 (68%), Gaps = 17/139 (12%)
 Frame = -2

Query  774  LPVNIDS-FSTFPFFRSKSNRMDNFQSGP-----LSAQKDEILTLKNKAPGWHEQLQCWC  613
            LP + D   S  P  + K   MD   + P      S    E LTLKNKAP WHEQLQCWC
Sbjct  275  LPQSFDEQLSPLPSSKGKQPLMDTSSTSPAVTPLFSPGSGEPLTLKNKAPRWHEQLQCWC  334

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAPEH-------ENVILQFGKVGKDVFTMDYQYPIS  454
            LNF GRVTVASVKNFQLVA+    V PEH       E VILQFGK+GKD+FTMDYQYP+S
Sbjct  335  LNFKGRVTVASVKNFQLVAA----VEPEHNVSPEDQEKVILQFGKIGKDIFTMDYQYPLS  390

Query  453  AFQAFAICLSSFDTKIACE  397
            AFQAFAICLSSFDTK ACE
Sbjct  391  AFQAFAICLSSFDTKPACE  409



>emb|CBI18204.3| unnamed protein product [Vitis vinifera]
Length=284

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  720  NRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDG  541
            N  D+FQ       KD  L L+NK P WHEQLQCWCLNF GRVTVASVKNFQL+A+    
Sbjct  181  NLEDSFQD----EGKDRPLVLRNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPA  236

Query  540  VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             A +H+ +ILQFGKVGKD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  237  AASDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  284



>ref|XP_006340635.1| PREDICTED: tubby-like F-box protein 5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006340636.1| PREDICTED: tubby-like F-box protein 5-like isoform X2 [Solanum 
tuberosum]
Length=407

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFS-TFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT   F P + D  S + P   +K + MD      ++A   E+L LKNKAP WHEQLQCW
Sbjct  273  PTPKSF-PQSFDEKSFSGPLAIAKESAMDIISRSAVTATSQELLVLKNKAPRWHEQLQCW  331

Query  615  CLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPISAFQ  445
            CLNF GRVTVASVKNFQLVA++         E E VILQFGK+GKD+FTMDY+YP+SAFQ
Sbjct  332  CLNFKGRVTVASVKNFQLVAAVDPSHNIPVAEQEKVILQFGKIGKDIFTMDYRYPLSAFQ  391

Query  444  AFAICLSSFDTKIACE  397
            AFAICLSSFDTK ACE
Sbjct  392  AFAICLSSFDTKPACE  407



>ref|XP_008661891.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 ref|XP_008661892.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 ref|XP_008661893.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 ref|XP_008661894.1| PREDICTED: LOC100281492 isoform X1 [Zea mays]
 gb|ACR36164.1| unknown [Zea mays]
 gb|AFW56160.1| tubby-like protein isoform 1 [Zea mays]
 gb|AFW56161.1| tubby-like protein isoform 2 [Zea mays]
 gb|AIB05490.1| TUB transcription factor, partial [Zea mays]
Length=436

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 89/122 (73%), Gaps = 11/122 (9%)
 Frame = -2

Query  729  SKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVA--  556
            S S R+ +  SG     K+  L L+NKAP WHEQLQCWCLNF GRVTVASVKNFQLVA  
Sbjct  315  SSSRRIGDTASGDNDECKERPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAT  374

Query  555  ---------SMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIA  403
                     S    V PEHE VILQFGKV KD+FTMDY+YP+SAFQAFAICLSSFDTK+A
Sbjct  375  QPAAGAPTPSQATPVPPEHEKVILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLA  434

Query  402  CE  397
            CE
Sbjct  435  CE  436



>gb|KHG30423.1| Tubby-like F-box protein 5 [Gossypium arboreum]
Length=403

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 92/129 (71%), Gaps = 8/129 (6%)
 Frame = -2

Query  759  DSFSTFPFFRSKSNRMDNFQSGP-----LSAQKDEILTLKNKAPGWHEQLQCWCLNFNGR  595
            +  S  P  + K   MD     P      S    E LTLKNKAP WHEQLQCWCLNF GR
Sbjct  275  EQLSPLPSSKGKQPLMDTSSLSPAVTPLFSPGSGEPLTLKNKAPRWHEQLQCWCLNFKGR  334

Query  594  VTVASVKNFQLVASMGD--GVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLS  424
            VTVASVKNFQLVA++     V+PE  E VILQFGK+GKD+FTMDYQYP+SAFQAFAICLS
Sbjct  335  VTVASVKNFQLVAAVEPEHNVSPEDQEKVILQFGKIGKDIFTMDYQYPLSAFQAFAICLS  394

Query  423  SFDTKIACE  397
            SFDTK ACE
Sbjct  395  SFDTKPACE  403



>gb|KHN36105.1| Tubby-like F-box protein 5 [Glycine soja]
Length=387

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 100/141 (71%), Gaps = 9/141 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKS--NRMDNF---QSGPLSAQKD-EILTLKNKAPGWHE  631
            PT T F  +  + FS  P  + K     +DN    +  P+ +Q   E L LKNKAP WHE
Sbjct  247  PTPTSFPQIIDEPFSPSPALKGKGPIRDLDNASLPELLPVQSQDSAEPLVLKNKAPRWHE  306

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYP  460
            QLQCWCLNFNGRVTVASVKNFQLVA++       A E E VILQFGK+GKD+FTMDY+YP
Sbjct  307  QLQCWCLNFNGRVTVASVKNFQLVAAVDPSHNVSAAEQEKVILQFGKIGKDIFTMDYRYP  366

Query  459  ISAFQAFAICLSSFDTKIACE  397
            +SAFQAFAICLSSFDTK ACE
Sbjct  367  LSAFQAFAICLSSFDTKPACE  387



>ref|XP_009120949.1| PREDICTED: tubby-like F-box protein 11 [Brassica rapa]
Length=399

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 104/151 (69%), Gaps = 20/151 (13%)
 Frame = -2

Query  792  PTXTXFLPVNIDSF--STFPFF--------RSKSNRMDNFQSGPLSAQKDEILTLKNKAP  643
            PT     P  + S   S FP+         RS+S  + +  SG LS  K+  L L NK P
Sbjct  250  PTSAMEQPRGVSSSEPSEFPYLGGSRSTFSRSQSKPLRSSSSG-LSHLKETPLVLSNKTP  308

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASM-------GDGVAPEHEN--VILQFGKVGK  490
             WHEQL+CWCLNF+GRVTVASVKNFQLVA+        G+G++PE +N  +ILQFGKVGK
Sbjct  309  RWHEQLRCWCLNFHGRVTVASVKNFQLVAAAASSGVGGGEGLSPERQNERIILQFGKVGK  368

Query  489  DVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            D+FTMDY YPISAFQAFAICLSSF+T+IACE
Sbjct  369  DMFTMDYGYPISAFQAFAICLSSFETRIACE  399



>ref|XP_007156957.1| hypothetical protein PHAVU_002G031500g [Phaseolus vulgaris]
 gb|ESW28951.1| hypothetical protein PHAVU_002G031500g [Phaseolus vulgaris]
Length=414

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 96/140 (69%), Gaps = 8/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMD----NFQSGPLSAQKD-EILTLKNKAPGWHEQ  628
            PT T F  +    FS  P  + K    D    N    P+ +Q   E + LKNKAP WHEQ
Sbjct  275  PTPTSFPQIIDKPFSPSPVLKGKGPSTDLNDVNLPKIPVPSQGSAEPMVLKNKAPRWHEQ  334

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRVTVASVKNFQLVA++       A E E VILQFGK+GKD+FTMDY+YP+
Sbjct  335  LQCWCLNFKGRVTVASVKNFQLVAAVDPSHNVSAAEQEKVILQFGKIGKDIFTMDYRYPL  394

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAFAICLSSFDTK ACE
Sbjct  395  SAFQAFAICLSSFDTKPACE  414



>gb|AFK46698.1| unknown [Lotus japonicus]
Length=169

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 98/151 (65%), Gaps = 20/151 (13%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQSGPLS---------AQKDEILTLKNKAP  643
            P     LP ++ DSF + PF RS  N    F S   S           KD  L  KNK+P
Sbjct  20   PGQPELLPRSLEDSFRSIPFARSIDN-ASEFSSSRFSDIIGTSNEEEGKDRPLVFKNKSP  78

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV-AP--------EHENVILQFGKVGK  490
             WHEQLQCWCLNF GRVTVASVKNFQL+A+      AP        +H+  ILQFGKVGK
Sbjct  79   RWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPTLSDHDKTILQFGKVGK  138

Query  489  DVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            D+FTMDY+YP+SAFQAFAICL+SFDTK+ACE
Sbjct  139  DMFTMDYRYPLSAFQAFAICLTSFDTKLACE  169



>ref|XP_009403904.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403905.1| PREDICTED: tubby-like F-box protein 5 [Musa acuminata subsp. 
malaccensis]
Length=424

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 99/140 (71%), Gaps = 8/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSF--STFPFFRSKSNRMDNFQSGPLSA---QKDEILTLKNKAPGWHEQ  628
            PT T FL   I      +    + K   +D+  S P SA      E L LKNKAP WHEQ
Sbjct  285  PTPTSFLHPIISQRVCCSLAVAKGKQPAIDDVSSTPASAPVRTNGEPLVLKNKAPRWHEQ  344

Query  627  LQCWCLNFNGRVTVASVKNFQLVASM--GDGVAPE-HENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRVTVASVKNFQLVA++    GV+PE  E VILQFGK+GKD+FTMDY+YP+
Sbjct  345  LQCWCLNFRGRVTVASVKNFQLVAAVVPSYGVSPEEQEKVILQFGKIGKDIFTMDYRYPL  404

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAFAICL+SFDTK ACE
Sbjct  405  SAFQAFAICLTSFDTKPACE  424



>dbj|BAK08010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 6/121 (5%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKN  571
            + FPFF  KS+R+D+    PLS+Q +  L LKNK+P WHE L+CWCLNF+GRVTVASVKN
Sbjct  259  TVFPFFNPKSSRIDS-SIIPLSSQVESKLVLKNKSPRWHEHLRCWCLNFHGRVTVASVKN  317

Query  570  FQLVASMGDGVAP---EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIAC  400
            FQLVAS  D  AP   E+++  LQFGK+GKD+FT+DY+YP+SAFQAFAICLSSFDTK+A 
Sbjct  318  FQLVAS--DESAPANEENDDTTLQFGKIGKDLFTLDYRYPVSAFQAFAICLSSFDTKLAR  375

Query  399  E  397
            E
Sbjct  376  E  376



>ref|XP_003517227.1| PREDICTED: tubby-like F-box protein 5-like isoform X1 [Glycine 
max]
 ref|XP_006573577.1| PREDICTED: tubby-like F-box protein 5-like isoform X2 [Glycine 
max]
Length=415

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 100/141 (71%), Gaps = 9/141 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKS--NRMDNF---QSGPLSAQKD-EILTLKNKAPGWHE  631
            PT T F  +  + FS  P  + K     +DN    +  P+ +Q   E L LKNKAP WHE
Sbjct  275  PTPTSFPQIIDEPFSPSPALKGKGPIRDLDNASLPELLPVQSQDSAEPLVLKNKAPRWHE  334

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYP  460
            QLQCWCLNFNGRVTVASVKNFQLVA++       A E E VILQFGK+GKD+FTMDY+YP
Sbjct  335  QLQCWCLNFNGRVTVASVKNFQLVAAVDPSHNVSAAEQEKVILQFGKIGKDIFTMDYRYP  394

Query  459  ISAFQAFAICLSSFDTKIACE  397
            +SAFQAFAICLSSFDTK ACE
Sbjct  395  LSAFQAFAICLSSFDTKPACE  415



>ref|NP_001266362.1| uncharacterized protein LOC101202709 [Zea mays]
 gb|ACF80993.1| unknown [Zea mays]
 gb|ACN34796.1| unknown [Zea mays]
Length=161

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 92/128 (72%), Gaps = 11/128 (9%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQ-------KDEILTLKNKAPGWHEQLQCWCLNFNGRV  592
            ST P  + K   ++ F S  LSA            L LKNKAP WHEQLQCWCLNF GRV
Sbjct  35   STLPSAKGKEVAVE-FSSTSLSADLSGPACVNGTPLVLKNKAPRWHEQLQCWCLNFRGRV  93

Query  591  TVASVKNFQLVASMGDGV---APEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSS  421
            TVASVKNFQLVAS+   +   A E E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+S
Sbjct  94   TVASVKNFQLVASVDPSLNIPAAEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTS  153

Query  420  FDTKIACE  397
            FDTK ACE
Sbjct  154  FDTKPACE  161



>ref|XP_010489533.1| PREDICTED: tubby-like F-box protein 2 [Camelina sativa]
Length=394

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = -2

Query  759  DSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVAS  580
            +  S+ P  + K++  D        + +D+ L LKNK+P WHEQLQCWCLNF GRVTVAS
Sbjct  270  EEVSSSPSPKGKTSATDREVPDISPSLRDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVAS  329

Query  579  VKNFQLVASMGDGV-AP--EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTK  409
            VKNFQLVA +   + AP  EHE VILQFGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK
Sbjct  330  VKNFQLVADIDTSLEAPPEEHERVILQFGKIGKDIFTMDYRYPLSAFQAFAICISSFDTK  389

Query  408  IACE  397
             ACE
Sbjct  390  PACE  393



>ref|XP_008452072.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
Length=414

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 93/139 (67%), Gaps = 7/139 (5%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNF----QSGPLSAQKDEILTLKNKAPGWHEQL  625
            PT T F     D  S+      K +   +F    QS P     DE L LKNKAP WHEQL
Sbjct  276  PTPTSFTYSIDDHLSSMSDSMRKDSTTKDFGSKIQSEPAVRASDESLVLKNKAPRWHEQL  335

Query  624  QCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPIS  454
            QCWCLNF GRVTVASVKNFQLVA++         E E VILQFGK+GKD+FTMDY YP+S
Sbjct  336  QCWCLNFRGRVTVASVKNFQLVAAVDQSHNVSVEEQEKVILQFGKIGKDIFTMDYHYPLS  395

Query  453  AFQAFAICLSSFDTKIACE  397
            AFQAFAICLSSFDTK ACE
Sbjct  396  AFQAFAICLSSFDTKPACE  414



>ref|XP_001776881.1| tubby-like protein [Physcomitrella patens]
 gb|EDQ58284.1| tubby-like protein [Physcomitrella patens]
Length=422

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 94/121 (78%), Gaps = 11/121 (9%)
 Frame = -2

Query  732  RSKSNRMD------NFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKN  571
            RSK+  +D      +F SG L+  KDE L LKNKAP WHEQLQCWCLNF GRVTVASVKN
Sbjct  304  RSKAAVVDISTLDYDFASGLLA--KDEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKN  361

Query  570  FQLVASMGD---GVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIAC  400
            FQLVASM         + + V+LQFGK+GKD+FTMDY+YP+SAFQAFAICLSSFDTK+AC
Sbjct  362  FQLVASMESLPTSSQSDRDKVLLQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKLAC  421

Query  399  E  397
            E
Sbjct  422  E  422



>ref|XP_004146502.1| PREDICTED: tubby-like F-box protein 5-like [Cucumis sativus]
 ref|XP_004160969.1| PREDICTED: tubby-like F-box protein 5-like [Cucumis sativus]
 gb|KGN53311.1| hypothetical protein Csa_4G046740 [Cucumis sativus]
Length=414

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 93/139 (67%), Gaps = 7/139 (5%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNF----QSGPLSAQKDEILTLKNKAPGWHEQL  625
            PT T F     D  S+      K +   +F    QS P     DE L LKNKAP WHEQL
Sbjct  276  PTPTSFTYSLDDHLSSMSDSMRKDSTTKDFGSKIQSEPAVRASDESLVLKNKAPRWHEQL  335

Query  624  QCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPIS  454
            QCWCLNF GRVTVASVKNFQLVA++         E E VILQFGK+GKD+FTMDY YP+S
Sbjct  336  QCWCLNFRGRVTVASVKNFQLVAAVDQSHNVSVEEQEKVILQFGKIGKDIFTMDYHYPLS  395

Query  453  AFQAFAICLSSFDTKIACE  397
            AFQAFAICLSSFDTK ACE
Sbjct  396  AFQAFAICLSSFDTKPACE  414



>gb|EMS56881.1| hypothetical protein TRIUR3_17848 [Triticum urartu]
Length=350

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -2

Query  699  SGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APE  529
            SGP+S  +  +L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +   A E
Sbjct  248  SGPISTSEAPLL-LKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLGVPAAE  306

Query  528  HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  307  QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE  350



>ref|XP_010414142.1| PREDICTED: tubby-like F-box protein 2 [Camelina sativa]
 ref|XP_010414150.1| PREDICTED: tubby-like F-box protein 2 [Camelina sativa]
Length=392

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = -2

Query  753  FSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVK  574
             S+ P  + K++  D        + +D+ L LKNK+P WHEQLQCWCLNF GRVTVASVK
Sbjct  270  ISSSPSPKEKTSATDREVPDVSPSLRDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVK  329

Query  573  NFQLVASMGDGV-AP--EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIA  403
            NFQLVA +   + AP  EHE VILQFGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK A
Sbjct  330  NFQLVADIDTSLEAPPEEHERVILQFGKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPA  389

Query  402  CE  397
            CE
Sbjct  390  CE  391



>dbj|BAJ95176.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -2

Query  699  SGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APE  529
            SGP+S  +  +L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +   A E
Sbjct  246  SGPISTSEAPLL-LKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLGVPAAE  304

Query  528  HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  305  QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE  348



>gb|AHZ96981.1| TLP transcription factor 98, partial [Saccharum hybrid cultivar 
CoC 671]
Length=122

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 86/121 (71%), Gaps = 12/121 (10%)
 Frame = -2

Query  723  SNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGD  544
            S+R+ +   G     K+    L+NKAP WHEQLQCWCLNF GRVTVASVKNFQLVA+   
Sbjct  2    SHRIGDTALGDNDECKERPXILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAATQP  61

Query  543  GVA------------PEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIAC  400
                           PEHE VILQFGKV KD+FTMDY+YP+SAFQAFAICLSSFDTK+AC
Sbjct  62   AAGAPTPSQATPVPPPEHEKVILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC  121

Query  399  E  397
            E
Sbjct  122  E  122



>ref|XP_006297853.1| hypothetical protein CARUB_v10013894mg [Capsella rubella]
 gb|EOA30751.1| hypothetical protein CARUB_v10013894mg [Capsella rubella]
Length=394

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQ  508
            +D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D    EHE VILQ
Sbjct  297  RDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDTSLDASTEEHERVILQ  356

Query  507  FGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  357  FGKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  393



>emb|CDY25159.1| BnaC07g03480D [Brassica napus]
Length=375

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 3/96 (3%)
 Frame = -2

Query  675  DEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQF  505
            D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D +  EHE VILQF
Sbjct  279  DQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDPSLDALPEEHERVILQF  338

Query  504  GKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  339  GKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  374



>gb|EMT18456.1| hypothetical protein F775_06966 [Aegilops tauschii]
Length=385

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -2

Query  699  SGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APE  529
            SGP+S  +  +L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +   A E
Sbjct  283  SGPISTSEAPLL-LKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLGVPAAE  341

Query  528  HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  342  QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE  385



>ref|XP_009102252.1| PREDICTED: tubby-like F-box protein 2 [Brassica rapa]
Length=378

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 3/96 (3%)
 Frame = -2

Query  675  DEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQF  505
            D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D +  EHE VILQF
Sbjct  282  DQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDPSLDALPEEHERVILQF  341

Query  504  GKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  342  GKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  377



>emb|CDY46301.1| BnaA07g02000D [Brassica napus]
Length=378

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 3/96 (3%)
 Frame = -2

Query  675  DEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQF  505
            D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D +  EHE VILQF
Sbjct  282  DQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDPSLDALPEEHERVILQF  341

Query  504  GKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  342  GKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  377



>gb|KJB40194.1| hypothetical protein B456_007G050300 [Gossypium raimondii]
Length=321

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 3/95 (3%)
 Frame = -2

Query  672  EILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASM--GDGVAPE-HENVILQFG  502
            E LTLKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVA++     V+PE  E VILQFG
Sbjct  227  EPLTLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPSHNVSPEEQEKVILQFG  286

Query  501  KVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            K+GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  287  KIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE  321



>ref|XP_002884125.1| hypothetical protein ARALYDRAFT_480735 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60384.1| hypothetical protein ARALYDRAFT_480735 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = -2

Query  759  DSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVAS  580
            +  S+ P  + +++  D          +D+ L LKNK+P WHEQLQCWCLNF GRVTVAS
Sbjct  270  EEVSSSPSPKGETSTTDREVPDITPGLRDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVAS  329

Query  579  VKNFQLVASMG---DGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTK  409
            VKNFQLVA +    D    EHE VILQFGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK
Sbjct  330  VKNFQLVADIDASLDAPPEEHERVILQFGKIGKDIFTMDYRYPLSAFQAFAICISSFDTK  389

Query  408  IACE  397
             ACE
Sbjct  390  PACE  393



>ref|XP_004147860.1| PREDICTED: tubby-like F-box protein 5-like [Cucumis sativus]
 ref|XP_004154845.1| PREDICTED: tubby-like F-box protein 5-like [Cucumis sativus]
Length=382

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F     +   + P  + K    ++    P S +    L LKNKAP WHEQLQCWC
Sbjct  248  PTPTEFKDCIDEYHPSTPLLKGKKAITESPTESPDSQESVAPLVLKNKAPRWHEQLQCWC  307

Query  612  LNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            LNF GRVTVASVKNFQLVA+        A E E VILQFGK+GKD+FTMDY+YP+SAFQA
Sbjct  308  LNFKGRVTVASVKNFQLVAAAETSQNVSAAEQERVILQFGKIGKDIFTMDYRYPLSAFQA  367

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTK ACE
Sbjct  368  FAICLSSFDTKPACE  382



>ref|NP_849975.1| Tubby-like F-box protein 2 [Arabidopsis thaliana]
 ref|NP_001031369.1| Tubby-like F-box protein 2 [Arabidopsis thaliana]
 sp|Q8GVE5.1|TLP2_ARATH RecName: Full=Tubby-like F-box protein 2; Short=AtTLP2 [Arabidopsis 
thaliana]
 gb|AAK98801.1| tubby-like protein 2 [Arabidopsis thaliana]
 gb|ABF47130.1| At2g18280 [Arabidopsis thaliana]
 dbj|BAH19783.1| AT2G18280 [Arabidopsis thaliana]
 gb|AEC06748.1| Tubby-like F-box protein 2 [Arabidopsis thaliana]
 gb|AEC06749.1| Tubby-like F-box protein 2 [Arabidopsis thaliana]
Length=394

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQ  508
            +D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D    EHE VILQ
Sbjct  297  RDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVAEIDASLDAPPEEHERVILQ  356

Query  507  FGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  357  FGKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  393



>ref|XP_008466546.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
Length=411

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F     +  S+ P  + K    ++    P S +    L LKNKAP WHEQLQCWC
Sbjct  277  PTPTEFKDCINEYHSSTPLSKGKKAITESPTESPDSQESVAPLILKNKAPRWHEQLQCWC  336

Query  612  LNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            LNF GRVTVASVKNFQLVA+        A E E VILQFGK+GKD+FTMDY+YP+SAFQA
Sbjct  337  LNFKGRVTVASVKNFQLVAAAETNQNVSAAEQERVILQFGKIGKDIFTMDYRYPLSAFQA  396

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTK ACE
Sbjct  397  FAICLSSFDTKPACE  411



>ref|XP_004232417.1| PREDICTED: tubby-like F-box protein 5 [Solanum lycopersicum]
 ref|XP_010316378.1| PREDICTED: tubby-like F-box protein 5 [Solanum lycopersicum]
Length=411

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 99/140 (71%), Gaps = 9/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFS-TFPFFRSKSNRMDNFQSG----PLSAQKDEILTLKNKAPGWHEQ  628
            PT   F P + D  S + P   +K + MD   SG     ++A   +IL LKNKAP WHEQ
Sbjct  273  PTPKSF-PQSFDEKSFSAPLAIAKESAMDISSSGISRSAVTATSQDILVLKNKAPRWHEQ  331

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRVTVASVKNFQLVA++         E E VILQFGK+GKD+FTMDY+YP+
Sbjct  332  LQCWCLNFKGRVTVASVKNFQLVAAVDPSHNIPVAEQEKVILQFGKIGKDIFTMDYRYPL  391

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAFAICLSSFDTK ACE
Sbjct  392  SAFQAFAICLSSFDTKPACE  411



>ref|XP_001768253.1| tubby-like protein [Physcomitrella patens]
 gb|EDQ66867.1| tubby-like protein [Physcomitrella patens]
Length=420

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 90/109 (83%), Gaps = 9/109 (8%)
 Frame = -2

Query  708  NFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVAP-  532
            +F SGPL+  KD  L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVA+    + P 
Sbjct  316  DFVSGPLT--KDAPLILKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAATD--LPPT  371

Query  531  ----EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
                +H+ V+LQFGK+GKD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  372  NSQNDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  420



>ref|XP_006432266.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 ref|XP_006432271.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45506.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45511.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
Length=253

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 21/152 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQSGPLSA-----QKDE-----ILTLKNKA  646
            P     LP ++ DSF +  F +S  + +D F S   S      + DE      L LKNK 
Sbjct  103  PGQPELLPRSLEDSFRSISFSKSLDHSVD-FSSARFSEIGALREDDEDGKVRPLILKNKP  161

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA---------PEHENVILQFGKVG  493
            P WHEQLQCWCLNF GRVTVASVKNFQL+A+               PEH+ +ILQFGKVG
Sbjct  162  PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAPPEHDKIILQFGKVG  221

Query  492  KDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  222  KDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  253



>ref|XP_009603271.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
 ref|XP_009603272.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
Length=412

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 99/140 (71%), Gaps = 9/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFS-TFPFFRSKSNRMD----NFQSGPLSAQKDEILTLKNKAPGWHEQ  628
            PT T F P + D  + + P  ++K + +D     F    ++    E+L LKNKAP WHEQ
Sbjct  274  PTPTSF-PQSFDEKTFSAPLSKAKESAIDINSSGFSRSAVTVTSQELLVLKNKAPRWHEQ  332

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRVTVASVKNFQLVA++         E E VILQFGK+GKD+FTMDY+YP+
Sbjct  333  LQCWCLNFKGRVTVASVKNFQLVAAVDPSHNIPVAEQEKVILQFGKIGKDIFTMDYRYPL  392

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAFAICLSSFDTK ACE
Sbjct  393  SAFQAFAICLSSFDTKPACE  412



>gb|KGN59979.1| hypothetical protein Csa_3G859660 [Cucumis sativus]
Length=411

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F     +   + P  + K    ++    P S +    L LKNKAP WHEQLQCWC
Sbjct  277  PTPTEFKDCIDEYHPSTPLLKGKKAITESPTESPDSQESVAPLVLKNKAPRWHEQLQCWC  336

Query  612  LNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            LNF GRVTVASVKNFQLVA+        A E E VILQFGK+GKD+FTMDY+YP+SAFQA
Sbjct  337  LNFKGRVTVASVKNFQLVAAAETSQNVSAAEQERVILQFGKIGKDIFTMDYRYPLSAFQA  396

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTK ACE
Sbjct  397  FAICLSSFDTKPACE  411



>gb|AAD15508.1| putative Tub family protein [Arabidopsis thaliana]
Length=386

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQ  508
            +D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D    EHE VILQ
Sbjct  289  RDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVAEIDASLDAPPEEHERVILQ  348

Query  507  FGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  349  FGKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  385



>gb|EPS58599.1| hypothetical protein M569_16214, partial [Genlisea aurea]
Length=371

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 98/134 (73%), Gaps = 5/134 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFST-FPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCW  616
            PT T F     +  S   PFFRSKS+R  + + G   +     L L+NK+P WHEQLQCW
Sbjct  241  PTQTYFPLTGTEVPSAVLPFFRSKSSRWSSHECGVGGSSCSSSLVLRNKSPRWHEQLQCW  300

Query  615  CLNFNGRVTVASVKNFQLVASMGDGVAPE-HENVILQFGKVGKDVFTMDYQYPISAFQAF  439
            CLNF+GRVTVASVKNFQLV   GD VA E    VILQFGKVGKDVFTMD+ YP+SAFQAF
Sbjct  301  CLNFHGRVTVASVKNFQLV---GDEVAAEGGGGVILQFGKVGKDVFTMDFGYPVSAFQAF  357

Query  438  AICLSSFDTKIACE  397
            AICLSSFDTKIACE
Sbjct  358  AICLSSFDTKIACE  371



>gb|ABK24436.1| unknown [Picea sitchensis]
Length=418

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 98/132 (74%), Gaps = 18/132 (14%)
 Frame = -2

Query  756  SFSTFPFFRSKSNRMDNFQ-SGPL--SAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTV  586
            S ++ P F SKS  +++   S PL  S  KDE L LKNKAP WHEQLQCWCLNF GRVTV
Sbjct  293  SLASCPTFGSKSCILESPSISEPLTNSNSKDEPLVLKNKAPRWHEQLQCWCLNFRGRVTV  352

Query  585  ASVKNFQLVASMGDGVAPE---------HENVILQFGKVGKDVFTMDYQYPISAFQAFAI  433
            ASVKNFQLVA      APE         ++ VILQFGKVGKD+FTMDY+YP+SAFQAFAI
Sbjct  353  ASVKNFQLVA------APEPNPSVSQNDYDKVILQFGKVGKDMFTMDYRYPLSAFQAFAI  406

Query  432  CLSSFDTKIACE  397
            CLSSFDTK+ACE
Sbjct  407  CLSSFDTKLACE  418



>ref|XP_010467642.1| PREDICTED: tubby-like F-box protein 2 [Camelina sativa]
Length=392

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 3/97 (3%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV-AP--EHENVILQ  508
            +D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +   + AP  EHE VILQ
Sbjct  295  RDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDTSLEAPPEEHERVILQ  354

Query  507  FGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            FGK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  355  FGKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  391



>ref|NP_197369.2| Tubby-like F-box protein 11 [Arabidopsis thaliana]
 sp|Q6NPQ1.1|TLP11_ARATH RecName: Full=Tubby-like F-box protein 11; Short=AtTLP11 [Arabidopsis 
thaliana]
 gb|AAR23738.1| At5g18680 [Arabidopsis thaliana]
 gb|AAW80874.1| At5g18680 [Arabidopsis thaliana]
 dbj|BAH30591.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92598.1| Tubby-like F-box protein 11 [Arabidopsis thaliana]
Length=389

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 95/129 (74%), Gaps = 12/129 (9%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPL----SAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVA  583
            S FP   ++S  +   QS PL    S  K+  L L NK P WHEQL+CWCLNF+GRVTVA
Sbjct  262  SEFPLLGTRST-LSRSQSKPLRSSSSHLKETPLVLSNKTPRWHEQLRCWCLNFHGRVTVA  320

Query  582  SVKNFQLVAS-----MGDGVAPEH--ENVILQFGKVGKDVFTMDYQYPISAFQAFAICLS  424
            SVKNFQLVA+      G G++PE   E +ILQFGKVGKD+FTMDY YPISAFQAFAICLS
Sbjct  321  SVKNFQLVAAGASCGSGTGMSPERQSERIILQFGKVGKDMFTMDYGYPISAFQAFAICLS  380

Query  423  SFDTKIACE  397
            SF+T+IACE
Sbjct  381  SFETRIACE  389



>emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera]
Length=380

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 99/151 (66%), Gaps = 19/151 (13%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQS------GPLSAQ---KDEILTLKNKAP  643
            P     LP N+ DSF +  F +S  N  +   S      GP   +   KD  L L+NK P
Sbjct  230  PGQAELLPRNLEDSFRSISFSKSIDNSTEFSSSRFSDIIGPRDEEDEGKDRPLVLRNKPP  289

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---------APEHENVILQFGKVGK  490
             WHEQLQCWCLNF GRVTVASVKNFQL+A+              A +H+ +ILQFGKVGK
Sbjct  290  RWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPPASDHDKIILQFGKVGK  349

Query  489  DVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            D+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  350  DMFTMDYRYPLSAFQAFAICLSSFDTKLACE  380



>gb|AAL03978.1| tubby-like protein 12 [Arabidopsis thaliana]
Length=380

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 12/129 (9%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQ----KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVA  583
            S FP   ++S  +   QS PL +     K+  L L NK P WHEQL+CWCLNF+GRVTVA
Sbjct  253  SEFPLLGTRST-LSRSQSKPLRSSSSHLKETPLVLSNKTPRWHEQLRCWCLNFHGRVTVA  311

Query  582  SVKNFQLVAS-----MGDGVAPEH--ENVILQFGKVGKDVFTMDYQYPISAFQAFAICLS  424
            SVKNFQLVA+      G G++PE   E +ILQFGKVGKD+FTMDY YPISAFQAFAICLS
Sbjct  312  SVKNFQLVAAGASCGSGTGMSPERQSERIILQFGKVGKDMFTMDYGYPISAFQAFAICLS  371

Query  423  SFDTKIACE  397
            SF+T+IACE
Sbjct  372  SFETRIACE  380



>ref|NP_001147882.1| LOC100281492 [Zea mays]
 gb|ACG29002.1| tubby-like protein [Zea mays]
Length=437

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 88/123 (72%), Gaps = 12/123 (10%)
 Frame = -2

Query  729  SKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASM  550
            S S R+ +  SG     K+  L L+NKAP WHEQLQCWCLNF GRVTVASVKNFQLVA+ 
Sbjct  315  SSSRRIGDTASGDNDECKERPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAT  374

Query  549  GDGVA------------PEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKI  406
                             PEHE VILQFGKV KD+FTMDY+YP+SAFQAFAICLSSFDTK+
Sbjct  375  QPAAGAPTPSQATPVPPPEHEKVILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKL  434

Query  405  ACE  397
            ACE
Sbjct  435  ACE  437



>gb|EYU25695.1| hypothetical protein MIMGU_mgv1a024543mg, partial [Erythranthe 
guttata]
Length=154

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 93/135 (69%), Gaps = 7/135 (5%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT + F    +D      F  S +NR ++ +S   +   +  L LKNK+P WHEQLQCWC
Sbjct  24   PTPSTFSSYGLDET----FDISSTNRAESKESSIGNITSNRPLVLKNKSPRWHEQLQCWC  79

Query  612  LNFNGRVTVASVKNFQLVASMGDGV---APEHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            LNF GRVTVASVKNFQLVA +         E E VILQFGK+GKD+FTMDY+YP+SAFQA
Sbjct  80   LNFRGRVTVASVKNFQLVADVDPSENIPESEQEKVILQFGKIGKDIFTMDYRYPLSAFQA  139

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTK  CE
Sbjct  140  FAICLSSFDTKPVCE  154



>ref|NP_001141728.2| uncharacterized protein LOC100273859 [Zea mays]
 gb|ACF86942.2| unknown [Zea mays]
 gb|AFU81652.1| TUB-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW73016.1| hypothetical protein ZEAMMB73_946003 [Zea mays]
Length=437

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 4/104 (4%)
 Frame = -2

Query  699  SGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APE  529
            SGP+S   +  L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +   A E
Sbjct  335  SGPVSGN-EAPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLNVPAAE  393

Query  528  HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  394  QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE  437



>ref|XP_003562487.1| PREDICTED: tubby-like F-box protein 11 [Brachypodium distachyon]
 ref|XP_010234253.1| PREDICTED: tubby-like F-box protein 11 [Brachypodium distachyon]
Length=382

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 105/135 (78%), Gaps = 6/135 (4%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWC  613
            PT T F   + DSF++ PFF+SKS+R D+  +  LS Q++  L LKNK+P W E LQCWC
Sbjct  251  PTQTGFPSSSHDSFASIPFFKSKSSRRDSSTTQ-LSTQEESKLVLKNKSPRWQEHLQCWC  309

Query  612  LNFNGRVTVASVKNFQLVASMGDGVAP---EHENVILQFGKVGKDVFTMDYQYPISAFQA  442
            LNF+GRVTVASVKNFQLV S  D  AP   E ++  LQFGK+GKD+F+MDY+YP+SAFQA
Sbjct  310  LNFHGRVTVASVKNFQLVPS--DESAPTNHELDDATLQFGKIGKDMFSMDYRYPLSAFQA  367

Query  441  FAICLSSFDTKIACE  397
            FAICLSSFDTKIACE
Sbjct  368  FAICLSSFDTKIACE  382



>dbj|BAJ93523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -2

Query  699  SGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APE  529
            SGP+S  +  +L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +   A E
Sbjct  325  SGPISTSEAPLL-LKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLGVPAAE  383

Query  528  HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  384  QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE  427



>ref|XP_006878561.1| hypothetical protein AMTR_s00011p00238180 [Amborella trichopoda]
 gb|ERM94706.1| hypothetical protein AMTR_s00011p00238180 [Amborella trichopoda]
Length=326

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 98/145 (68%), Gaps = 18/145 (12%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA------QKDEILTLKNKAPGWHE  631
            PT   F     + FS     +SK   +D F S  LS        K+E L LKNKAP WHE
Sbjct  187  PTPIEFPNALDEPFSLLSATKSKDPIID-FSSTSLSELPISFHSKEEPLVLKNKAPRWHE  245

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASMGDGVAPEH-------ENVILQFGKVGKDVFTMD  472
            QLQCWCLNF GRVTVASVKNFQLVA+    V P H       + VILQFGK+G+D+FTMD
Sbjct  246  QLQCWCLNFRGRVTVASVKNFQLVAA----VEPSHPISMAEQDKVILQFGKIGRDIFTMD  301

Query  471  YQYPISAFQAFAICLSSFDTKIACE  397
            Y+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  302  YRYPLSAFQAFAICLSSFDTKLACE  326



>gb|KJB40192.1| hypothetical protein B456_007G050300 [Gossypium raimondii]
 gb|KJB40193.1| hypothetical protein B456_007G050300 [Gossypium raimondii]
 gb|KJB40195.1| hypothetical protein B456_007G050300 [Gossypium raimondii]
 gb|KJB40196.1| hypothetical protein B456_007G050300 [Gossypium raimondii]
 gb|KJB40197.1| hypothetical protein B456_007G050300 [Gossypium raimondii]
Length=414

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 3/95 (3%)
 Frame = -2

Query  672  EILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASM--GDGVAPE-HENVILQFG  502
            E LTLKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVA++     V+PE  E VILQFG
Sbjct  320  EPLTLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPSHNVSPEEQEKVILQFG  379

Query  501  KVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            K+GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  380  KIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE  414



>ref|XP_004953612.1| PREDICTED: tubby-like F-box protein 5-like [Setaria italica]
Length=429

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 11/133 (8%)
 Frame = -2

Query  765  NIDSFSTFPFFRSKSNRMDNFQSGPLSAQ-------KDEILTLKNKAPGWHEQLQCWCLN  607
            ++D  ST P  + K   ++ F S  LSA         +  L LKNKAP WHEQLQCWCLN
Sbjct  298  SLDEPSTLPSTKGKEPAVE-FSSTSLSADLSGPACTSEAPLVLKNKAPRWHEQLQCWCLN  356

Query  606  FNGRVTVASVKNFQLVASMGDGV---APEHENVILQFGKVGKDVFTMDYQYPISAFQAFA  436
            F GRVTVASVKNFQLVAS+   +   A E E VILQFGK+GKD+FTMDY+YP+SAFQAFA
Sbjct  357  FRGRVTVASVKNFQLVASVDPSLNVPAAEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFA  416

Query  435  ICLSSFDTKIACE  397
            ICL+SFDTK ACE
Sbjct  417  ICLTSFDTKPACE  429



>ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010665127.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010665128.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010665129.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
Length=425

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 99/151 (66%), Gaps = 19/151 (13%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQS------GPLSAQ---KDEILTLKNKAP  643
            P     LP N+ DSF +  F +S  N  +   S      GP   +   KD  L L+NK P
Sbjct  275  PGQAELLPRNLEDSFRSISFSKSIDNSTEFSSSRFSDIIGPRDEEDEGKDRPLVLRNKPP  334

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---------APEHENVILQFGKVGK  490
             WHEQLQCWCLNF GRVTVASVKNFQL+A+              A +H+ +ILQFGKVGK
Sbjct  335  RWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPPASDHDKIILQFGKVGK  394

Query  489  DVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            D+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  395  DMFTMDYRYPLSAFQAFAICLSSFDTKLACE  425



>ref|XP_010546915.1| PREDICTED: tubby-like F-box protein 11 [Tarenaya hassleriana]
Length=386

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 92/127 (72%), Gaps = 9/127 (7%)
 Frame = -2

Query  750  STFPF-FRSKSNRMD--NFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVAS  580
            S FPF FRS S      N   G L   KD  L LKNK P WHEQL+CWCLNF+GRVTVAS
Sbjct  260  SEFPFPFRSPSKPASSSNTPPGDLGHPKDSALVLKNKTPRWHEQLRCWCLNFHGRVTVAS  319

Query  579  VKNFQLVASMGDGVAP------EHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSF  418
            VKNFQLVA+  +   P       +E +ILQFGKVGKD+FTMD+ YPISAFQAFAICLSSF
Sbjct  320  VKNFQLVAAGRETGQPSQQQQQRNERIILQFGKVGKDIFTMDFGYPISAFQAFAICLSSF  379

Query  417  DTKIACE  397
            +T+IACE
Sbjct  380  ETRIACE  386



>ref|XP_007046900.1| Tubby-like F-box protein 5 isoform 1 [Theobroma cacao]
 ref|XP_007046901.1| Tubby-like F-box protein 5 isoform 1 [Theobroma cacao]
 gb|EOX91057.1| Tubby-like F-box protein 5 isoform 1 [Theobroma cacao]
 gb|EOX91058.1| Tubby-like F-box protein 5 isoform 1 [Theobroma cacao]
Length=414

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 83/95 (87%), Gaps = 3/95 (3%)
 Frame = -2

Query  672  EILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASM--GDGVAPE-HENVILQFG  502
            E LTLKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVA++     V+PE  E VILQFG
Sbjct  320  EPLTLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPSHNVSPEEQEKVILQFG  379

Query  501  KVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            K+GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  380  KIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE  414



>ref|XP_006432270.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
 gb|ESR45510.1| hypothetical protein CICLE_v10001261mg [Citrus clementina]
Length=332

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 21/152 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQSGPLSA-----QKDE-----ILTLKNKA  646
            P     LP ++ DSF +  F +S  + +D F S   S      + DE      L LKNK 
Sbjct  182  PGQPELLPRSLEDSFRSISFSKSLDHSVD-FSSARFSEIGALREDDEDGKVRPLILKNKP  240

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA---------PEHENVILQFGKVG  493
            P WHEQLQCWCLNF GRVTVASVKNFQL+A+               PEH+ +ILQFGKVG
Sbjct  241  PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAPPEHDKIILQFGKVG  300

Query  492  KDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  301  KDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  332



>ref|XP_010095256.1| Tubby-like F-box protein 5 [Morus notabilis]
 gb|EXB59102.1| Tubby-like F-box protein 5 [Morus notabilis]
Length=421

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = -2

Query  750  STFPFFRSKSNRMD----NFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVA  583
            S  P  + K   +D    +F   P S Q  E L LKNKAP WHEQLQCWCLNF GRVTVA
Sbjct  297  SPLPNLKGKEPFIDFSSTSFSKPPASVQGVEPLVLKNKAPRWHEQLQCWCLNFKGRVTVA  356

Query  582  SVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDT  412
            SVKNFQLVA++         E E VILQFGK+GKD+FTMDY YP+SAFQAFAICLSSFDT
Sbjct  357  SVKNFQLVAAVDPSHNVSEAEQERVILQFGKIGKDIFTMDYSYPLSAFQAFAICLSSFDT  416

Query  411  KIACE  397
            K ACE
Sbjct  417  KPACE  421



>ref|XP_010241698.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010241699.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010241700.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010241701.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
Length=424

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 101/152 (66%), Gaps = 21/152 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRS-------KSNRMDNFQSGPL---SAQKDEILTLKNKA  646
            P     LP ++ DSF +  F +S        S+R  +  +GP       K+  L L+NKA
Sbjct  274  PGQPELLPRSLEDSFGSISFSKSIDHSVEFSSSRFSDI-AGPRDDDEEGKERPLILRNKA  332

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA---------PEHENVILQFGKVG  493
            P WHEQLQCWCLNF GRVTVASVKNFQL+A+               PEH+ +ILQFGKVG
Sbjct  333  PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAPPEHDKIILQFGKVG  392

Query  492  KDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  393  KDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  424



>ref|XP_011099633.1| PREDICTED: tubby-like F-box protein 5 [Sesamum indicum]
Length=412

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQ------KDEILTLKNKAPGWHE  631
            PT T F     D     P  + K   + +F S  LS          E L LKNKAP WHE
Sbjct  273  PTPTEFPHCTEDKSPVAPMLKGKEP-VVSFSSPNLSTSLVATPNVGEALVLKNKAPRWHE  331

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQFGKVGKDVFTMDYQYP  460
            QLQCWCLNF GRVTVASVKNFQLVAS+    D  A E E VILQFGK+GKD+FTMDY+YP
Sbjct  332  QLQCWCLNFKGRVTVASVKNFQLVASVDPSLDIPAAELEKVILQFGKIGKDIFTMDYRYP  391

Query  459  ISAFQAFAICLSSFDTKIACE  397
            +SAFQAFAICLSSFDTK ACE
Sbjct  392  LSAFQAFAICLSSFDTKPACE  412



>ref|XP_007017568.1| Tubby like protein 6 [Theobroma cacao]
 gb|EOY14793.1| Tubby like protein 6 [Theobroma cacao]
Length=412

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 92/123 (75%), Gaps = 8/123 (7%)
 Frame = -2

Query  741  PFFRSKSNRM----DNFQSG-PLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASV  577
            P   SK NR+    ++  SG PL + +   L L+NKAP WHEQLQCWCLNF GRVTVASV
Sbjct  290  PLLGSKGNRLRVGCNSTGSGKPLKSVQSAPLVLRNKAPRWHEQLQCWCLNFKGRVTVASV  349

Query  576  KNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKI  406
            KNFQLVA++         E E VILQFGK+GKD+FTMDY+YP+SAFQAFAICLSSFDTK 
Sbjct  350  KNFQLVAAVEPSQNVTLVEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKP  409

Query  405  ACE  397
            ACE
Sbjct  410  ACE  412



>ref|NP_001265963.1| tubby-like F-box protein 5-like [Cicer arietinum]
 emb|CAB88665.1| tubby-like protein [Cicer arietinum]
Length=411

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 98/141 (70%), Gaps = 10/141 (7%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKD------EILTLKNKAPGWHE  631
            PT T    +  + FS  P  + KS   D++ SG LS   +      E L LKNKAP WHE
Sbjct  272  PTPTLLPQIFDEPFSPSPALKGKSPMTDSY-SGNLSELPELSQGSVEPLVLKNKAPRWHE  330

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYP  460
            QLQCWCLNF GRVTVASVKNFQLVA++       + E E VILQFGK+GKD+FTMDY YP
Sbjct  331  QLQCWCLNFVGRVTVASVKNFQLVAAVDPSHNVSSEEQERVILQFGKIGKDIFTMDYSYP  390

Query  459  ISAFQAFAICLSSFDTKIACE  397
            +SAFQAFAICL+SFDTK ACE
Sbjct  391  LSAFQAFAICLTSFDTKPACE  411



>ref|XP_006409171.1| hypothetical protein EUTSA_v10022721mg [Eutrema salsugineum]
 dbj|BAJ33697.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50624.1| hypothetical protein EUTSA_v10022721mg [Eutrema salsugineum]
Length=392

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 3/96 (3%)
 Frame = -2

Query  675  DEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV-AP--EHENVILQF  505
            D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +   + AP  EH+ VILQF
Sbjct  296  DQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDPSLNAPPEEHDRVILQF  355

Query  504  GKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GK+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  356  GKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  391



>gb|ABR16075.1| unknown [Picea sitchensis]
Length=418

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 99/128 (77%), Gaps = 6/128 (5%)
 Frame = -2

Query  762  IDSFSTFPFFRSKSNRMDNFQS-GPLSAQ--KDEILTLKNKAPGWHEQLQCWCLNFNGRV  592
            ++  ++F   RSKS   ++  S GPL++   KD+ L LKNKAP WHEQLQCWCLNF GRV
Sbjct  291  VEPLASFRSSRSKSVISESSASSGPLNSGNLKDDPLILKNKAPRWHEQLQCWCLNFRGRV  350

Query  591  TVASVKNFQLVASMGDGVA---PEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSS  421
            TVASVKNFQLVA+     +    + + VILQFGKVGKDVFTMDY+YP+SAFQAFAICLSS
Sbjct  351  TVASVKNFQLVAATEPAQSVSQSDQDKVILQFGKVGKDVFTMDYRYPLSAFQAFAICLSS  410

Query  420  FDTKIACE  397
            FDTK+ACE
Sbjct  411  FDTKLACE  418



>ref|XP_010258386.1| PREDICTED: tubby-like F-box protein 5 [Nelumbo nucifera]
 ref|XP_010258387.1| PREDICTED: tubby-like F-box protein 5 [Nelumbo nucifera]
Length=415

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = -2

Query  693  PLSAQKD-EILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APEH  526
            P S Q+  E L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +     E 
Sbjct  313  PASIQRTREPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLNVSLAEQ  372

Query  525  ENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            E VILQFGK+GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  373  EKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE  415



>ref|XP_010420648.1| PREDICTED: tubby-like F-box protein 11 [Camelina sativa]
Length=396

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 92/134 (69%), Gaps = 16/134 (12%)
 Frame = -2

Query  750  STFPFFRSKSNRMDNFQSGPLSAQ----KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVA  583
            S FPF  ++S      QS PL +     K+  L L NK P WHEQL+CWCLNF+GRVTVA
Sbjct  263  SEFPFLSTRSTTFSRSQSKPLRSSSSHLKETPLVLSNKTPRWHEQLRCWCLNFHGRVTVA  322

Query  582  SVKNFQLVASMGDGVA----------PEHEN--VILQFGKVGKDVFTMDYQYPISAFQAF  439
            SVKNFQLVA+                PE +N  +ILQFGKVGKD+FTMDY YPISAFQAF
Sbjct  323  SVKNFQLVAAAAPTSGSVSGGGMGSSPERQNERIILQFGKVGKDMFTMDYGYPISAFQAF  382

Query  438  AICLSSFDTKIACE  397
            AICLSSF+T+IACE
Sbjct  383  AICLSSFETRIACE  396



>ref|XP_009416896.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009416897.1| PREDICTED: tubby-like F-box protein 8 [Musa acuminata subsp. 
malaccensis]
Length=432

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 83/103 (81%), Gaps = 9/103 (9%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASM---------GDGVAPEH  526
            K+  L L+NKAP WHEQLQCWCLNF GRVTVASVKNFQL+A++            V PEH
Sbjct  330  KERPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAIQPSAGVPTPSQSVPPEH  389

Query  525  ENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            + VILQFGKV KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  390  DKVILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  432



>ref|XP_006598751.1| PREDICTED: uncharacterized protein LOC100803729 isoform X1 [Glycine 
max]
 ref|XP_006598752.1| PREDICTED: uncharacterized protein LOC100803729 isoform X2 [Glycine 
max]
 gb|KHN41272.1| Tubby-like F-box protein 8 [Glycine soja]
Length=424

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 101/153 (66%), Gaps = 21/153 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRM--------DNFQSGPLSAQ-KDEILTLKNKAP  643
            P     LP ++ DSF +  F RS  N          D F +G    Q KD  L LKNK+P
Sbjct  272  PGQPELLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFLAGKEEEQGKDRPLVLKNKSP  331

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV--AP---------EHENVILQFGKV  496
             WHEQLQCWCLNF GRVTVASVKNFQL+A+       AP         +H+ +ILQFGKV
Sbjct  332  RWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPATGAPTPSSQPAQSDHDKIILQFGKV  391

Query  495  GKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GKD+FTMDY+YP+SAFQAFAICL+SFDTK+ACE
Sbjct  392  GKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE  424



>ref|XP_006574698.1| PREDICTED: tubby-like F-box protein 5-like [Glycine max]
Length=414

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 8/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMD----NFQSGP-LSAQKDEILTLKNKAPGWHEQ  628
            PT T F  +  + FS  P  + K+   D    +    P LS    E L LKNKAP WHEQ
Sbjct  275  PTPTSFPQIFDEPFSPSPALKEKAQVTDLNSASLSEPPVLSQGSTEQLALKNKAPRWHEQ  334

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRV+VASVKNFQLVA++       A E E VILQFGK+GKD+FTMDY YP+
Sbjct  335  LQCWCLNFKGRVSVASVKNFQLVAAVDPSHNISAEEQEKVILQFGKIGKDIFTMDYCYPL  394

Query  456  SAFQAFAICLSSFDTKIACE  397
            S FQAFAICLSSFDTK ACE
Sbjct  395  STFQAFAICLSSFDTKPACE  414



>gb|KHN00530.1| Tubby-like F-box protein 2 [Glycine soja]
Length=386

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 8/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMD----NFQSGP-LSAQKDEILTLKNKAPGWHEQ  628
            PT T F  +  + FS  P  + K+   D    +    P LS    E L LKNKAP WHEQ
Sbjct  247  PTPTSFPQIFDEPFSPSPALKEKAQVTDLNSASLSEPPVLSQGSTEQLALKNKAPRWHEQ  306

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRV+VASVKNFQLVA++       A E E VILQFGK+GKD+FTMDY YP+
Sbjct  307  LQCWCLNFKGRVSVASVKNFQLVAAVDPSHNISAEEQEKVILQFGKIGKDIFTMDYCYPL  366

Query  456  SAFQAFAICLSSFDTKIACE  397
            S FQAFAICLSSFDTK ACE
Sbjct  367  STFQAFAICLSSFDTKPACE  386



>ref|XP_010062111.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 ref|XP_010062112.1| PREDICTED: tubby-like F-box protein 8 [Eucalyptus grandis]
 gb|KCW69179.1| hypothetical protein EUGRSUZ_F02703 [Eucalyptus grandis]
 gb|KCW69180.1| hypothetical protein EUGRSUZ_F02703 [Eucalyptus grandis]
Length=424

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 102/152 (67%), Gaps = 21/152 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRS-------KSNRMDNFQSGPLSAQ---KDEILTLKNKA  646
            P     LP ++ DSF +  F +S        S+R  +   GP   +   KD  L LKNKA
Sbjct  274  PGQAELLPRSLEDSFRSISFSKSIDTSTEFSSSRFSDI-IGPRDEEDDGKDRYLVLKNKA  332

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVAS-MGDGVAP--------EHENVILQFGKVG  493
            P WHEQLQCWCLNF GRVTVASVKNFQL+A+      AP        +H+ +ILQFGKVG
Sbjct  333  PRWHEQLQCWCLNFRGRVTVASVKNFQLIAANQPSAGAPTPSQPAQSDHDKIILQFGKVG  392

Query  492  KDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  393  KDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  424



>gb|KEH20427.1| tubby-F-box-like protein [Medicago truncatula]
Length=412

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 99/141 (70%), Gaps = 10/141 (7%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQKD------EILTLKNKAPGWHE  631
            PT T    +  + F   P  + KS   D++ SG LS   +      + L LKNK+P WHE
Sbjct  273  PTPTSLPQIFSEPFPPSPALKEKSPMTDSY-SGCLSELPEPSQGSMDSLVLKNKSPRWHE  331

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASM--GDGVAP-EHENVILQFGKVGKDVFTMDYQYP  460
            QLQCWCLNF GRVTVASVKNFQLVAS+     V+P E E VILQFGK+GKD+FTMDY YP
Sbjct  332  QLQCWCLNFMGRVTVASVKNFQLVASVDPSHNVSPAEQERVILQFGKIGKDIFTMDYSYP  391

Query  459  ISAFQAFAICLSSFDTKIACE  397
            +SAFQAFAICL+SFDTK ACE
Sbjct  392  LSAFQAFAICLTSFDTKPACE  412



>ref|XP_002454421.1| hypothetical protein SORBIDRAFT_04g030550 [Sorghum bicolor]
 gb|EES07397.1| hypothetical protein SORBIDRAFT_04g030550 [Sorghum bicolor]
Length=433

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 99/146 (68%), Gaps = 13/146 (9%)
 Frame = -2

Query  798  RXPTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSAQ---------KDEILTLKNKA  646
            + PT T  +    +  ST P  + K   ++ F S  LSA           +  L LKNKA
Sbjct  289  KAPTPTGTIQSLDEPVSTSPSTKGKEVALE-FSSTSLSADLSGLALACANETPLVLKNKA  347

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APEHENVILQFGKVGKDVFTM  475
            P WHEQLQCWCLNF GRVTVASVKNFQLVAS+   +   A E E VILQFGK+GKD+FTM
Sbjct  348  PRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLNIPAAEQEKVILQFGKIGKDIFTM  407

Query  474  DYQYPISAFQAFAICLSSFDTKIACE  397
            DY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  408  DYRYPLSAFQAFAICLTSFDTKPACE  433



>ref|XP_002306697.1| hypothetical protein POPTR_0005s21450g [Populus trichocarpa]
 gb|EEE93693.1| hypothetical protein POPTR_0005s21450g [Populus trichocarpa]
Length=423

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 100/150 (67%), Gaps = 18/150 (12%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQS------GPLSAQ--KDEILTLKNKAPG  640
            P     LP ++ DSF +  F +S  N  +   S      GP   +  K+  L L+NKAP 
Sbjct  274  PGQAELLPRSLEDSFRSISFSKSIDNSTEFSSSRFSDIVGPREDEEGKERPLVLRNKAPR  333

Query  639  WHEQLQCWCLNFNGRVTVASVKNFQLVASM---------GDGVAPEHENVILQFGKVGKD  487
            WHEQLQCWCLNF GRVTVASVKNFQL+A+             V  +H+ +ILQFGKVGKD
Sbjct  334  WHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPVQSDHDKIILQFGKVGKD  393

Query  486  VFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            +FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  394  MFTMDYRYPLSAFQAFAICLSSFDTKLACE  423



>gb|ABK94204.1| unknown [Populus trichocarpa]
Length=423

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 100/150 (67%), Gaps = 18/150 (12%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQS------GPLSAQ--KDEILTLKNKAPG  640
            P     LP ++ DSF +  F +S  N  +   S      GP   +  K+  L L+NKAP 
Sbjct  274  PGQAELLPRSLEDSFRSISFSKSIDNSTEFSSSRFSDIVGPREDEEGKERPLVLRNKAPR  333

Query  639  WHEQLQCWCLNFNGRVTVASVKNFQLVASM---------GDGVAPEHENVILQFGKVGKD  487
            WHEQLQCWCLNF GRVTVASVKNFQL+A+             V  +H+ +ILQFGKVGKD
Sbjct  334  WHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPVQSDHDKIILQFGKVGKD  393

Query  486  VFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            +FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  394  MFTMDYRYPLSAFQAFAICLSSFDTKLACE  423



>gb|AAP40448.1| putative F-box containing tubby family protein [Arabidopsis thaliana]
Length=394

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQ  508
            +D+ L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D    EHE VILQ
Sbjct  297  RDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVAEIDASLDAPPEEHERVILQ  356

Query  507  FGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            F K+GKD+FTMDY+YP+SAFQAFAIC+SSFDTK ACE
Sbjct  357  FVKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACE  393



>ref|XP_009786613.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris]
 ref|XP_009786614.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris]
Length=412

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 98/140 (70%), Gaps = 9/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFS-TFPFFRSKSNRMD----NFQSGPLSAQKDEILTLKNKAPGWHEQ  628
            PT T F P + D  + + P  ++K + ++     F    ++    E L LKNKAP WHEQ
Sbjct  274  PTPTSF-PQSFDEKTFSAPLSKAKESAIEINSSGFSRSAVTVASQEPLVLKNKAPRWHEQ  332

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRVTVASVKNFQLVA++         E E VILQFGK+GKD+FTMDY+YP+
Sbjct  333  LQCWCLNFKGRVTVASVKNFQLVAAVDPSHNIPVAEQEKVILQFGKIGKDIFTMDYRYPL  392

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAFAICLSSFDTK ACE
Sbjct  393  SAFQAFAICLSSFDTKPACE  412



>ref|XP_002984539.1| hypothetical protein SELMODRAFT_181065 [Selaginella moellendorffii]
 gb|EFJ14589.1| hypothetical protein SELMODRAFT_181065 [Selaginella moellendorffii]
Length=430

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 11/140 (8%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA------QKDEILTLKNKAPGWHE  631
            PT T F     D+   FP  +SK   + +  + P+         KD  L LKNKAP WH+
Sbjct  294  PTPTVFANPLEDAQLPFPVSKSK---VSDCSTAPVVVPFSGVMSKDGPLVLKNKAPRWHD  350

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASM--GDGVAPEHENVILQFGKVGKDVFTMDYQYPI  457
            QLQCWCLNF GRVTVASVKNFQLVA++  G     +H+ V+LQFGK+GKD+FTMDY+YP+
Sbjct  351  QLQCWCLNFRGRVTVASVKNFQLVAALEPGQQAHADHDKVLLQFGKIGKDMFTMDYRYPL  410

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAF ICLSSFDTK+ACE
Sbjct  411  SAFQAFGICLSSFDTKLACE  430



>ref|XP_002965452.1| hypothetical protein SELMODRAFT_83983 [Selaginella moellendorffii]
 gb|EFJ32872.1| hypothetical protein SELMODRAFT_83983 [Selaginella moellendorffii]
Length=430

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 11/140 (8%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMDNFQSGPLSA------QKDEILTLKNKAPGWHE  631
            PT T F     D+   FP  +SK   + +  + P+         KD  L LKNKAP WH+
Sbjct  294  PTPTVFANPLEDAQLPFPVSKSK---VSDCSTAPVVVPYSGVMSKDGPLVLKNKAPRWHD  350

Query  630  QLQCWCLNFNGRVTVASVKNFQLVASM--GDGVAPEHENVILQFGKVGKDVFTMDYQYPI  457
            QLQCWCLNF GRVTVASVKNFQLVA++  G     +H+ V+LQFGK+GKD+FTMDY+YP+
Sbjct  351  QLQCWCLNFRGRVTVASVKNFQLVAALEPGQQAHADHDKVLLQFGKIGKDMFTMDYRYPL  410

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAF ICLSSFDTK+ACE
Sbjct  411  SAFQAFGICLSSFDTKLACE  430



>ref|XP_010531041.1| PREDICTED: tubby-like F-box protein 2 [Tarenaya hassleriana]
Length=397

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 3/93 (3%)
 Frame = -2

Query  666  LTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQFGKV  496
            L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA +    D  A EHE VILQFGK+
Sbjct  304  LVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDPSLDVPAEEHERVILQFGKI  363

Query  495  GKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GKD+FTMDY+YP+S FQAFAIC+SSFDTK ACE
Sbjct  364  GKDIFTMDYRYPLSTFQAFAICISSFDTKPACE  396



>ref|XP_009590675.1| PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis]
Length=411

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  672  EILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFG  502
            E L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+       A E E VILQFG
Sbjct  317  ESLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVASVDPSHNVPAEEQEKVILQFG  376

Query  501  KVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            K+GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  377  KIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE  411



>ref|XP_011101573.1| PREDICTED: tubby-like F-box protein 8 [Sesamum indicum]
Length=425

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 100/152 (66%), Gaps = 21/152 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDNFQSGPLS----------AQKDEILTLKNKA  646
            P     LP  + DSF +  F +S  N  + F S   S            KD+ L LKNK 
Sbjct  275  PGQPELLPRPLEDSFRSISFSKSIDNSTE-FSSARFSDTVGPREDDDGGKDKPLVLKNKP  333

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV-AP--------EHENVILQFGKVG  493
            P WHEQLQCWCLNF GRVTVASVKNFQL+A+M     AP        +H+ +ILQFGKVG
Sbjct  334  PRWHEQLQCWCLNFRGRVTVASVKNFQLIAAMQPAASAPTPSQPNQSDHDKIILQFGKVG  393

Query  492  KDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  394  KDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  425



>ref|XP_010260950.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
 ref|XP_010260951.1| PREDICTED: tubby-like F-box protein 8 [Nelumbo nucifera]
Length=422

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 102/151 (68%), Gaps = 20/151 (13%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRS-------KSNRMDNFQSGPLS--AQKDEILTLKNKAP  643
            P     LP ++ DSF +  F +S        S+R  +  +GP      K+  L L+NKAP
Sbjct  273  PGQPELLPRSLEDSFGSISFSKSIDHSTEFSSSRFSDI-AGPRDDDGGKERPLVLRNKAP  331

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV-AP--------EHENVILQFGKVGK  490
             WHEQLQCWCLNF GRVTVASVKNFQL+A+      AP        EH+ +ILQFGKVGK
Sbjct  332  RWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPTQSEHDKIILQFGKVGK  391

Query  489  DVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            D+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  392  DMFTMDYRYPLSAFQAFAICLSSFDTKLACE  422



>ref|XP_008440726.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
 ref|XP_008440727.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
 ref|XP_008440728.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
 ref|XP_008440729.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
 ref|XP_008440730.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
 ref|XP_008440731.1| PREDICTED: tubby-like F-box protein 5 [Cucumis melo]
Length=414

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 94/140 (67%), Gaps = 8/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMD-NFQSG----PLSAQKDEILTLKNKAPGWHEQ  628
            PT T F     D     P   SK  + D +F S     P   +  E L LKNKAP WHEQ
Sbjct  275  PTPTSFSSCLNDHHHHPPLPTSKGKKSDIDFSSTSITEPPVQELGESLVLKNKAPRWHEQ  334

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRVTVASVKNFQLVA +    D    E E +ILQFGK+GKD+FTMDY+YP+
Sbjct  335  LQCWCLNFRGRVTVASVKNFQLVADVDPALDVSVEEQEKIILQFGKIGKDIFTMDYRYPL  394

Query  456  SAFQAFAICLSSFDTKIACE  397
            SAFQAFAICLSSFDTK ACE
Sbjct  395  SAFQAFAICLSSFDTKPACE  414



>gb|EPS60718.1| hypothetical protein M569_14084, partial [Genlisea aurea]
Length=279

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 79/93 (85%), Gaps = 3/93 (3%)
 Frame = -2

Query  666  LTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMG---DGVAPEHENVILQFGKV  496
            L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVA++    D    E E VILQFGK+
Sbjct  187  LVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVDPSHDIPYAEQEKVILQFGKI  246

Query  495  GKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  247  GKDMFTMDYRYPVSAFQAFAICLSSFDTKPACE  279



>ref|XP_007156059.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
 ref|XP_007156060.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
 gb|ESW28053.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
 gb|ESW28054.1| hypothetical protein PHAVU_003G254900g [Phaseolus vulgaris]
Length=413

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 97/140 (69%), Gaps = 8/140 (6%)
 Frame = -2

Query  792  PTXTXFLPVNIDSFSTFPFFRSKSNRMD----NFQSGPLSAQ-KDEILTLKNKAPGWHEQ  628
            PT T F  +  + FS  P  + K    D    +    P+S+Q   E L LKNKAP WHEQ
Sbjct  274  PTPTSFPQIFDEPFSPSPAAKEKVPVPDLNSASLSEPPISSQVSTEQLALKNKAPRWHEQ  333

Query  627  LQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFGKVGKDVFTMDYQYPI  457
            LQCWCLNF GRV+VASVKNFQLVA++       A E + VILQFGK+GKD+FTMDY+YP+
Sbjct  334  LQCWCLNFKGRVSVASVKNFQLVAAVDPSHNISAEEQDKVILQFGKIGKDIFTMDYRYPL  393

Query  456  SAFQAFAICLSSFDTKIACE  397
            S FQAFAICLSSFDTK ACE
Sbjct  394  STFQAFAICLSSFDTKPACE  413



>ref|NP_001242468.1| uncharacterized protein LOC100803729 [Glycine max]
 gb|ACU18297.1| unknown [Glycine max]
Length=424

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 100/153 (65%), Gaps = 21/153 (14%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRM--------DNFQSGPLSAQ-KDEILTLKNKAP  643
            P     LP ++ DSF +  F RS  N          D F +G    Q KD  L LKNK+P
Sbjct  272  PGQPELLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFLAGKEEEQGKDRPLVLKNKSP  331

Query  642  GWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV--APE---------HENVILQFGKV  496
             WHEQLQCWCLNF GRVTVASVKNFQL+A+       AP          H+ +ILQFGKV
Sbjct  332  RWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPATGAPTPSSQPAQSGHDKIILQFGKV  391

Query  495  GKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            GKD+FTMDY+YP+SAFQAFAICL+SFDTK+ACE
Sbjct  392  GKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE  424



>gb|KDP38521.1| hypothetical protein JCGZ_04446 [Jatropha curcas]
Length=548

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = -2

Query  693  PLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGV---APEHE  523
            P+ +QKD  L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVA++       A E E
Sbjct  448  PICSQKDP-LVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPSQNVPAEEQE  506

Query  522  NVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             VILQFGK+GKD+FTMDY+YP+SAFQAFAICLSSFDTK ACE
Sbjct  507  KVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE  548



>ref|XP_002266692.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
 ref|XP_010657561.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera]
Length=424

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 100/154 (65%), Gaps = 26/154 (17%)
 Frame = -2

Query  792  PTXTXFLPVNI-DSFSTFPFFRSKSNRMDN---FQS-------GPLSAQ--KDEILTLKN  652
            P     LP  + DSF +  F    SN +D+   F S       GP   +  K   L LKN
Sbjct  275  PGQPELLPRALEDSFRSISF----SNSLDHSVEFSSSRFSEVCGPCDDEEGKARPLVLKN  330

Query  651  KAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA---------PEHENVILQFGK  499
            KAP WHEQLQCWCLNF GRVTVASVKNFQL+A+               PEH+ +ILQFGK
Sbjct  331  KAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAPPEHDKIILQFGK  390

Query  498  VGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            VGKD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  391  VGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  424



>ref|XP_006647762.1| PREDICTED: tubby-like F-box protein 5-like, partial [Oryza brachyantha]
Length=401

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 86/104 (83%), Gaps = 4/104 (4%)
 Frame = -2

Query  699  SGPLSAQKDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGD--GVAP-E  529
            SGP+    +  L LKNKAP WHEQLQCWCLNF GRVTVASVKNFQLVAS+    G+ P E
Sbjct  299  SGPVCTN-EVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASVDPSLGIPPAE  357

Query  528  HENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
             E VILQFGK+GKD+FTMDY+YP+SAFQAFAICL+SFDTK ACE
Sbjct  358  QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE  401



>ref|XP_004512053.1| PREDICTED: tubby-like F-box protein 5-like [Cicer arietinum]
Length=416

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -2

Query  672  EILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDG---VAPEHENVILQFG  502
            E L LKNK+P WHEQLQCWCLNF GRVTVASVKNFQLVA++       A E E VILQFG
Sbjct  322  ESLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVDPSHNVSAAEQEKVILQFG  381

Query  501  KVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            K+GKD+FTMDY+YPISAFQAFAICLSSFDTK ACE
Sbjct  382  KIGKDIFTMDYRYPISAFQAFAICLSSFDTKPACE  416



>gb|KFK38076.1| hypothetical protein AALP_AA3G066700 [Arabis alpina]
Length=383

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 92/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  768  VNIDSFSTF--PFFRSKSNRMDNFQSG-PLSAQ--KDEILTLKNKAPGWHEQLQCWCLNF  604
             +I SF T   PFFRS S  +    S   +S    +D  L L NK P WHEQL+CWCLNF
Sbjct  255  TSISSFPTRSSPFFRSHSKPVRGSNSSYSISGNNLRDPPLVLSNKTPRWHEQLRCWCLNF  314

Query  603  NGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLS  424
            +GRVTVASVKNFQLV+    G     E +ILQFGKVGKD+FTMDY YPISAFQAFAICLS
Sbjct  315  HGRVTVASVKNFQLVSVSDCGTEQPSERIILQFGKVGKDMFTMDYGYPISAFQAFAICLS  374

Query  423  SFDTKIACE  397
            SF+T+IACE
Sbjct  375  SFETRIACE  383



>ref|XP_010912431.1| PREDICTED: tubby-like F-box protein 14 [Elaeis guineensis]
 ref|XP_010912432.1| PREDICTED: tubby-like F-box protein 14 [Elaeis guineensis]
Length=432

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 100/152 (66%), Gaps = 25/152 (16%)
 Frame = -2

Query  777  FLPVNID-SFSTFPFFRSK---------SNRMDNFQSGP--LSAQKDEI----LTLKNKA  646
             LP ++D SF +  F +S          S+R      GP  +  ++DE     L L+NKA
Sbjct  281  LLPRSLDDSFRSMSFSKSSIMDRSMDFSSSRFSEIAGGPRGIGDEEDEAKERPLILRNKA  340

Query  645  PGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA---------PEHENVILQFGKVG  493
            P WHEQLQCWCLNF GRVTVASVKNFQL+A+               PEH+ ++LQFGKV 
Sbjct  341  PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAPPEHDKILLQFGKVA  400

Query  492  KDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            KD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  401  KDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  432



>ref|XP_002882466.1| hypothetical protein ARALYDRAFT_477941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58725.1| hypothetical protein ARALYDRAFT_477941 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 93/131 (71%), Gaps = 9/131 (7%)
 Frame = -2

Query  768  VNIDSFST--FPFFRS-----KSNRMDNFQSGPLSAQKDEILTLKNKAPGWHEQLQCWCL  610
             +I SFST   PFFRS     +SN      SG  +  +D  L L NK P WHEQL+CWCL
Sbjct  254  TSIRSFSTQSSPFFRSHSKPVRSNSASCSDSG--NNLRDPPLVLSNKTPRWHEQLRCWCL  311

Query  609  NFNGRVTVASVKNFQLVASMGDGVAPEHENVILQFGKVGKDVFTMDYQYPISAFQAFAIC  430
            NF+GRVTVASVKNFQLVA          E +ILQFGKVGKD+FTMDY YPISAFQAFAIC
Sbjct  312  NFHGRVTVASVKNFQLVAVSDCETGQPSERIILQFGKVGKDMFTMDYGYPISAFQAFAIC  371

Query  429  LSSFDTKIACE  397
            LSSF+T+IACE
Sbjct  372  LSSFETRIACE  382



>ref|XP_008218837.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume]
Length=252

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 9/103 (9%)
 Frame = -2

Query  678  KDEILTLKNKAPGWHEQLQCWCLNFNGRVTVASVKNFQLVASMGDGVA---------PEH  526
            K   L LKNK P WHEQLQCWCLNF GRVTVASVKNFQL+A+               PE 
Sbjct  150  KTRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPTPPEL  209

Query  525  ENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE  397
            + +ILQFGKVGKD+FTMDY+YP+SAFQAFAICLSSFDTK+ACE
Sbjct  210  DKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1646677518220