BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025B13

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086210.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    407   1e-138   Sesamum indicum [beniseed]
ref|XP_009802263.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    397   3e-136   Nicotiana sylvestris
ref|XP_010316565.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    400   5e-134   
sp|P21343.3|PFPB_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    400   2e-133   Solanum tuberosum [potatoes]
ref|XP_009610530.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    397   5e-133   
gb|EYU27733.1|  hypothetical protein MIMGU_mgv1a003746mg                398   9e-133   Erythranthe guttata [common monkey flower]
ref|NP_001275324.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    393   2e-131   Solanum tuberosum [potatoes]
ref|XP_011096009.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    391   7e-130   Sesamum indicum [beniseed]
ref|XP_002317176.2|  hypothetical protein POPTR_0011s01970g             382   3e-129   
ref|XP_004169324.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    389   4e-129   
ref|XP_010534010.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    380   6e-129   Tarenaya hassleriana [spider flower]
ref|XP_004134783.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    388   1e-128   Cucumis sativus [cucumbers]
emb|CDP04453.1|  unnamed protein product                                388   1e-128   Coffea canephora [robusta coffee]
ref|XP_007026197.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    388   1e-128   
gb|KJB67272.1|  hypothetical protein B456_010G184300                    383   4e-128   Gossypium raimondii
ref|XP_008440051.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    385   9e-128   Cucumis melo [Oriental melon]
gb|KJB67270.1|  hypothetical protein B456_010G184300                    382   9e-128   Gossypium raimondii
ref|XP_006449816.1|  hypothetical protein CICLE_v10014760mg             385   1e-127   Citrus clementina [clementine]
gb|KJB67271.1|  hypothetical protein B456_010G184300                    382   1e-127   Gossypium raimondii
gb|KDP20694.1|  hypothetical protein JCGZ_21165                         385   1e-127   Jatropha curcas
ref|XP_006357957.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    383   4e-127   Solanum tuberosum [potatoes]
gb|KJB67274.1|  hypothetical protein B456_010G184300                    383   6e-127   Gossypium raimondii
gb|KJB67269.1|  hypothetical protein B456_010G184300                    383   7e-127   Gossypium raimondii
ref|XP_010057883.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    383   8e-127   Eucalyptus grandis [rose gum]
emb|CDY30046.1|  BnaC05g09740D                                          383   8e-127   Brassica napus [oilseed rape]
ref|XP_009148623.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    383   1e-126   Brassica rapa
emb|CDX98086.1|  BnaA06g08370D                                          382   1e-126   
gb|AIE47260.1|  pyrophosphate-dependent phosphofructokinase             382   1e-126   Hevea brasiliensis [jebe]
ref|XP_004243522.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    382   2e-126   Solanum lycopersicum
ref|XP_008384258.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    370   2e-126   
gb|KDO78376.1|  hypothetical protein CISIN_1g008424mg                   382   3e-126   Citrus sinensis [apfelsine]
ref|XP_002317160.2|  pyrophosphate--fructose-6-phosphate 1-phosph...    382   3e-126   
gb|KCW75230.1|  hypothetical protein EUGRSUZ_E03983                     384   3e-126   Eucalyptus grandis [rose gum]
ref|XP_010476153.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    382   3e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010099150.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    381   3e-126   Morus notabilis
ref|NP_172664.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    380   7e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43462.1|  hypothetical protein AALP_AA1G128500                    380   8e-126   Arabis alpina [alpine rockcress]
gb|AAC17614.1|  Similar to pyrophosphate-dependent phosphofuctoki...    380   9e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KJB69226.1|  hypothetical protein B456_011G011600                    380   1e-125   Gossypium raimondii
gb|AAC67586.1|  pyrophosphate-dependent phosphofructokinase beta ...    380   1e-125   Citrus x paradisi [grapefruit]
gb|KJB69223.1|  hypothetical protein B456_011G011600                    380   1e-125   Gossypium raimondii
ref|XP_008224722.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    380   1e-125   Prunus mume [ume]
ref|XP_007211880.1|  hypothetical protein PRUPE_ppa003518mg             380   1e-125   Prunus persica
ref|XP_011002542.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    380   2e-125   Populus euphratica
ref|XP_010458622.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    380   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010252536.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    379   2e-125   Nelumbo nucifera [Indian lotus]
gb|KHN35710.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    373   2e-125   Glycine soja [wild soybean]
ref|XP_002892669.1|  hypothetical protein ARALYDRAFT_888516             379   3e-125   Arabidopsis lyrata subsp. lyrata
ref|XP_010546562.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    379   3e-125   Tarenaya hassleriana [spider flower]
gb|EPS65871.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    377   4e-125   Genlisea aurea
ref|XP_006307130.1|  hypothetical protein CARUB_v10008719mg             379   4e-125   Capsella rubella
sp|Q41141.1|PFPB_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    378   4e-125   Ricinus communis
ref|XP_002518416.1|  phosphofructokinase, putative                      378   5e-125   Ricinus communis
ref|XP_002271059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    378   6e-125   Vitis vinifera
ref|XP_010493617.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    378   7e-125   Camelina sativa [gold-of-pleasure]
ref|XP_006417279.1|  hypothetical protein EUTSA_v10007237mg             378   8e-125   Eutrema salsugineum [saltwater cress]
ref|XP_010533788.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    377   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_010244159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    377   2e-124   Nelumbo nucifera [Indian lotus]
ref|XP_010529462.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    377   2e-124   Tarenaya hassleriana [spider flower]
gb|EYU33871.1|  hypothetical protein MIMGU_mgv1a003790mg                377   2e-124   Erythranthe guttata [common monkey flower]
ref|XP_008458989.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    376   5e-124   Cucumis melo [Oriental melon]
ref|XP_004157729.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   9e-124   
ref|XP_004145428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   9e-124   Cucumis sativus [cucumbers]
ref|XP_009620787.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   1e-123   Nicotiana tomentosiformis
ref|XP_009788347.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   1e-123   Nicotiana sylvestris
emb|CDY34604.1|  BnaC08g41630D                                          373   1e-123   Brassica napus [oilseed rape]
ref|XP_003534704.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    374   2e-123   Glycine max [soybeans]
ref|XP_004965128.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    374   2e-123   Setaria italica
ref|XP_003529650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    374   2e-123   Glycine max [soybeans]
ref|XP_002269934.2|  PREDICTED: pyrophosphate--fructose 6-phospha...    374   2e-123   Vitis vinifera
ref|XP_006467368.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    373   5e-123   Citrus sinensis [apfelsine]
ref|XP_011047000.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    372   1e-122   Populus euphratica
ref|XP_003594152.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    372   2e-122   Medicago truncatula
ref|XP_004486196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    371   3e-122   Cicer arietinum [garbanzo]
ref|XP_008371161.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    367   4e-122   
ref|XP_003610482.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    371   4e-122   Medicago truncatula
ref|XP_002438147.1|  hypothetical protein SORBIDRAFT_10g008850          370   5e-122   Sorghum bicolor [broomcorn]
dbj|BAJ85690.1|  predicted protein                                      370   7e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007147679.1|  hypothetical protein PHAVU_006G145300g             370   7e-122   Phaseolus vulgaris [French bean]
ref|XP_009365098.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    370   1e-121   
dbj|BAK07581.1|  predicted protein                                      370   1e-121   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001168412.1|  ppi-phosphofructokinase                            370   1e-121   Zea mays [maize]
ref|XP_008805585.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    369   1e-121   Phoenix dactylifera
ref|XP_007153992.1|  hypothetical protein PHAVU_003G082000g             370   1e-121   Phaseolus vulgaris [French bean]
ref|XP_006383850.1|  hypothetical protein POPTR_0004s00550g             369   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_009391474.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   2e-121   
ref|XP_010686769.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    369   2e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010913416.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    369   3e-121   Elaeis guineensis
ref|XP_009408423.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   4e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391472.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   4e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379662.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   4e-121   
ref|XP_009414122.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   6e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003564006.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   7e-121   Brachypodium distachyon [annual false brome]
ref|XP_009356464.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   7e-121   Pyrus x bretschneideri [bai li]
gb|ABU82740.1|  pyrophosphate-fructose 6-phosphate 1-phosphotrasf...    358   8e-121   Nicotiana tabacum [American tobacco]
gb|AIE88316.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    367   8e-121   Eriobotrya japonica [loquat]
ref|XP_004305986.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    367   9e-121   Fragaria vesca subsp. vesca
ref|XP_009114586.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    367   2e-120   Brassica rapa
ref|XP_004507660.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    367   2e-120   Cicer arietinum [garbanzo]
ref|XP_003547272.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    367   2e-120   Glycine max [soybeans]
ref|XP_004293328.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    366   2e-120   Fragaria vesca subsp. vesca
ref|XP_007215516.1|  hypothetical protein PRUPE_ppa003662mg             366   2e-120   Prunus persica
ref|NP_001148574.1|  LOC100282190                                       366   3e-120   Zea mays [maize]
ref|XP_009357501.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    366   4e-120   Pyrus x bretschneideri [bai li]
gb|KFK30957.1|  hypothetical protein AALP_AA6G049400                    365   5e-120   Arabis alpina [alpine rockcress]
emb|CDX94541.1|  BnaC09g22950D                                          368   5e-120   
gb|ADZ96379.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    365   6e-120   Eriobotrya japonica [loquat]
ref|XP_008364088.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    365   8e-120   Malus domestica [apple tree]
ref|XP_008230005.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    366   9e-120   Prunus mume [ume]
ref|NP_192313.3|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    364   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433059.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    364   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010422248.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    364   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_004955203.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    363   3e-119   Setaria italica
ref|XP_010928237.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    363   3e-119   Elaeis guineensis
ref|XP_006826755.1|  hypothetical protein AMTR_s00136p00065750          363   3e-119   Amborella trichopoda
gb|AAC28214.1|  contains similarity to phosphofructokinases (Pfam...    364   4e-119   Arabidopsis thaliana [mouse-ear cress]
gb|EMS58307.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    362   5e-119   Triticum urartu
ref|XP_010422247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    364   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_007049157.1|  Phosphofructokinase family protein                 362   1e-118   
ref|XP_006287381.1|  hypothetical protein CARUB_v10000587mg             362   2e-118   Capsella rubella
ref|XP_010496159.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    362   2e-118   Camelina sativa [gold-of-pleasure]
gb|EMT25675.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    360   4e-118   
ref|NP_001057284.1|  Os06g0247500                                       360   8e-118   
ref|XP_010089437.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    359   9e-118   Morus notabilis
ref|XP_006656840.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    359   2e-117   Oryza brachyantha
emb|CDP11324.1|  unnamed protein product                                354   8e-116   Coffea canephora [robusta coffee]
ref|XP_010035533.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    351   2e-114   Eucalyptus grandis [rose gum]
ref|XP_006396719.1|  hypothetical protein EUTSA_v10028543mg             351   3e-114   Eutrema salsugineum [saltwater cress]
gb|KJB42857.1|  hypothetical protein B456_007G170900                    348   3e-113   Gossypium raimondii
ref|XP_002872678.1|  hypothetical protein ARALYDRAFT_490075             346   2e-112   
ref|XP_006447632.1|  hypothetical protein CICLE_v10014750mg             340   4e-112   
gb|KJB67273.1|  hypothetical protein B456_010G184300                    343   2e-111   Gossypium raimondii
gb|KDO54287.1|  hypothetical protein CISIN_1g008310mg                   342   5e-111   Citrus sinensis [apfelsine]
ref|XP_010529463.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    340   2e-110   Tarenaya hassleriana [spider flower]
ref|XP_006447633.1|  hypothetical protein CICLE_v10014750mg             341   2e-110   Citrus clementina [clementine]
ref|XP_002984967.1|  hypothetical protein SELMODRAFT_234662             337   4e-109   Selaginella moellendorffii
ref|XP_002986153.1|  hypothetical protein SELMODRAFT_234963             336   1e-108   Selaginella moellendorffii
ref|XP_008345810.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    313   9e-105   
gb|KDO54283.1|  hypothetical protein CISIN_1g042388mg                   324   8e-104   Citrus sinensis [apfelsine]
ref|XP_006469757.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    323   1e-103   Citrus sinensis [apfelsine]
ref|XP_006447627.1|  hypothetical protein CICLE_v10017788mg             323   3e-103   
ref|XP_001773466.1|  predicted protein                                  319   6e-102   
ref|XP_001774878.1|  predicted protein                                  316   7e-101   
gb|KHN03504.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    303   2e-97    Glycine soja [wild soybean]
ref|XP_001770321.1|  predicted protein                                  306   6e-97    
gb|KHG11353.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    303   6e-97    Gossypium arboreum [tree cotton]
gb|KHG16419.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    304   7e-97    Gossypium arboreum [tree cotton]
ref|XP_009609864.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    289   9e-96    Nicotiana tomentosiformis
gb|KHN40852.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    291   4e-92    Glycine soja [wild soybean]
gb|AET22421.1|  pyrophosphate-dependent phosphofructokinase             281   6e-91    Citrus maxima [buntan]
gb|AET22402.1|  pyrophosphate-dependent phosphofructokinase             278   5e-90    Citrus sinensis [apfelsine]
ref|XP_008384111.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    284   2e-88    
gb|ACS71752.1|  pyrophosphate-dependent phosphofructokinase             274   3e-88    Camellia sinensis [black tea]
gb|KJB69225.1|  hypothetical protein B456_011G011600                    276   2e-85    Gossypium raimondii
gb|KJB67275.1|  hypothetical protein B456_010G184300                    269   3e-83    Gossypium raimondii
emb|CDY31232.1|  BnaC08g15270D                                          262   1e-82    Brassica napus [oilseed rape]
gb|KJB69224.1|  hypothetical protein B456_011G011600                    262   1e-80    Gossypium raimondii
ref|XP_009788354.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    261   3e-80    Nicotiana sylvestris
gb|ADE76702.1|  unknown                                                 248   2e-79    Picea sitchensis
gb|ABL10096.1|  pyrophosphate-fructose-6-phosphate1-phosphotransf...    250   2e-79    Saccharum spontaneum [fodder cane]
ref|WP_009036818.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    241   6e-76    
ref|WP_006745515.1|  diphosphate--fructose-6-phosphate 1-phosphot...    251   6e-76    Bacteroides coprosuis
ref|XP_005652109.1|  pyrophosphate-fructose 6-phosphate 1-phospho...    247   1e-74    Coccomyxa subellipsoidea C-169
ref|XP_004340159.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    248   1e-74    Acanthamoeba castellanii str. Neff
ref|WP_018109477.1|  diphosphate--fructose-6-phosphate 1-phosphot...    246   5e-74    Bacteroides propionicifaciens
ref|WP_004307609.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    245   1e-73    Bacteroides
ref|WP_008648305.1|  diphosphate--fructose-6-phosphate 1-phosphot...    245   1e-73    Bacteroides sp. 3_1_23
ref|WP_009120576.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   3e-73    Bacteroides clarus
ref|WP_004297384.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   3e-73    Bacteroides ovatus
ref|WP_022043359.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   3e-73    
ref|WP_022217804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   3e-73    
ref|WP_005680621.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   3e-73    Bacteroides caccae
ref|WP_013548412.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   3e-73    Bacteroides helcogenes
ref|WP_005677832.1|  diphosphate--fructose-6-phosphate 1-phosphot...    244   4e-73    Bacteroides caccae
ref|WP_016661325.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    243   6e-73    Bacteroides stercoris
ref|WP_022103660.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    243   7e-73    Bacteroides stercoris
ref|WP_022275035.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   7e-73    
ref|WP_007758927.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   7e-73    Bacteroides finegoldii
ref|WP_007757428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   7e-73    Bacteroides finegoldii
ref|WP_004314973.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    243   7e-73    Bacteroides
ref|WP_024986627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   8e-73    Bacteroides acidifaciens
ref|WP_008021833.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    243   9e-73    Bacteroides
ref|WP_018669292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   9e-73    Bacteroides gallinarum
ref|WP_009123978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   1e-72    Bacteroides fluxus
ref|WP_010537577.1|  diphosphate--fructose-6-phosphate 1-phosphot...    243   1e-72    Bacteroides
ref|WP_016267907.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    243   1e-72    Bacteroides thetaiotaomicron
ref|WP_008760603.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    243   1e-72    Bacteroides
ref|WP_005826644.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    243   1e-72    Bacteroides
gb|EDS15317.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    243   1e-72    Bacteroides stercoris ATCC 43183
emb|CDA83182.1|  diphosphate--fructose-6-phosphate 1-phosphotrans...    242   2e-72    Bacteroides sp. CAG:754
ref|WP_002561703.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    242   2e-72    Bacteroides
ref|WP_005923725.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    242   2e-72    Bacteroides salyersiae
ref|WP_021846571.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    242   2e-72    
ref|WP_044468201.1|  diphosphate--fructose-6-phosphate 1-phosphot...    242   2e-72    Bacteroides uniformis
ref|WP_004292707.1|  diphosphate--fructose-6-phosphate 1-phosphot...    241   3e-72    Bacteroides eggerthii
ref|WP_022020075.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    241   6e-72    
ref|WP_025074602.1|  diphosphate--fructose-6-phosphate 1-phosphot...    241   7e-72    Bacteroides faecichinchillae
ref|WP_008144348.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    240   7e-72    Bacteroides coprophilus
ref|WP_004290431.1|  diphosphate--fructose-6-phosphate 1-phosphot...    240   9e-72    Bacteroides eggerthii
ref|WP_025831498.1|  diphosphate--fructose-6-phosphate 1-phosphot...    240   1e-71    Bacteroides stercorirosoris
ref|WP_013758252.1|  diphosphate--fructose-6-phosphate 1-phosphot...    240   1e-71    Treponema brennaborense
ref|WP_007570582.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    239   2e-71    Bacteroides coprocola
ref|WP_022130193.1|  hypothetical protein                               239   2e-71    
ref|WP_009131195.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    239   2e-71    Bacteroides oleiciplenus
ref|WP_021966993.1|  diphosphate--fructose-6-phosphate 1-phosphot...    239   3e-71    Bacteroides
ref|WP_007214428.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    239   3e-71    Bacteroides
ref|WP_044264258.1|  diphosphate--fructose-6-phosphate 1-phosphot...    239   3e-71    Bacteroides timonensis
ref|WP_022392567.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    239   3e-71    Bacteroides intestinalis
ref|WP_007663913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   4e-71    Bacteroides intestinalis
ref|WP_024752338.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   5e-71    Treponema phagedenis
ref|WP_005936237.1|  MULTISPECIES: diphosphate-fructose-6-phospha...    238   5e-71    Bacteroides
ref|WP_042372185.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   5e-71    Bacteroides neonati
ref|WP_021909550.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   6e-71    
ref|WP_027325820.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   7e-71    Bacteroides pyogenes
ref|WP_008979581.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   8e-71    Erysipelotrichaceae bacterium 5_2_54FAA
ref|WP_008689162.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   8e-71    Eubacterium
ref|WP_006843040.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   9e-71    Dysgonomonas mossii
ref|WP_022419924.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   1e-70    
dbj|GAE16760.1|  pyrophosphate-dependent fructose 6-phosphate-1-k...    237   1e-70    Bacteroides pyogenes JCM 6292
ref|WP_013968126.1|  diphosphate--fructose-6-phosphate 1-phosphot...    238   1e-70    Treponema caldarium
ref|WP_022499090.1|  pyrophosphate-dependent phosphofructokinase        237   1e-70    
ref|WP_002701079.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   1e-70    Treponema phagedenis
ref|WP_022023024.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   2e-70    
ref|WP_022458553.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   2e-70    
ref|WP_022231625.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   2e-70    
ref|WP_032945214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   2e-70    Bacteroides vulgatus
ref|WP_005846138.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    237   2e-70    Bacteroides
ref|WP_038605987.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   2e-70    
ref|WP_008652858.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    237   2e-70    Bacteroides
ref|WP_007842406.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    237   2e-70    Bacteroides
ref|WP_021916966.1|  diphosphate--fructose-6-phosphate 1-phosphot...    237   2e-70    
ref|WP_025017895.1|  diphosphate--fructose-6-phosphate 1-phosphot...    236   2e-70    Bacteroides sartorii
ref|WP_016276863.1|  MULTISPECIES: diphosphate-fructose-6-phospha...    236   3e-70    Bacteroides sartorii
ref|WP_022163440.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    236   3e-70    
ref|WP_007837134.1|  diphosphate--fructose-6-phosphate 1-phosphot...    236   3e-70    Bacteroides
ref|WP_021645136.1|  diphosphate--fructose-6-phosphate 1-phosphot...    236   4e-70    Bacteroides pyogenes
ref|WP_026625143.1|  diphosphate--fructose-6-phosphate 1-phosphot...    236   4e-70    Dysgonomonas capnocytophagoides
ref|WP_007658653.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    236   5e-70    Parabacteroides
ref|WP_022356272.1|  pyrophosphate-dependent phosphofructokinase        236   5e-70    Faecalitalea cylindroides
ref|WP_034542387.1|  diphosphate--fructose-6-phosphate 1-phosphot...    236   5e-70    Bacteroides pyogenes
emb|CBK24494.2|  unnamed protein product                                235   5e-70    Blastocystis hominis
ref|WP_026475518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    236   6e-70    Alkaliflexus imshenetskii
ref|WP_029901822.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   6e-70    Prevotella sp. 10(H)
ref|WP_024994586.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   7e-70    Bacteroides paurosaccharolyticus
ref|WP_028727537.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   7e-70    Parabacteroides
ref|WP_034931503.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   8e-70    Erysipelotrichaceae bacterium NK3D112
ref|WP_034449876.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   1e-69    Butyrivibrio sp. AE2032
ref|WP_022353894.1|  hypothetical protein                               235   1e-69    
ref|WP_021887993.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   1e-69    
ref|WP_019540988.1|  diphosphate--fructose-6-phosphate 1-phosphot...    235   1e-69    Proteiniphilum acetatigenes
ref|XP_005850148.1|  hypothetical protein CHLNCDRAFT_34452              236   1e-69    Chlorella variabilis
ref|WP_007561750.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    Bacteroides plebeius
ref|WP_022245848.1|  hypothetical protein                               234   2e-69    
ref|WP_035646621.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    Lachnospiraceae bacterium FE2018
ref|WP_021945700.1|  diphosphate/fructose-6-phosphate1-phosphotra...    234   2e-69    
ref|WP_014223699.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    Tannerella forsythia
ref|WP_006626998.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    Bulleidia extructa
ref|WP_022482432.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    
ref|WP_027435625.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    Lachnospiraceae bacterium AB2028
ref|WP_015535442.1|  pyrophosphate-dependent phosphofructokinase        234   2e-69    Faecalitalea cylindroides
ref|WP_022789788.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   2e-69    Faecalicoccus pleomorphus
ref|WP_022783344.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   3e-69    Lachnospiraceae bacterium NK4A179
ref|WP_028512698.1|  diphosphate--fructose-6-phosphate 1-phosphot...    234   3e-69    Ruminococcaceae bacterium AE2021
ref|WP_040451094.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   4e-69    Holdemania massiliensis
ref|WP_028507542.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   4e-69    Ruminococcaceae bacterium AB4001
ref|WP_025863645.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   4e-69    Prolixibacter bellariivorans
ref|WP_018358521.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   5e-69    Porphyromonas levii
gb|ADQ78315.1|  pyrophosphate-dependent phosphofructokinase             233   5e-69    Paludibacter propionicigenes WB4
ref|WP_041620527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   5e-69    Paludibacter propionicigenes
ref|WP_008771783.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   6e-69    Bacteroidales
ref|WP_041572541.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   6e-69    Candidatus Azobacteroides pseudotrichonymphae
ref|WP_016318768.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    233   7e-69    Firmicutes bacterium M10-2
ref|WP_044160982.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   7e-69    Bacteroides reticulotermitis
dbj|BAG83826.1|  pyrophosphate--fructose-6-phosphate 1-phosphotra...    233   7e-69    Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
ref|WP_037983302.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   8e-69    
ref|WP_006798230.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   1e-68    Dysgonomonas gadei
ref|WP_022442023.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   1e-68    
ref|WP_022458961.1|  diphosphate--fructose-6-phosphate 1-phosphot...    233   1e-68    
ref|WP_005647732.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   1e-68    Parabacteroides merdae
ref|WP_005640886.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   1e-68    
ref|WP_021864006.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   1e-68    
ref|WP_008145850.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    232   1e-68    
ref|WP_008158638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   1e-68    
ref|WP_027110374.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   2e-68    
ref|WP_027456161.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   2e-68    
ref|WP_027449768.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   2e-68    
ref|WP_022781712.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   2e-68    
ref|WP_022322946.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   2e-68    
ref|WP_004798470.1|  diphosphate--fructose-6-phosphate 1-phosphot...    232   2e-68    
ref|WP_036650726.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   2e-68    
ref|WP_036613717.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   2e-68    
ref|WP_005855923.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    231   2e-68    
gb|EEF66458.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    231   2e-68    
ref|WP_022040715.1|  diphosphate/fructose-6-phosphate 1-phosphotr...    231   2e-68    
ref|WP_021687206.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   3e-68    
ref|WP_021914328.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   4e-68    
ref|WP_039865086.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   4e-68    
ref|WP_024268710.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    231   4e-68    
ref|WP_044227866.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   4e-68    
ref|WP_032590268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   5e-68    
ref|WP_032583802.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   5e-68    
ref|WP_005788903.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    231   5e-68    
ref|WP_005798671.1|  diphosphate--fructose-6-phosphate 1-phosphot...    231   5e-68    
ref|WP_013617020.1|  diphosphate--fructose-6-phosphate 1-phosphot...    230   5e-68    
gb|EXZ67313.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    230   5e-68    
ref|WP_005815165.1|  diphosphate--fructose-6-phosphate 1-phosphot...    230   6e-68    
emb|CEA17138.1|  Pyrophosphate-fructose 6-phosphate 1-phosphotran...    230   8e-68    
ref|WP_022053735.1|  hypothetical protein                               230   8e-68    
ref|WP_037997392.1|  diphosphate--fructose-6-phosphate 1-phosphot...    230   8e-68    
ref|WP_027470899.1|  diphosphate--fructose-6-phosphate 1-phosphot...    230   9e-68    
ref|WP_021892263.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    229   9e-68    
ref|WP_022511727.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_005780146.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    229   1e-67    
ref|WP_028912949.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_018525631.1|  hypothetical protein                               229   1e-67    
ref|WP_020613720.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_013064630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_022454393.1|  phosphofructokinase                                229   1e-67    
ref|WP_010422435.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_028908471.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_035455514.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_028903737.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    229   1e-67    
ref|WP_015708501.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
ref|WP_028077990.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   1e-67    
gb|EPT34726.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    229   2e-67    
ref|WP_036911117.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   2e-67    
ref|WP_021903099.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    221   2e-67    
ref|WP_013314522.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   2e-67    
ref|WP_025278280.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   2e-67    
ref|WP_033149315.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   2e-67    
ref|WP_028973346.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   2e-67    
ref|WP_008861193.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   3e-67    
ref|WP_040627712.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   3e-67    
ref|WP_010663795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   3e-67    
ref|WP_024996790.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   3e-67    
ref|WP_022491531.1|  diphosphate--fructose-6-phosphate 1-phosphot...    229   3e-67    
ref|WP_022158214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   3e-67    
gb|EFW24308.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    229   3e-67    
ref|WP_022102965.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   4e-67    
ref|WP_036787718.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   5e-67    
ref|WP_016525088.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    228   5e-67    
ref|WP_036869019.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   6e-67    
ref|WP_019893247.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   6e-67    
ref|WP_015711192.1|  diphosphate--fructose-6-phosphate 1-phosphot...    228   6e-67    
ref|WP_036790212.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    228   6e-67    
ref|WP_022081702.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    227   7e-67    
ref|WP_005846772.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   7e-67    
ref|WP_027951653.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   8e-67    
ref|WP_036869025.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   1e-66    
ref|WP_007277807.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   1e-66    
ref|WP_040466458.1|  diphosphate--fructose-6-phosphate 1-phosphot...    218   1e-66    
ref|WP_009317720.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    227   1e-66    
ref|WP_014271836.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   1e-66    
ref|WP_014625405.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   1e-66    
ref|WP_028899167.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   1e-66    
gb|EEC89467.1|  putative diphosphate--fructose-6-phosphate 1-phos...    218   1e-66    
ref|WP_022328315.1|  diphosphate--fructose-6-phosphate 1-phosphot...    227   1e-66    
ref|WP_040561026.1|  diphosphate--fructose-6-phosphate 1-phosphot...    226   2e-66    
ref|WP_022480045.1|  diphosphate--fructose-6-phosphate 1-phosphot...    226   2e-66    
ref|XP_007026198.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    225   2e-66    
gb|EGV34403.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...    226   2e-66    
ref|WP_025070337.1|  diphosphate--fructose-6-phosphate 1-phosphot...    226   2e-66    
ref|WP_022111322.1|  diphosphate--fructose-6-phosphate 1-phosphot...    226   2e-66    
ref|WP_016562813.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    226   2e-66    
ref|WP_021931216.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    226   2e-66    
ref|WP_022351630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    226   3e-66    
ref|WP_022486127.1|  diphosphate--fructose-6-phosphate 1-phosphot...    226   3e-66    
ref|WP_021896515.1|  pyrophosphate-dependent phosphofructokinase        226   3e-66    
ref|WP_007902847.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    225   4e-66    
ref|WP_007574011.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   4e-66    
ref|WP_009437358.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   4e-66    
ref|WP_026285932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   5e-66    
ref|WP_004376175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   5e-66    
ref|WP_036890490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   5e-66    
ref|WP_009346441.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   5e-66    
ref|WP_006846630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   7e-66    
ref|WP_014455241.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   7e-66    
gb|EFB33295.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    225   7e-66    
ref|WP_022092267.1|  diphosphate--fructose-6-phosphate 1-phosphot...    225   7e-66    
ref|WP_008822440.1|  diphosphate--fructose-6-phosphate 1-phosphot...    224   8e-66    
ref|XP_005707151.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    225   8e-66    
ref|WP_016777789.1|  diphosphate--fructose-6-phosphate 1-phosphot...    224   9e-66    
ref|WP_038563379.1|  diphosphate--fructose-6-phosphate 1-phosphot...    224   1e-65    
ref|WP_013254833.1|  diphosphate--fructose-6-phosphate 1-phosphot...    224   1e-65    
ref|WP_018028382.1|  diphosphate--fructose-6-phosphate 1-phosphot...    224   2e-65    
ref|WP_022121202.1|  diphosphate--fructose-6-phosphate 1-phosphot...    224   2e-65    
ref|WP_044233209.1|  diphosphate--fructose-6-phosphate 1-phosphot...    223   2e-65    
ref|WP_010261490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    223   2e-65    
ref|WP_044190829.1|  diphosphate--fructose-6-phosphate 1-phosphot...    223   2e-65    
ref|WP_009010591.1|  diphosphate--fructose-6-phosphate 1-phosphot...    223   3e-65    
ref|WP_023983193.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    223   3e-65    
ref|WP_013265533.1|  diphosphate--fructose-6-phosphate 1-phosphot...    223   5e-65    
ref|WP_025790489.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_036865072.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_008622743.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_036925131.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_004370527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_021980053.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_004359492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_009161991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   7e-65    
ref|WP_008627564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   8e-65    
ref|WP_036851359.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   9e-65    
ref|WP_025079520.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   1e-64    
ref|WP_007172919.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   1e-64    
ref|WP_037547210.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   1e-64    
ref|WP_036877364.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   1e-64    
ref|WP_025004727.1|  diphosphate--fructose-6-phosphate 1-phosphot...    222   1e-64    
ref|WP_025067563.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   1e-64    
ref|WP_013672124.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   1e-64    
ref|WP_036854388.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   1e-64    
ref|WP_015423578.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   2e-64    
ref|WP_019967261.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   2e-64    
ref|WP_005467407.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   2e-64    
ref|WP_007133749.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   2e-64    
ref|WP_004383638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   2e-64    
ref|WP_018909818.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   3e-64    
ref|WP_009434216.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   3e-64    
ref|WP_036848678.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   3e-64    
gb|EKE04636.1|  hypothetical protein ACD_20C00035G0001                  221   3e-64    
ref|WP_036853877.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   3e-64    
ref|WP_036851063.1|  diphosphate--fructose-6-phosphate 1-phosphot...    221   3e-64    
ref|WP_025798196.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   4e-64    
ref|WP_039419596.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_022252312.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_028909804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_021677112.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_025839858.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_012415175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_039426896.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_039420029.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    220   5e-64    
ref|WP_013607434.1|  diphosphate--fructose-6-phosphate 1-phosphot...    220   5e-64    
ref|WP_026292223.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   6e-64    
ref|WP_021671600.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   6e-64    
ref|WP_028896044.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   6e-64    
ref|WP_044168564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   7e-64    
ref|WP_016410568.1|  diphosphate/fructose-6-phosphate1-phosphotra...    211   7e-64    
ref|WP_021662033.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   7e-64    
ref|WP_021663363.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   8e-64    
ref|WP_009227259.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   8e-64    
ref|WP_012457385.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   9e-64    
ref|WP_004583807.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   9e-64    
ref|WP_013815410.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   9e-64    
ref|WP_023847292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   9e-64    
ref|WP_025065627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   9e-64    
ref|WP_039876710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_044535858.1|  diphosphate--fructose-6-phosphate 1-phosphot...    208   1e-63    
ref|XP_005854316.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    224   1e-63    
ref|WP_009216741.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_010527175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_004353492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_024991268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_031534286.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    219   1e-63    
ref|WP_018966518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_009235627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    219   1e-63    
ref|WP_025881004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    218   2e-63    
ref|WP_021589756.1|  diphosphate--fructose-6-phosphate 1-phosphot...    218   2e-63    
gb|ERK00034.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    219   2e-63    
gb|EWM27417.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    225   2e-63    
ref|WP_018464632.1|  diphosphate--fructose-6-phosphate 1-phosphot...    218   3e-63    
ref|WP_023924546.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    217   5e-63    
ref|WP_004362686.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    217   6e-63    
ref|WP_007366298.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   6e-63    
ref|WP_004365932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   6e-63    
ref|WP_019188428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   6e-63    
ref|WP_022311541.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   7e-63    
ref|WP_024989602.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   7e-63    
ref|WP_022315998.1|  MULTISPECIES: phosphofructokinase                  217   8e-63    
ref|WP_021990869.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   8e-63    
ref|WP_022340120.1|  MULTISPECIES: hypothetical protein                 217   8e-63    
ref|WP_022150455.1|  phosphofructokinase                                216   8e-63    
ref|WP_044072458.1|  diphosphate--fructose-6-phosphate 1-phosphot...    217   8e-63    
ref|WP_008564004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    216   9e-63    
gb|KJF43929.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    216   1e-62    
ref|WP_025081450.1|  diphosphate--fructose-6-phosphate 1-phosphot...    216   1e-62    
ref|WP_014545075.1|  diphosphate--fructose-6-phosphate 1-phosphot...    216   2e-62    
ref|WP_021667347.1|  diphosphate--fructose-6-phosphate 1-phosphot...    216   2e-62    
ref|WP_006044710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    216   2e-62    
ref|WP_009229809.1|  diphosphate--fructose-6-phosphate 1-phosphot...    215   3e-62    
ref|WP_036829398.1|  diphosphate--fructose-6-phosphate 1-phosphot...    215   4e-62    
ref|WP_021947313.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   5e-62    
ref|WP_009433397.1|  diphosphate--fructose-6-phosphate 1-phosphot...    215   5e-62    
ref|WP_006255527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   5e-62    
ref|WP_044115791.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   5e-62    
ref|WP_006952714.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   6e-62    
ref|WP_022437430.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    214   6e-62    
ref|WP_004345857.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   6e-62    
ref|WP_036881252.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   6e-62    
ref|WP_036872035.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   7e-62    
ref|WP_018361565.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   7e-62    
ref|WP_025877362.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   7e-62    
ref|WP_022406493.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    214   8e-62    
ref|WP_023058711.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    214   9e-62    
ref|WP_014709913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   1e-61    
ref|XP_011402204.1|  ATP-dependent zinc metalloprotease FTSH 5, m...    219   1e-61    
ref|WP_028904978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    214   1e-61    
ref|WP_013182152.1|  diphosphate--fructose-6-phosphate 1-phosphot...    213   1e-61    
emb|CCB91524.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...    213   1e-61    
ref|WP_044654480.1|  diphosphate--fructose-6-phosphate 1-phosphot...    202   1e-61    
ref|WP_007412056.1|  diphosphate--fructose-6-phosphate 1-phosphot...    213   2e-61    
ref|WP_004340656.1|  diphosphate--fructose-6-phosphate 1-phosphot...    213   2e-61    



>ref|XP_011086210.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Sesamum indicum]
Length=404

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+AGVWK+KLTPQ LQLF+ LP AIQDQL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  191  ILAHDIVDEAGVWKKKLTPQSLQLFDFLPPAIQDQLMLERDPHGNVQVAKIETEKMLIQM  250

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE+R+Q  +Y GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL
Sbjct  251  VETELEVRKQGAAYKGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  310

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKF SMREEW
Sbjct  311  ISSVGNLAAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFVSMREEW  370

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRYLNPGPIQF+GP SD+VNHTLLLELG+
Sbjct  371  ALKNRYLNPGPIQFIGPASDKVNHTLLLELGS  402



>ref|XP_009802263.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like, partial [Nicotiana sylvestris]
Length=283

 Score =   397 bits (1020),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTPQCL+LFELLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  70   ILAHDVVDEAGVWKKKLTPQCLELFELLPLAIQEQLLLERDPHGNVQVAKIETEKMLIQM  129

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q G YN QFKGQSHFFGYEGRCGLPSNFD+TYCYALGYGAGALLQSGKTGL
Sbjct  130  VETELGQRKQKGGYNAQFKGQSHFFGYEGRCGLPSNFDSTYCYALGYGAGALLQSGKTGL  189

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  190  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASKREEW  249

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            AL NRY+NPGPIQFVGPV++++NHTLLLELG
Sbjct  250  ALNNRYINPGPIQFVGPVANKLNHTLLLELG  280



>ref|XP_010316565.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta-like [Solanum lycopersicum]
Length=513

 Score =   400 bits (1027),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTPQCL+LFELLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  300  ILAHDVVDEAGVWKKKLTPQCLELFELLPLAIQEQLLLERDPHGNVQVAKIETEKMLIQM  359

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G+YN QFKGQSHFFGYEGRCGLPSNFD+TYCYALGYGAG+LLQSGKTGL
Sbjct  360  VETELDQRKQKGAYNAQFKGQSHFFGYEGRCGLPSNFDSTYCYALGYGAGSLLQSGKTGL  419

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  420  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASKREEW  479

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY+NPGPIQFVGPV+++VNHTLLLELG 
Sbjct  480  ALNNRYINPGPIQFVGPVANKVNHTLLLELGV  511



>sp|P21343.3|PFPB_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Solanum tuberosum]
Length=569

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 203/211 (96%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTPQCL+LFELLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  356  ILAHDVVDEAGVWKKKLTPQCLELFELLPLAIQEQLLLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G+YN QFKGQSHFFGYEGRCGLPSNFD+TYCYALGYGAG+LLQSGKTGL
Sbjct  416  VETELDQRKQKGAYNAQFKGQSHFFGYEGRCGLPSNFDSTYCYALGYGAGSLLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASKREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            AL NRY+NPGPIQFVGPV+++VNHTLLLELG
Sbjct  536  ALNNRYINPGPIQFVGPVANKVNHTLLLELG  566



>ref|XP_009610530.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Nicotiana tomentosiformis]
Length=513

 Score =   397 bits (1020),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTPQCL+LFELLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  300  ILAHDVVDEAGVWKKKLTPQCLELFELLPLAIQEQLLLERDPHGNVQVAKIETEKMLIQM  359

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q G+YN QFKGQSHFFGYEGRCGLPSNFD+TYCYALGYGAG LLQSGKTGL
Sbjct  360  VETELGQRKQKGAYNAQFKGQSHFFGYEGRCGLPSNFDSTYCYALGYGAGTLLQSGKTGL  419

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  420  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASKREEW  479

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY+NPGPIQFVGPV++++NHTLLLELG 
Sbjct  480  ALNNRYINPGPIQFVGPVANKLNHTLLLELGV  511



>gb|EYU27733.1| hypothetical protein MIMGU_mgv1a003746mg [Erythranthe guttata]
Length=566

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTP  LQLF+LLP AIQDQL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEVVDEAGVWKKKLTPSSLQLFDLLPSAIQDQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELELR+Q  +Y GQFKGQSHFFGYEGRCGLPSNFD+TYCYALGY AGALL +GK+GL
Sbjct  413  VETELELRKQIAAYKGQFKGQSHFFGYEGRCGLPSNFDSTYCYALGYAAGALLNTGKSGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPVS+WTVGGT LTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKF SMREEW
Sbjct  473  ISSVGNLAAPVSEWTVGGTPLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFVSMREEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRYLNPGPIQFVGP SD +NHTLLLELGA
Sbjct  533  ALKNRYLNPGPIQFVGPASDNLNHTLLLELGA  564



>ref|NP_001275324.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Solanum tuberosum]
 gb|AAA63452.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase beta-subunit 
[Solanum tuberosum]
Length=513

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTPQCL+LFELLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  300  ILAHDVVDEAGVWKKKLTPQCLELFELLPLAIQEQLLLERDPHGNVQVAKIETEKMLIQM  359

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G+YN QFKGQ HFFGYEGRCGLPSNFD+TYCYALGYGAG+LLQSGKTGL
Sbjct  360  VETELDQRKQKGAYNAQFKGQFHFFGYEGRCGLPSNFDSTYCYALGYGAGSLLQSGKTGL  419

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV + TVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  420  ISSVGNLAAPVEELTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASKREEW  479

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY+NPGPIQFVGPV+++VNHTLLLELG 
Sbjct  480  ALNNRYINPGPIQFVGPVANKVNHTLLLELGV  511



>ref|XP_011096009.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta [Sesamum indicum]
Length=568

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+AG+WK+KLTPQ LQLF+ LP AIQDQL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDIVDEAGLWKKKLTPQSLQLFDFLPPAIQDQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL++R+Q  +Y GQFKGQSHFFGYEGRCGLPSNFDATYCYALGY AGALL SGKTGL
Sbjct  415  VETELDVRKQGATYKGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYAAGALLHSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV++W VGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF+KF SMRE+W
Sbjct  475  ISSVGNLAAPVAEWIVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFRKFVSMREDW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRYLNPGPIQFVGP + +VNHTLLLELGA
Sbjct  535  ALNNRYLNPGPIQFVGPTASKVNHTLLLELGA  566



>ref|XP_002317176.2| hypothetical protein POPTR_0011s01970g [Populus trichocarpa]
 gb|EEE97788.2| hypothetical protein POPTR_0011s01970g [Populus trichocarpa]
Length=370

 Score =   382 bits (982),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LAH VVD+ G WK+KLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  157  VLAHDVVDEGGQWKKKLTNQSLQLFEFLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  216

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALL SGKTGL
Sbjct  217  VETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLHSGKTGL  276

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  277  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  336

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP SD ++HTLLLELGA
Sbjct  337  ALKNRYISPGPIQFMGPGSDAISHTLLLELGA  368



>ref|XP_004169324.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cucumis sativus]
Length=567

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVDD G+WK+KLT Q L+LFELLPQAIQ+QL+LERDPHGNVQVA+IETEKMLIQM
Sbjct  354  ILAHDVVDDEGLWKKKLTSQSLELFELLPQAIQEQLMLERDPHGNVQVARIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G+Y GQFKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALLQSGKTGL
Sbjct  414  VETELEKRKSEGAYKGQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLQSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+R++W
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASLRDDW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A  NRY++PGPIQFVGP S+ VNHTLLLELG
Sbjct  534  AFNNRYISPGPIQFVGPASNAVNHTLLLELG  564



>ref|XP_010534010.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Tarenaya hassleriana]
Length=322

 Score =   380 bits (975),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD++G+WK+KLT Q L+LFE LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  110  ILAHEVVDESGLWKKKLTEQSLKLFEFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  169

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
             ETELE RRQ G+Y G+F GQSHFFGYEGRCGLP+NFDATYCYA+GY AGALL+SGKTGL
Sbjct  170  AETELEKRRQEGTYKGRFMGQSHFFGYEGRCGLPTNFDATYCYAIGYAAGALLRSGKTGL  229

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  230  ISSVGNLAAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  289

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF G  SD VNHTLLLELGA
Sbjct  290  ALKNRYISPGPIQFKGAGSDAVNHTLLLELGA  321



>ref|XP_004134783.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cucumis sativus]
 gb|KGN49075.1| hypothetical protein Csa_6G512900 [Cucumis sativus]
Length=567

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVDD G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVA+IETEKMLIQM
Sbjct  354  ILAHDVVDDEGLWKKKLTSQSLELFEFLPQAIQEQLMLERDPHGNVQVARIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G+Y GQFKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALLQSGKTGL
Sbjct  414  VETELEKRKSEGAYKGQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLQSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+R++W
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASLRDDW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A  NRY++PGPIQFVGP S+ VNHTLLLELG
Sbjct  534  AFNNRYISPGPIQFVGPASNAVNHTLLLELG  564



>emb|CDP04453.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+AG+WK+KL PQ L+LF+LLP AIQ+QL+LERDPHGNVQVAKIETEKM IQM
Sbjct  350  ILAHDEVDEAGLWKQKLQPQSLELFKLLPAAIQEQLMLERDPHGNVQVAKIETEKMFIQM  409

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y  QFKGQSHFFGYEGRCGLPSNFD+TYCYALGYGAGALLQSGKTGL
Sbjct  410  VETELENRKQAGAYKAQFKGQSHFFGYEGRCGLPSNFDSTYCYALGYGAGALLQSGKTGL  469

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFK+FAS+REEW
Sbjct  470  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKQFASLREEW  529

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQFVGP SD+VNHTLLLE GA
Sbjct  530  ALNNRYISPGPIQFVGPASDKVNHTLLLEFGA  561



>ref|XP_007026197.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta isoform 1 [Theobroma cacao]
 gb|EOY28819.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta isoform 1 [Theobroma cacao]
Length=567

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  354  ILAHDIVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q+GSY GQFKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  414  VETELDTRKQAGSYKGQFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL  PV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKF+SMREEW
Sbjct  474  ISSVGNLGTPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFSSMREEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQFVGPVS+ VNHTLLLELGA
Sbjct  534  ALKNCYISPGPIQFVGPVSNAVNHTLLLELGA  565



>gb|KJB67272.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=460

 Score =   383 bits (983),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  247  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  306

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  307  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  366

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  367  ISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  426

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KN Y++PGPIQFVGP S+ VNHTLLLELGA
Sbjct  427  ASKNCYISPGPIQFVGPASNAVNHTLLLELGA  458



>ref|XP_008440051.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Cucumis melo]
Length=567

 Score =   385 bits (990),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VDD G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVA+IETEKMLIQM
Sbjct  354  ILAHDIVDDEGLWKKKLTSQSLELFEFLPQAIQEQLMLERDPHGNVQVARIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G+Y  QFKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALLQSGKTGL
Sbjct  414  VETELEKRKSEGAYKAQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLQSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+R++W
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASLRDDW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A  NRY++PGPIQFVGP S+ VNHTLLLELG
Sbjct  534  AFNNRYISPGPIQFVGPASNAVNHTLLLELG  564



>gb|KJB67270.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=480

 Score =   382 bits (982),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  267  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  326

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  327  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  386

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  387  ISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  446

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KN Y++PGPIQFVGP S+ VNHTLLLELGA
Sbjct  447  ASKNCYISPGPIQFVGPASNAVNHTLLLELGA  478



>ref|XP_006449816.1| hypothetical protein CICLE_v10014760mg [Citrus clementina]
 gb|ESR63056.1| hypothetical protein CICLE_v10014760mg [Citrus clementina]
Length=566

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KLT Q LQLFE LPQAIQDQL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEVVDEGGQWKKKLTKQSLQLFEFLPQAIQDQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G   GQFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  413  VETELENRKQEGVNKGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV DWTV GTALT+LMDVERRHGKFKPVIKKAMVELDGAPFKKFASM++EW
Sbjct  473  ISSVGNLAAPVEDWTVSGTALTALMDVERRHGKFKPVIKKAMVELDGAPFKKFASMQDEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF GP S  VNHTLLLELGA
Sbjct  533  ALNNRYISPGPIQFTGPTSGDVNHTLLLELGA  564



>gb|KJB67271.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=487

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  274  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  333

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  334  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  393

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  394  ISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  453

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KN Y++PGPIQFVGP S+ VNHTLLLELGA
Sbjct  454  ASKNCYISPGPIQFVGPASNAVNHTLLLELGA  485



>gb|KDP20694.1| hypothetical protein JCGZ_21165 [Jatropha curcas]
Length=566

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA  VVD+ G+WKRKLT Q LQLFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAREVVDEGGLWKRKLTNQSLQLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY  QFKGQSHFFGYEGRCGLP+NFDA YCYALGYGAGALLQ+GKTGL
Sbjct  413  VETELEKRKQQGSYKAQFKGQSHFFGYEGRCGLPTNFDAMYCYALGYGAGALLQNGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+R+EW
Sbjct  473  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASLRDEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKNRYL+PGPIQF+GP SD V+HTLLLELG
Sbjct  533  ALKNRYLSPGPIQFMGPGSDAVSHTLLLELG  563



>ref|XP_006357957.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Solanum tuberosum]
Length=554

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH V+D+AG WK+KL  Q   LFELLPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  341  ILAHDVIDEAGSWKKKLQSQSHDLFELLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  400

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE ELE +R+ GSY  QFKGQSHFFGYEGRCGLPSNFD+ YCYALGYGAGALLQSGKTGL
Sbjct  401  VEAELESKRKEGSYTKQFKGQSHFFGYEGRCGLPSNFDSNYCYALGYGAGALLQSGKTGL  460

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV DWTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  461  ISSVGNLKAPVEDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  520

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY +PGP+QFVGP S++ NHTL+LELGA
Sbjct  521  ALKNRYFSPGPLQFVGPTSNETNHTLMLELGA  552



>gb|KJB67274.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=558

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  345  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  404

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  405  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  464

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  465  ISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  524

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KN Y++PGPIQFVGP S+ VNHTLLLELGA
Sbjct  525  ASKNCYISPGPIQFVGPASNAVNHTLLLELGA  556



>gb|KJB67269.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=566

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  413  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  473  ISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KN Y++PGPIQFVGP S+ VNHTLLLELGA
Sbjct  533  ASKNCYISPGPIQFVGPASNAVNHTLLLELGA  564



>ref|XP_010057883.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Eucalyptus grandis]
Length=568

 Score =   383 bits (984),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KL  Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDVVDEGGLWKKKLQTQSLELFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G FKGQSHFFGYEGRCGLP+NFD+TYCYALG+ AGALLQSGKTGL
Sbjct  415  VETELEKRKQEGTYKGNFKGQSHFFGYEGRCGLPTNFDSTYCYALGFAAGALLQSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NLAAP+S+WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFASMR+EW
Sbjct  475  ISSVANLAAPLSEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASMRDEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD VNHTLLLELGA
Sbjct  535  AIKNRYISPGPIQFNGPASDAVNHTLLLELGA  566



>emb|CDY30046.1| BnaC05g09740D [Brassica napus]
Length=566

 Score =   383 bits (983),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD++G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  354  ILANEVVDESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+GSY GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  414  VETELEKRKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  534  ALKNRYISPGPIQFTGPGSDALSHTLLLELGA  565



>ref|XP_009148623.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1 [Brassica rapa]
Length=566

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD++G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  354  ILANEVVDESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+GSY GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  414  VETELEKRKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  534  ALKNRYISPGPIQFTGPGSDALSHTLLLELGA  565



>emb|CDX98086.1| BnaA06g08370D [Brassica napus]
Length=566

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD++G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  354  ILANEVVDESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+GSY GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  414  VETELEKRKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  534  ALKNRYISPGPIQFTGPGSDALSHTLLLELGA  565



>gb|AIE47260.1| pyrophosphate-dependent phosphofructokinase, partial [Hevea brasiliensis]
Length=560

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA  VVD+ G+WK+KLT Q LQLFE LP AI++QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  347  ILARDVVDEGGLWKKKLTSQSLQLFEFLPLAIREQLMLERDPHGNVQVAKIETEKMLIQM  406

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY  QFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  407  VETELEKRKQQGSYKAQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  466

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTS+MDVERRHGKFKPVIKKAMVEL+GAPFKKFASMR+EW
Sbjct  467  ISSVGNLGAPVAEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELEGAPFKKFASMRDEW  526

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKNRY++PGPIQF+GP SD VNHTLLLELG
Sbjct  527  ALKNRYISPGPIQFMGPGSDAVNHTLLLELG  557



>ref|XP_004243522.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Solanum lycopersicum]
Length=554

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH V+D AG WK+KL  Q   LFELLPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  341  ILAHDVIDAAGSWKKKLQSQSRDLFELLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  400

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE ELE +R+ GSY  QFKGQSHFFGYEGRCGLPSNFD+ YCYALGYGAGALLQSGKTGL
Sbjct  401  VEAELESKRKEGSYTKQFKGQSHFFGYEGRCGLPSNFDSNYCYALGYGAGALLQSGKTGL  460

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV DWTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  461  ISSVGNLKAPVEDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  520

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY +PGP+QFVGP S++ NHTL+LELGA
Sbjct  521  ALKNRYFSPGPLQFVGPTSNETNHTLMLELGA  552



>ref|XP_008384258.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=229

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  14   ILAHEVVDEDGLWKKKLTSQSLELFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  73

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+LE RRQ GSYNGQF+GQSHFFGYEGRCG P+NFD+TYCYALGY AGALL SGKTGL
Sbjct  74   VETDLEKRRQEGSYNGQFQGQSHFFGYEGRCGFPTNFDSTYCYALGYAAGALLHSGKTGL  133

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  134  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  193

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  194  AINNRYISPGPIQFHGQASNALSHTLLLELG  224



>gb|KDO78376.1| hypothetical protein CISIN_1g008424mg [Citrus sinensis]
Length=566

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KLT Q LQLFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEVVDEGGQWKKKLTKQSLQLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G   GQFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  413  VETELENRKQEGVNKGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTV GTALT+LMDVERRHGKFKPVIKKAMVELDGAPFKKF SMR+EW
Sbjct  473  ISSVGNLAAPVEEWTVSGTALTALMDVERRHGKFKPVIKKAMVELDGAPFKKFVSMRDEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF GP S  VNHTLLLELGA
Sbjct  533  ALNNRYISPGPIQFTGPTSGDVNHTLLLELGA  564



>ref|XP_002317160.2| pyrophosphate--fructose-6-phosphate 1-phosphotransferase beta 
subunit family protein [Populus trichocarpa]
 gb|EEE97772.2| pyrophosphate--fructose-6-phosphate 1-phosphotransferase beta 
subunit family protein [Populus trichocarpa]
Length=565

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LAH VVD+ G WK+KLT Q LQLF+ LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  352  VLAHDVVDEGGQWKKKLTNQSLQLFDFLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  411

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALL SGKTGL
Sbjct  412  VETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLHSGKTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  472  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP SD ++HTLLLELGA
Sbjct  532  ALKNRYISPGPIQFMGPGSDAISHTLLLELGA  563



>gb|KCW75230.1| hypothetical protein EUGRSUZ_E03983 [Eucalyptus grandis]
Length=642

 Score =   384 bits (986),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KL  Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  429  ILAHDVVDEGGLWKKKLQTQSLELFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  488

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G FKGQSHFFGYEGRCGLP+NFD+TYCYALG+ AGALLQSGKTGL
Sbjct  489  VETELEKRKQEGTYKGNFKGQSHFFGYEGRCGLPTNFDSTYCYALGFAAGALLQSGKTGL  548

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NLAAP+S+WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFASMR+EW
Sbjct  549  ISSVANLAAPLSEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASMRDEW  608

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD VNHTLLLELGA
Sbjct  609  AIKNRYISPGPIQFNGPASDAVNHTLLLELGA  640



>ref|XP_010476153.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Camelina sativa]
Length=567

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  415  VETELEKRKQVGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLNSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV DWTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  475  ISSVGNLAAPVEDWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP S+ ++HTLLLELGA
Sbjct  535  ALKNRYISPGPIQFTGPGSEALSHTLLLELGA  566



>ref|XP_010099150.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
 gb|EXB77022.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
Length=565

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+ G+WK+KL  Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  352  ILAHDIVDEGGLWKKKLAEQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  411

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y G+FKGQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL+SGKTGL
Sbjct  412  VETELEKRKQAGAYKGEFKGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLRSGKTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAA V +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  472  ISSVGNLAARVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQFVGP S+ VNHTLLLELGA
Sbjct  532  ALKNRYISPGPIQFVGPSSNAVNHTLLLELGA  563



>ref|NP_172664.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase subunit 
beta 1 [Arabidopsis thaliana]
 sp|Q8W4M5.1|PFPB1_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1; Short=PFP 1; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 1; AltName: Full=PPi-PFK 
1; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
1 [Arabidopsis thaliana]
 gb|AAL32551.1| Similar to pyrophosphate-dependent phosphofuctokinase beta subunit 
[Arabidopsis thaliana]
 gb|AAM13259.1| similar to pyrophosphate-dependent phosphofuctokinase beta subunit 
[Arabidopsis thaliana]
 gb|AEE28825.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=566

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  354  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  414  VETELEKRKQAGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  534  ALKNRYISPGPIQFTGPGSDSLSHTLLLELGA  565



>gb|KFK43462.1| hypothetical protein AALP_AA1G128500 [Arabis alpina]
Length=565

 Score =   380 bits (977),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD++G WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILANEVVDESGAWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y GQF GQSHFFGYEGRCGLP+NFD+TYCYALGYGAG LL SGKTGL
Sbjct  413  VETELEKRKQAGTYKGQFMGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGVLLSSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV DWTVGGTALT+LMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+ EEW
Sbjct  473  ISSVGNLAAPVEDWTVGGTALTALMDVERRHGKFKPVIKKAMVELDGAPFKKFASLCEEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  533  ALKNRYISPGPIQFTGPGSDALSHTLLLELGA  564



>gb|AAC17614.1| Similar to pyrophosphate-dependent phosphofuctokinase beta subunit 
gb|Z32850 from Ricinus communis. ESTs gb|N65773, gb|N64925 
and gb|F15232 come from this gene [Arabidopsis thaliana]
Length=574

 Score =   380 bits (977),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  362  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  421

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  422  VETELEKRKQAGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  481

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  482  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  541

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  542  ALKNRYISPGPIQFTGPGSDSLSHTLLLELGA  573



>gb|KJB69226.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=557

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  344  ILAHDVVDEDGIWKKKLTNQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  403

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGA ALL SGKTGL
Sbjct  404  VETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAAALLHSGKTGL  463

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+RE+W
Sbjct  464  ISSVGNLGAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASVREDW  523

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQFVGP S+ V+HTLLLELGA
Sbjct  524  ALKNCYISPGPIQFVGPSSNAVSHTLLLELGA  555



>gb|AAC67586.1| pyrophosphate-dependent phosphofructokinase beta subunit [Citrus 
x paradisi]
Length=566

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KLT Q LQLFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEVVDEGGQWKKKLTKQSLQLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G   GQFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  413  VETELENRKQEGVNKGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTV GTALT+LMDVERRHGKFKPVIKKAMVELDG PFKKF SMR+EW
Sbjct  473  ISSVGNLAAPVEEWTVSGTALTALMDVERRHGKFKPVIKKAMVELDGTPFKKFVSMRDEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF GP S  VNHTLLLELGA
Sbjct  533  ALNNRYISPGPIQFTGPTSGDVNHTLLLELGA  564



>gb|KJB69223.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=566

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDEDGIWKKKLTNQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGA ALL SGKTGL
Sbjct  413  VETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAAALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+RE+W
Sbjct  473  ISSVGNLGAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASVREDW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQFVGP S+ V+HTLLLELGA
Sbjct  533  ALKNCYISPGPIQFVGPSSNAVSHTLLLELGA  564



>ref|XP_008224722.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Prunus mume]
Length=568

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK KLT Q LQLF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDVVDEGGLWKNKLTSQSLQLFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+LE RRQ GSYNGQFKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALL SGKTG+
Sbjct  415  VETDLEKRRQEGSYNGQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLHSGKTGV  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  475  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF GP S+ ++HTLLLELG
Sbjct  535  AINNRYISPGPIQFHGPASNALSHTLLLELG  565



>ref|XP_007211880.1| hypothetical protein PRUPE_ppa003518mg [Prunus persica]
 gb|EMJ13079.1| hypothetical protein PRUPE_ppa003518mg [Prunus persica]
Length=568

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK KLT Q LQLF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDVVDEGGLWKNKLTSQSLQLFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+LE RRQ GSYNGQFKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALL SGKTG+
Sbjct  415  VETDLEKRRQEGSYNGQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLHSGKTGV  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  475  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF GP S+ ++HTLLLELG
Sbjct  535  AINNRYISPGPIQFHGPASNALSHTLLLELG  565



>ref|XP_011002542.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit beta-like [Populus euphratica]
Length=568

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LAH VVD+ G WKRKLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  VLAHDVVDEGGQWKRKLTNQSLQLFEFLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G YN  FKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALL SGKTGL
Sbjct  415  VETELEKRKQIGQYNCIFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLHSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  475  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP SD ++HTLLLELGA
Sbjct  535  ALKNRYISPGPIQFMGPGSDAISHTLLLELGA  566



>ref|XP_010458622.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1 [Camelina sativa]
Length=567

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE+ELE R+Q G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  415  VESELEKRKQVGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLNSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV DWTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  475  ISSVGNLAAPVDDWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP S+ ++HTLLLELGA
Sbjct  535  ALKNRYISPGPIQFTGPGSEALSHTLLLELGA  566



>ref|XP_010252536.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Nelumbo nucifera]
Length=570

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAHGV+D+ G+WK+KL  Q  QLF  LP+AIQ+QLLLERDPHGNVQVAKIE+EKMLIQM
Sbjct  357  ILAHGVIDEDGLWKKKLRDQSQQLFLFLPKAIQEQLLLERDPHGNVQVAKIESEKMLIQM  416

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y GQFKGQSHFFGYEGRCG+P+NFD+TYCYALGYGAGALL SGKTGL
Sbjct  417  VETELEKRKQEGTYKGQFKGQSHFFGYEGRCGMPTNFDSTYCYALGYGAGALLHSGKTGL  476

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF+KFAS+REEW
Sbjct  477  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFRKFASLREEW  536

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KNRY++PGP+QF+GP S+ +NHTLLLELGA
Sbjct  537  AYKNRYISPGPVQFIGPSSNGINHTLLLELGA  568



>gb|KHN35710.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta, partial [Glycine soja]
Length=391

 Score =   373 bits (958),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+  VD+ G+WK+KLT Q L+LFE LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  178  ILANDAVDEGGLWKKKLTDQSLKLFEFLPKAIQEQLMLERDPHGNVQVAKIETEKMLIQM  237

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G F+GQSHFFGYEGRCGLP+NFD+TYCYALGYGA  +LQSGKTGL
Sbjct  238  VETELEKRKQQGTYKGGFRGQSHFFGYEGRCGLPTNFDSTYCYALGYGAATILQSGKTGL  297

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  298  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  357

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQF GP SD +NHTLLLELGA
Sbjct  358  ALKNCYISPGPIQFTGPGSDAINHTLLLELGA  389



>ref|XP_002892669.1| hypothetical protein ARALYDRAFT_888516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68928.1| hypothetical protein ARALYDRAFT_888516 [Arabidopsis lyrata subsp. 
lyrata]
Length=566

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  354  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  414  VETELEKRKQAGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  474  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  534  ALNNRYISPGPIQFTGPGSDALSHTLLLELGA  565



>ref|XP_010546562.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Tarenaya hassleriana]
Length=565

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LP+ IQ+QL+LERDPHGNVQVAKIETEKMLI+M
Sbjct  353  ILAHEVVDENGLWKKKLTEQSLKLFEFLPETIQEQLMLERDPHGNVQVAKIETEKMLIEM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RRQ G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGY AGALL SGKTGL
Sbjct  413  VETELEKRRQKGTYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYAAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV++WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL GAPFKKFA+ REEW
Sbjct  473  ISSVGNLAAPVAEWTVGGTALTALMDVERRHGKFKPVIKKAMVELQGAPFKKFAAEREEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD +NHTLLLELGA
Sbjct  533  ALKNRYISPGPIQFKGPGSDAINHTLLLELGA  564



>gb|EPS65871.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta, partial [Genlisea aurea]
Length=504

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+  VWK+KLTPQC QLF+LLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  290  ILAHDVVDEGSVWKKKLTPQCQQLFDLLPPAIQEQLLLERDPHGNVQVAKIETEKMLIQM  349

Query  556  VETELELRRQSGSYNGQF-KGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTG  380
            VETELELR+Q G Y GQF KGQSHFFGYEGRCGLPSNFDA+YCYALGY AGALL +GKTG
Sbjct  350  VETELELRKQGGGYRGQFFKGQSHFFGYEGRCGLPSNFDASYCYALGYAAGALLDNGKTG  409

Query  379  LISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREE  200
            LISSV NLA P S+W +GGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKF+S+REE
Sbjct  410  LISSVVNLAGPASEWVLGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFSSLREE  469

Query  199  WALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            WAL NRY++PGPIQF+G  SD+VNHTLLLELGA
Sbjct  470  WALNNRYISPGPIQFMGSESDKVNHTLLLELGA  502



>ref|XP_006307130.1| hypothetical protein CARUB_v10008719mg [Capsella rubella]
 gb|EOA40028.1| hypothetical protein CARUB_v10008719mg [Capsella rubella]
Length=567

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILANEVVDEDGLWKKKLTEQSLKLFDLLPAAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+G+Y G F GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  415  VETELEKRKQAGAYKGNFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV DWTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  475  ISSVGNLAAPVEDWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  535  ALKNRYISPGPIQFTGPGSDALSHTLLLELGA  566



>sp|Q41141.1|PFPB_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Ricinus communis]
 emb|CAA83683.1| pyrophosphate-dependent phosphofructokinase beta subunit [Ricinus 
communis]
Length=552

 Score =   378 bits (971),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  339  ILAHDVVDEGGLWKKKLTSQSLQLFEFLPVAIQEQLMLERDPHGNVQVAKIETEKMLIQM  398

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y   FKGQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  399  VETELEKRKQQGTYKAHFKGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  458

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  459  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  518

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP SD  +HTLLLELG+
Sbjct  519  ALKNRYVSPGPIQFMGPGSDAASHTLLLELGS  550



>ref|XP_002518416.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF43803.1| phosphofructokinase, putative [Ricinus communis]
Length=552

 Score =   378 bits (970),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  339  ILAHDVVDEGGLWKKKLTSQSLQLFEFLPVAIQEQLMLERDPHGNVQVAKIETEKMLIQM  398

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y   FKGQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  399  VETELEKRKQQGTYKAHFKGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  458

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  459  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  518

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP SD  +HTLLLELG+
Sbjct  519  ALKNRYVSPGPIQFMGPGSDAASHTLLLELGS  550



>ref|XP_002271059.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Vitis vinifera]
 emb|CBI28853.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KL  Q  QLF+ LPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  350  ILAHDVVDEGGQWKKKLRNQSQQLFDFLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  409

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            V+TELE RRQ  SYNG+F GQSHFFGYEGRCGLP+NFDA YCYALGYGAGALL SGKTGL
Sbjct  410  VDTELEKRRQEHSYNGKFNGQSHFFGYEGRCGLPTNFDANYCYALGYGAGALLHSGKTGL  469

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  470  ISSVGNLGAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  529

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGP+QFVGP ++++NHTL+LELGA
Sbjct  530  ALKNRYVSPGPVQFVGPTANEINHTLMLELGA  561



>ref|XP_010493617.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Camelina sativa]
Length=567

 Score =   378 bits (971),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  415  VETELEKRKQVGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLNSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV DWTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFA +REEW
Sbjct  475  ISSVGNLAAPVDDWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFALLREEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP S+ ++HTLLLELGA
Sbjct  535  ALKNRYISPGPIQFTGPGSEALSHTLLLELGA  566



>ref|XP_006417279.1| hypothetical protein EUTSA_v10007237mg [Eutrema salsugineum]
 gb|ESQ35632.1| hypothetical protein EUTSA_v10007237mg [Eutrema salsugineum]
Length=565

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD+ G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILANEVVDENGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  413  VETELEKRKQVGAYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  473  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++HTLLLELGA
Sbjct  533  ALKNRYISPGPIQFSGPGSDALSHTLLLELGA  564



>ref|XP_010533788.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1 [Tarenaya hassleriana]
Length=565

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD++G+WK+KLT Q L+LFE LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEVVDESGLWKKKLTEQSLKLFEFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
             ETELE RRQ G+Y G+F GQSHFFGYEGRCGLP+NFDATYCYALGY AGALL+SGKTGL
Sbjct  413  AETELEKRRQEGTYKGRFMGQSHFFGYEGRCGLPTNFDATYCYALGYAAGALLRSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV++WTVGGTALTSLMDVERRHGKFKPVIKKAM EL+GAPFKKFAS REEW
Sbjct  473  ISSVGNLAAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMGELEGAPFKKFASQREEW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF G  SD VNHTLLLELGA
Sbjct  533  ALKNRYISPGPIQFKGAGSDAVNHTLLLELGA  564



>ref|XP_010244159.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Nelumbo nucifera]
Length=570

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+ L  Q   LFE LP+AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  357  ILAHDVVDEGGLWKKNLQHQSQLLFEFLPRAIQEQLLLERDPHGNVQVAKIETEKMLIQM  416

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G+FKGQSHFFGYEGRCGLP+NFD+TYCYALGYGA ALL  GKTGL
Sbjct  417  VETELEKRKQEGTYKGEFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAAALLHFGKTGL  476

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPF+KFASMREEW
Sbjct  477  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFRKFASMREEW  536

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KNRY++PGP+QF+GP SD +NHTLLLELGA
Sbjct  537  AYKNRYISPGPVQFIGPHSDDINHTLLLELGA  568



>ref|XP_010529462.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like isoform X1 [Tarenaya hassleriana]
Length=569

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  +D+ G WK+KL  Q L+LFE LP+ IQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHETIDEEGQWKKKLKEQSLKLFEFLPRTIQEQLLLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R Q G+Y G+FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAG LLQSGKTGL
Sbjct  415  VETELEKRNQEGTYKGEFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLQSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVEL+GAPFKKF S REEW
Sbjct  475  ISSVGNLAAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELEGAPFKKFESQREEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD VNHTLLLELGA
Sbjct  535  AMKNRYISPGPIQFKGPGSDAVNHTLLLELGA  566



>gb|EYU33871.1| hypothetical protein MIMGU_mgv1a003790mg [Erythranthe guttata]
Length=564

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+AG WK+KLT    QLF+LLP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  351  ILAHETVDEAGAWKKKLTTPSHQLFDLLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE+R+++ +Y G FKGQ HFFGYEGRCGLPSNFD+TYCYALGYGAGALL SG+TGL
Sbjct  411  VETELEVRKKAAAYKGDFKGQPHFFGYEGRCGLPSNFDSTYCYALGYGAGALLHSGRTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKF S+REEW
Sbjct  471  ISSVANLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFVSLREEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY+NPGPIQFVGP SD ++HTLLLE+G+
Sbjct  531  ALKNRYINPGPIQFVGPASDTLSHTLLLEIGS  562



>ref|XP_008458989.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cucumis melo]
Length=569

 Score =   376 bits (965),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH ++D+ G+WK+ LT Q   LF+  PQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDIMDEDGLWKKNLTTQSHHLFDFFPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNG-QFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTG  380
            VETELE RRQ GSYNG +FKGQSHFFGYEGRCGLP+NFD+TYCYALGY AGALLQ+GKTG
Sbjct  415  VETELEKRRQEGSYNGGEFKGQSHFFGYEGRCGLPTNFDSTYCYALGYTAGALLQNGKTG  474

Query  379  LISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREE  200
            LISSVGNLAAPV DWT GGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKF+S+RE+
Sbjct  475  LISSVGNLAAPVEDWTAGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFSSLREQ  534

Query  199  WALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            WA+KN+Y++PGPIQFVGP S+ +NHTLLLELGA
Sbjct  535  WAVKNQYISPGPIQFVGPASNVINHTLLLELGA  567



>ref|XP_004157729.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Cucumis sativus]
Length=569

 Score =   375 bits (963),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH ++D+ G+WK+ LT Q   LF+  PQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDIIDEDGLWKKNLTTQSHHLFDFFPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNG-QFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTG  380
            VE ELE RRQ G+YNG QFKGQSHFFGYEGRCGLP+NFD+TYCYALGY AGALLQ+GKTG
Sbjct  415  VEIELEKRRQEGAYNGGQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYTAGALLQNGKTG  474

Query  379  LISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREE  200
            LISSVGNLAAPV DWT GGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKF+S+RE+
Sbjct  475  LISSVGNLAAPVEDWTAGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFSSLREQ  534

Query  199  WALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            WA+KN+Y++PGPIQFVGP S+ +NHTLLLELGA
Sbjct  535  WAVKNQYISPGPIQFVGPASNVINHTLLLELGA  567



>ref|XP_004145428.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Cucumis sativus]
 gb|KGN66845.1| hypothetical protein Csa_1G701210 [Cucumis sativus]
Length=569

 Score =   375 bits (963),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH ++D+ G+WK+ LT Q   LF+  PQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDIIDEDGLWKKNLTTQSHHLFDFFPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNG-QFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTG  380
            VE ELE RRQ G+YNG QFKGQSHFFGYEGRCGLP+NFD+TYCYALGY AGALLQ+GKTG
Sbjct  415  VEIELEKRRQEGAYNGGQFKGQSHFFGYEGRCGLPTNFDSTYCYALGYTAGALLQNGKTG  474

Query  379  LISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREE  200
            LISSVGNLAAPV DWT GGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKF+S+RE+
Sbjct  475  LISSVGNLAAPVEDWTAGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFSSLREQ  534

Query  199  WALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            WA+KN+Y++PGPIQFVGP S+ +NHTLLLELGA
Sbjct  535  WAVKNQYISPGPIQFVGPASNVINHTLLLELGA  567



>ref|XP_009620787.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like [Nicotiana 
tomentosiformis]
Length=557

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ V+D+ G WK+KL  Q  +LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  344  ILANDVIDEGGNWKKKLRSQSHELFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  403

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE ELE +R+ GSY   FKGQSHFFGYEGRCGLPS+FD+ YCYALGYGAGALL SGKTGL
Sbjct  404  VEAELENKRKEGSYTKHFKGQSHFFGYEGRCGLPSSFDSNYCYALGYGAGALLHSGKTGL  463

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV DWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  464  ISSVGNLGAPVEDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  523

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY +PGP+QFVGP S+++NHTL+LELGA
Sbjct  524  ALKNRYFSPGPLQFVGPTSNEINHTLMLELGA  555



>ref|XP_009788347.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ V+D+AG WK+KL  Q  +LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  344  ILANDVIDEAGNWKKKLRSQSHELFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  403

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE ELE +R+  SY   FKGQSHFFGYEGRCGLPSNFD+ YCYALGYGAGALL SGKTGL
Sbjct  404  VEAELENKRKESSYTKHFKGQSHFFGYEGRCGLPSNFDSNYCYALGYGAGALLHSGKTGL  463

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV DWTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+REEW
Sbjct  464  ISSVGNLGAPVEDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLREEW  523

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY +PGP+QFVGP S+++NHTL+LELGA
Sbjct  524  ALKNRYFSPGPLQFVGPTSNEINHTLMLELGA  555



>emb|CDY34604.1| BnaC08g41630D [Brassica napus]
Length=507

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD++G+WK+KLT Q L+LF+LLP+AIQ+QL+LERDPHGNVQVAKIE EKMLIQM
Sbjct  295  ILANEVVDESGLWKKKLTEQSLKLFDLLPEAIQEQLMLERDPHGNVQVAKIEPEKMLIQM  354

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q+GSY GQF GQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  355  VETELEKRKQAGSYKGQFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  414

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFK VIKKAMVEL+GAPFKKFAS+REEW
Sbjct  415  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKHVIKKAMVELEGAPFKKFASLREEW  474

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKNRY++PGPIQF GP SD ++HTLLLELG
Sbjct  475  ALKNRYISPGPIQFSGPGSDALSHTLLLELG  505



>ref|XP_003534704.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
Length=562

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+ G+WK+KLT Q L+LF+ LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  349  ILAHDTVDEGGLWKKKLTDQSLKLFDFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G Y G+FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  409  VETELEKRKQEGKYKGEFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  469  ISSVGNLCAPVKEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQF GP S+ +NHTLLLEL A
Sbjct  529  ALKNCYISPGPIQFSGPGSEVINHTLLLELEA  560



>ref|XP_004965128.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Setaria italica]
Length=564

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+  QLF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  351  ILAHDVVDEAGAWKSKLEPESRQLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLITM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y+  F+GQSHFFGYEGRCGLP+NFD++YCYALGYG+GALLQSGKTGL
Sbjct  411  VETELEKRKAEGRYHASFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGSGALLQSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMR+EW
Sbjct  471  ITSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMRDEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  531  AIKNRYISPGPIQFSGPGSDDSNHTLMLELGA  562



>ref|XP_003529650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
Length=568

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+  VD+ G+WK+KLT Q L+LFE LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILANDAVDEGGLWKKKLTDQSLKLFEFLPKAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G F+GQSHFFGYEGRCGLP+NFD+TYCYALGYGA ALLQSGKTGL
Sbjct  415  VETELEKRKQQGTYKGGFRGQSHFFGYEGRCGLPTNFDSTYCYALGYGAAALLQSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  475  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQF GP SD +NHTLLLELGA
Sbjct  535  ALKNCYISPGPIQFTGPGSDAINHTLLLELGA  566



>ref|XP_002269934.2| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Vitis vinifera]
 emb|CBI33004.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 193/214 (90%), Gaps = 2/214 (1%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VDDAG+WK+KLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  350  ILAHEIVDDAGLWKKKLTNQSLQLFEFLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  409

Query  556  VETELELRRQSGSYN--GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKT  383
            VETELE R+  G+Y   G FKGQSHFFGYEGRCG P+NFDA YCYALG+ AGALL  GKT
Sbjct  410  VETELEKRKSEGTYKYKGHFKGQSHFFGYEGRCGFPTNFDAAYCYALGFAAGALLHCGKT  469

Query  382  GLISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMRE  203
            GLISSVGNL+APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMR+
Sbjct  470  GLISSVGNLSAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMRD  529

Query  202  EWALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            EWALKN+Y++PGPIQF GP S+ VNHTLLLELGA
Sbjct  530  EWALKNQYISPGPIQFNGPASNDVNHTLLLELGA  563



>ref|XP_006467368.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Citrus sinensis]
 gb|ABY25306.1| pyrophosphate-dependent phosphofructokinase beta subunit [Citrus 
sinensis x Citrus trifoliata]
Length=565

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KLT Q LQLFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEVVDEGGQWKKKLTKQSLQLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE  R+ G   GQFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  413  VETELE-NRKKGVNKGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTV GTALT+LMDVERRHGKFKPVIKKAMVELDGAPFKKF SMR+EW
Sbjct  472  ISSVGNLAAPVEEWTVSGTALTALMDVERRHGKFKPVIKKAMVELDGAPFKKFVSMRDEW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF GP S  VN+TLLLELGA
Sbjct  532  ALNNRYISPGPIQFTGPTSGDVNNTLLLELGA  563



>ref|XP_011047000.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Populus euphratica]
Length=561

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  348  ILAHDVVDEDGLWKKKLTNQSLQLFEFLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  407

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G YN  FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  408  VETELEKRKQLGQYNCIFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  467

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+G PFKKF S++ EW
Sbjct  468  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGGPFKKFESLKNEW  527

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+ NRY++PGPIQF+GP SD ++HTLLLELGA
Sbjct  528  AINNRYISPGPIQFIGPGSDAISHTLLLELGA  559



>ref|XP_003594152.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase subunit 
beta [Medicago truncatula]
 gb|ABD32662.1| Pyrophosphate-dependent phosphofructokinase PfpB [Medicago truncatula]
 gb|AES64403.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=565

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLI+M
Sbjct  352  ILAHETVDEGGLWKKKLTDQSLELFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIEM  411

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q G YNG+FKGQSHFFGYEGRCGLP+NFDA YCYALGYGAGALL SGKTGL
Sbjct  412  VETELGKRKQEGKYNGEFKGQSHFFGYEGRCGLPTNFDANYCYALGYGAGALLHSGKTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  472  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKN Y +PGPIQF GP SD V+HTLLLE G
Sbjct  532  ALKNCYTSPGPIQFTGPGSDAVSHTLLLESG  562



>ref|XP_004486196.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Cicer arietinum]
Length=562

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+ G+WK+KL  Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLI+M
Sbjct  351  ILAHDIVDEGGLWKKKLADQSLELFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIEM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q G Y G+FKGQSHFFGYEGRCGLP+NFDA YCYALGYGAGALLQSGKTGL
Sbjct  411  VETELGKRKQEGKYKGEFKGQSHFFGYEGRCGLPTNFDANYCYALGYGAGALLQSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  471  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKN Y++PGPIQF GP SD V+HTLLLE G
Sbjct  531  ALKNCYVSPGPIQFTGPGSDAVSHTLLLESG  561



>ref|XP_008371161.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=430

 Score =   367 bits (941),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  217  ILAHEVVDEDGLWKKKLTSQSLELFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  276

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+L  R+Q GSYNG F+GQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  277  VETDLAKRKQEGSYNGHFQGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  336

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  337  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  396

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  397  AINNRYISPGPIQFHGQASNALSHTLLLELG  427



>ref|XP_003610482.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase subunit 
beta [Medicago truncatula]
 gb|AES92679.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=569

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+ G+WK KLT Q L+LFE LP++IQ+QL+LERDPHGNVQVAKIETEKM IQM
Sbjct  356  ILAHETVDEGGLWKMKLTDQSLKLFEFLPRSIQEQLMLERDPHGNVQVAKIETEKMFIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G FKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALLQSGKTGL
Sbjct  416  VETELEKRKQEGTYKGGFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+ APFKKFAS+R+EW
Sbjct  476  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEEAPFKKFASLRDEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y++PGPIQF GP SD ++HTLLLELGA
Sbjct  536  ALKNCYISPGPIQFTGPGSDAISHTLLLELGA  567



>ref|XP_002438147.1| hypothetical protein SORBIDRAFT_10g008850 [Sorghum bicolor]
 gb|EER89514.1| hypothetical protein SORBIDRAFT_10g008850 [Sorghum bicolor]
Length=565

 Score =   370 bits (951),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+  +LFE LP+ IQ+QL+LERDPHGNVQVAKIETEKMLI M
Sbjct  352  ILAHDVVDEAGAWKSKLQPESKELFEFLPKTIQEQLMLERDPHGNVQVAKIETEKMLISM  411

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y+  F+GQ+HFFGYEGRCGLP+NFD+ YCYALGYGAGALLQSGKTGL
Sbjct  412  VETELEKRKAEGRYSAHFRGQAHFFGYEGRCGLPTNFDSNYCYALGYGAGALLQSGKTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELD APFKK+ASMR+EW
Sbjct  472  ISSVGNLAAPVQEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDAAPFKKYASMRDEW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  532  AIKNRYISPGPIQFSGPGSDDSNHTLMLELGA  563



>dbj|BAJ85690.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85834.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   370 bits (950),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P   QLF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  347  ILAHDVVDEAGAWKSKLEPASRQLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  406

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RR +G Y+  F+GQSHFFGYEGRCGLP+NFD++YCYALGYGAGALLQ GKTGL
Sbjct  407  VETELEKRRAAGKYSAHFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGAGALLQFGKTGL  466

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALT+LMDVERRHGKFKPVIKKAMVELD APFKKFASMR+EW
Sbjct  467  ISSVGNLAAPVEQWTVGGTALTALMDVERRHGKFKPVIKKAMVELDAAPFKKFASMRDEW  526

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  527  AIKNRYISPGPIQFSGPGSDASNHTLMLELGA  558



>ref|XP_007147679.1| hypothetical protein PHAVU_006G145300g [Phaseolus vulgaris]
 gb|ESW19673.1| hypothetical protein PHAVU_006G145300g [Phaseolus vulgaris]
Length=561

 Score =   370 bits (950),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+ G+WK+KL+ Q L+LF+ LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  348  ILAHDIVDEGGLWKKKLSDQSLKLFDFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  407

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RR+ G Y GQF+GQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  408  VETELEKRREEGKYKGQFRGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  467

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL+APV +WTVGGTALT LMDVERRHGKFKPVIKKAMVEL+GAPFK FAS+R+EW
Sbjct  468  ISSVGNLSAPVEEWTVGGTALTLLMDVERRHGKFKPVIKKAMVELEGAPFKMFASLRDEW  527

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLEL  107
            ALKN Y++PGPIQF GP SD  NHTLLLEL
Sbjct  528  ALKNCYVSPGPIQFSGPGSDATNHTLLLEL  557



>ref|XP_009365098.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Pyrus x bretschneideri]
Length=556

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+AGVWK+KL  Q L+LFE LPQ IQ+QLLLERDPHGNVQVAKIETEKML+QM
Sbjct  343  ILAHDIVDEAGVWKQKLRSQSLELFEFLPQTIQEQLLLERDPHGNVQVAKIETEKMLLQM  402

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q G+Y   F G++HFFGYEGRCGLP+NFDA YCYALGYGAGALL SGKTGL
Sbjct  403  VETELHKRKQEGTYMRHFAGKTHFFGYEGRCGLPTNFDANYCYALGYGAGALLHSGKTGL  462

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R+EW
Sbjct  463  ISSVGNLAAPVEQWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRDEW  522

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY+NPGPIQFVG  ++ +N+TLLLELGA
Sbjct  523  ALKNRYVNPGPIQFVGSAANTINNTLLLELGA  554



>dbj|BAK07581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P   QLF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  347  ILAHDVVDEAGAWKSKLEPASRQLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  406

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RR +G Y+  F+GQSHFFGYEGRCGLP+NFD++YCYALGYGAGALLQ GKTGL
Sbjct  407  VETELEKRRAAGKYSAHFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGAGALLQFGKTGL  466

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALT+LMDVERRHGKFKPVIKKAMVELD APFKKFASMR+EW
Sbjct  467  ISSVGNLAAPVGQWTVGGTALTALMDVERRHGKFKPVIKKAMVELDAAPFKKFASMRDEW  526

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  527  AIKNRYISPGPIQFSGPGSDASNHTLMLELGA  558



>ref|NP_001168412.1| ppi-phosphofructokinase [Zea mays]
 gb|ACN28133.1| unknown [Zea mays]
 gb|AFW76871.1| ppi-phosphofructokinase [Zea mays]
Length=564

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+  +LFE LP  IQ+QL+LERDPHGNVQVAKIETEKMLI M
Sbjct  351  ILAHDVVDEAGAWKSKLQPESRELFEFLPNTIQEQLMLERDPHGNVQVAKIETEKMLISM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y+  F+GQ+HFFGYEGRCGLP+NFD+ YCYALGYGAGALLQSGKTGL
Sbjct  411  VETELEKRKAEGRYSAHFRGQAHFFGYEGRCGLPTNFDSNYCYALGYGAGALLQSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELD APFKK+ASMR+EW
Sbjct  471  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDAAPFKKYASMRDEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP S+  NHTL+LELGA
Sbjct  531  ALKNRYISPGPIQFSGPGSNDSNHTLMLELGA  562



>ref|XP_008805585.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Phoenix dactylifera]
Length=562

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KL  Q   LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  349  ILAHDVVDEEGLWKKKLGHQSQLLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLISM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+  G+Y GQFKGQSHFFGYEGRCGLP+NFDATYCYALGY AGALL SGKTGL
Sbjct  409  VETELDKRKSEGTYAGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYAAGALLHSGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R+EW
Sbjct  469  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRDEW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN+Y++PGPIQF+GP SD  NHTL LELGA
Sbjct  529  ALKNKYISPGPIQFIGPGSDDSNHTLRLELGA  560



>ref|XP_007153992.1| hypothetical protein PHAVU_003G082000g [Phaseolus vulgaris]
 gb|ESW25986.1| hypothetical protein PHAVU_003G082000g [Phaseolus vulgaris]
Length=568

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+ G+WK+KLT Q L LFELLP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHDTVDEGGLWKKKLTDQSLNLFELLPKAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G F+GQSHFFGYEGRCGLP+NFD++YCYALGYGA ALLQSGKTGL
Sbjct  415  VETELEKRKQQGTYKGGFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGAAALLQSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF+KFAS+R+EW
Sbjct  475  ISSVANLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFQKFASLRDEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD ++ TLLLEL A
Sbjct  535  ALKNRYISPGPIQFTGPGSDAISQTLLLELDA  566



>ref|XP_006383850.1| hypothetical protein POPTR_0004s00550g [Populus trichocarpa]
 gb|ABK93074.1| unknown [Populus trichocarpa]
 gb|ERP61647.1| hypothetical protein POPTR_0004s00550g [Populus trichocarpa]
Length=561

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q LQLFE LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  348  ILAHDVVDEDGLWKKKLTNQSLQLFEFLPPAIQEQLMLERDPHGNVQVAKIETEKMLIQM  407

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G  N  FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  408  VETELEKRKQIGQSNCIFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  467

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+G PFKKF S++ EW
Sbjct  468  ISSVGNLGAPVAEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGGPFKKFESLKNEW  527

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+ NRY++PGPIQF+GP SD ++HTLLLELGA
Sbjct  528  AINNRYISPGPIQFIGPGSDAISHTLLLELGA  559



>ref|XP_009391474.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=520

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KL  Q L LFE LPQAI++QLLLERDPHGNVQV+KIETEKMLI M
Sbjct  307  ILAHDVVDEDGLWKKKLQHQSLHLFEFLPQAIKEQLLLERDPHGNVQVSKIETEKMLISM  366

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y G FKGQSHFFGYEGRCGLP+NFDATYCYALGY AGALL SGKTGL
Sbjct  367  VETELEKRKLEGKYAGHFKGQSHFFGYEGRCGLPTNFDATYCYALGYAAGALLCSGKTGL  426

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF+KFASMR+ W
Sbjct  427  ISSVGNLNAPVNEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFQKFASMRDVW  486

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP S+ VNHTLLLELGA
Sbjct  487  ALKNRYISPGPIQFIGPGSNDVNHTLLLELGA  518



>ref|XP_010686769.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+AG+WK+KLT Q L LF+ LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHEAVDEAGLWKKKLTSQSLVLFDFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R++ G Y   F GQSHFFGYEGRCGLP+NFD++YCYALGY AGALL +GKTGL
Sbjct  413  VETELKKRKEQGVYKQHFSGQSHFFGYEGRCGLPTNFDSSYCYALGYAAGALLHAGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGT LT+LMDVERRHGKFKPVIKKAMVELDGAPFKKFASMR++W
Sbjct  473  ISSVGNLTAPVDEWTVGGTPLTALMDVERRHGKFKPVIKKAMVELDGAPFKKFASMRDDW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+ NRY++PGPIQFVGP SD VNHTLLLE+GA
Sbjct  533  AINNRYISPGPIQFVGPTSDAVNHTLLLEIGA  564



>ref|XP_010913416.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Elaeis guineensis]
Length=562

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG+WK+KL  Q   LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  349  ILAHDVVDEAGLWKKKLGHQSQLLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLISM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+  G+Y GQFKGQSHFFGYEGRCGLP+NFDA YCYALG GAGALL SGKTGL
Sbjct  409  VETELDKRKSEGTYAGQFKGQSHFFGYEGRCGLPTNFDAMYCYALGCGAGALLHSGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R EW
Sbjct  469  ISSVGNLCAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRHEW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP SD VNHTL LELGA
Sbjct  529  ALKNRYISPGPIQFIGPGSDDVNHTLRLELGA  560



>ref|XP_009408423.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like [Musa 
acuminata subsp. malaccensis]
Length=564

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD  G+WK+KL  Q   LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  351  ILAHDVVDKEGLWKKKLQQQSQLLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLISM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G+Y G FKGQSHFFGYEGRCGLP+NFDA YCYALGY AGALL SGKTGL
Sbjct  411  VETELEKRKSEGTYAGHFKGQSHFFGYEGRCGLPTNFDAAYCYALGYAAGALLHSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL AP+ +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF+KFASMR+EW
Sbjct  471  ISSVGNLDAPIDEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFRKFASMRDEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF+GP S+ VNHTLLLELGA
Sbjct  531  ALNNRYISPGPIQFIGPGSNNVNHTLLLELGA  562



>ref|XP_009391472.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009391473.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KL  Q L LFE LPQAI++QLLLERDPHGNVQV+KIETEKMLI M
Sbjct  351  ILAHDVVDEDGLWKKKLQHQSLHLFEFLPQAIKEQLLLERDPHGNVQVSKIETEKMLISM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y G FKGQSHFFGYEGRCGLP+NFDATYCYALGY AGALL SGKTGL
Sbjct  411  VETELEKRKLEGKYAGHFKGQSHFFGYEGRCGLPTNFDATYCYALGYAAGALLCSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF+KFASMR+ W
Sbjct  471  ISSVGNLNAPVNEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFQKFASMRDVW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP S+ VNHTLLLELGA
Sbjct  531  ALKNRYISPGPIQFIGPGSNDVNHTLLLELGA  562



>ref|XP_008379662.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=556

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+AGVWK+KL  Q L+LFE LPQ IQ+QLLLERDPHGNVQVAKIETEKML+QM
Sbjct  343  ILAHDIVDEAGVWKQKLQSQSLELFEFLPQTIQEQLLLERDPHGNVQVAKIETEKMLLQM  402

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R Q G Y   F G++HFFGYEGRCGLP+NFDA YCYALGYGAGALL SGKTGL
Sbjct  403  VETELHKRMQEGXYKRDFAGKTHFFGYEGRCGLPTNFDANYCYALGYGAGALLHSGKTGL  462

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R+EW
Sbjct  463  ISSVGNLAAPVEQWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRDEW  522

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY+NPGPIQFVG  ++ +N+TLLLELGA
Sbjct  523  ALKNRYVNPGPIQFVGSAANTINNTLLLELGA  554



>ref|XP_009414122.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185} [Musa 
acuminata subsp. malaccensis]
Length=564

 Score =   368 bits (944),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD  G+WK+KL  Q   LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  351  ILAHDVVDKEGLWKKKLQHQSQLLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLISM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G+Y+G FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAG LL+SGKTGL
Sbjct  411  VETELEKRKLEGTYSGHFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLRSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL+A V +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPF KFASMR+EW
Sbjct  471  ISSVGNLSAAVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFGKFASMRDEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF+GP S  VNHTLLLELGA
Sbjct  531  ALKNRYISPGPIQFMGPGSGDVNHTLLLELGA  562



>ref|XP_003564006.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Brachypodium distachyon]
Length=562

 Score =   368 bits (944),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+  QLF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  349  ILAHDVVDEAGAWKSKLQPESRQLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+ +G Y+  F+GQSHFFGYEGRCGLP+NFD++YCYALGYGAGALLQ GKTGL
Sbjct  409  VETELEKRKAAGKYSADFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGAGALLQFGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVELD APFKKFASMR+EW
Sbjct  469  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELDAAPFKKFASMRDEW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP S   NHTL+LELGA
Sbjct  529  ALKNRYISPGPIQFSGPGSYASNHTLMLELGA  560



>ref|XP_009356464.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Pyrus x bretschneideri]
Length=569

 Score =   368 bits (944),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  ILAHEVVDEDGLWKKKLTRQSLELFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+LE R+Q GSYNGQF+GQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  416  VETDLEKRKQEGSYNGQFQGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  476  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  536  AINNRYISPGPIQFHGQASNALSHTLLLELG  566



>gb|ABU82740.1| pyrophosphate-fructose 6-phosphate 1-phosphotrasferase beta subunit 
[Nicotiana tabacum]
Length=303

 Score =   358 bits (920),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KLTPQCL+LFELLP AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  113  ILAHDVVDEAGVWKKKLTPQCLELFELLPLAIQEQLLLERDPHGNVQVAKIETEKMLIQM  172

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G+YN QFKGQ HFFGYEGRCGLPSNFD+TYCYALGYGAG+LLQSGKTGL
Sbjct  173  VETELDQRKQKGAYNAQFKGQFHFFGYEGRCGLPSNFDSTYCYALGYGAGSLLQSGKTGL  232

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV + TVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  233  ISSVGNLAAPVEELTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASKREEW  292

Query  196  ALKNRYLNPGP  164
            AL NRY+NPGP
Sbjct  293  ALNNRYINPGP  303



>gb|AIE88316.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase 2 [Eriobotrya 
japonica]
Length=556

 Score =   367 bits (943),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH +VD+AGVWK+KL  Q L+LFE LPQ IQ+QLLLERDPHGNVQVAKIETEKML+QM
Sbjct  343  ILAHDIVDEAGVWKQKLQSQSLELFEFLPQTIQEQLLLERDPHGNVQVAKIETEKMLLQM  402

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q G+Y   F G++HFFGYEGRCGLP+NFDA YCYALGYG GALL SGKTGL
Sbjct  403  VETELHKRKQEGTYLRDFAGKTHFFGYEGRCGLPTNFDANYCYALGYGTGALLHSGKTGL  462

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R+EW
Sbjct  463  ISSVGNLAAPVEQWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRDEW  522

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY+NPGPIQFVG  ++ +N+TLLLELGA
Sbjct  523  ALKNRYVNPGPIQFVGSAANTINNTLLLELGA  554



>ref|XP_004305986.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Fragaria vesca subsp. vesca]
Length=557

 Score =   367 bits (942),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAHG VD+AG WK+KL PQ  +LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKML+QM
Sbjct  346  ILAHGAVDEAGEWKKKLQPQSHKLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLVQM  405

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            V+TEL  R++ G Y   F GQ HFFGYEGRCGLP+NFDA YCYALGYGAGALL SGKTGL
Sbjct  406  VDTELAKRKEEGKYKRNFSGQCHFFGYEGRCGLPTNFDANYCYALGYGAGALLHSGKTGL  465

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  466  ISSVGNLGAPVEQWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  525

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y+NPGPIQF+GP S  +N+TLLLELGA
Sbjct  526  ALKNHYVNPGPIQFLGPRSTAINNTLLLELGA  557



>ref|XP_009114586.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2 [Brassica rapa]
Length=568

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA G VD+ G WK+ L  + L+LFE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAQGNVDEEGQWKKNLKEETLKLFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE +++ GSY  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  415  VETELEKKKKDGSYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGT LTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  475  ISSVGNLAAPVEKWTVGGTPLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD +NHTLLLELGA
Sbjct  535  ALKNRYISPGPIQFKGPGSDAINHTLLLELGA  566



>ref|XP_004507660.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Cicer arietinum]
Length=567

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA   VD+ G+WK+KLT Q L+LFE LP+ IQ+QL+LERDPHGNVQVAKIETEKM IQM
Sbjct  354  ILADDTVDEGGLWKKKLTDQSLKLFEFLPRPIQEQLMLERDPHGNVQVAKIETEKMFIQM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G FKGQSHFFGYEGRCGLP+NFD+TYCYALGYGAGALLQSGKTGL
Sbjct  414  VETELEKRKQEGTYKGGFKGQSHFFGYEGRCGLPTNFDSTYCYALGYGAGALLQSGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NL  PV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  474  ISSVANLCNPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKN Y +PGPIQF GP SD ++HTLLLELGA
Sbjct  534  ALKNCYTSPGPIQFTGPGSDAISHTLLLELGA  565



>ref|XP_003547272.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Glycine max]
 gb|KHN32989.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=562

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+ G+WK+KLT Q L+LF+ LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  349  ILAHDTVDEGGLWKKKLTDQSLKLFDFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G YNG+FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  409  VETELEKRKQEGKYNGEFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R+EW
Sbjct  469  ISSVANLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDEW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHT  122
            ALKN Y++PGPIQF GP S+ +NHT
Sbjct  529  ALKNCYISPGPIQFSGPGSEVINHT  553



>ref|XP_004293328.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q LQLFELLP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  348  ILAHDVVDEDGLWKKKLTSQSLQLFELLPGAIQEQLMLERDPHGNVQVAKIETEKMLIQM  407

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE +L  R+Q GSY+G F+G+SHFFGYEGRCGLP+NFDA YCYALG+GAGALL  GKTGL
Sbjct  408  VEADLAKRKQEGSYHGHFQGKSHFFGYEGRCGLPTNFDANYCYALGFGAGALLHGGKTGL  467

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+ APFKKFAS+R EW
Sbjct  468  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEAAPFKKFASLRNEW  527

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+KNRY++PGPIQF GP S+ ++HTL+LELG
Sbjct  528  AIKNRYISPGPIQFFGPASNSLSHTLILELG  558



>ref|XP_007215516.1| hypothetical protein PRUPE_ppa003662mg [Prunus persica]
 gb|EMJ16715.1| hypothetical protein PRUPE_ppa003662mg [Prunus persica]
Length=558

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KL  Q  +LFE LP  IQ+QLLLERDPHGNVQVAKIETEKML+QM
Sbjct  345  ILAHDVVDEAGVWKKKLQSQSHELFEFLPPTIQEQLLLERDPHGNVQVAKIETEKMLLQM  404

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G Y   F G++HFFGYEGRCGLP+NFDA YCYALG+GAGALL SGKTGL
Sbjct  405  VETELDKRKQEGKYKRDFLGKTHFFGYEGRCGLPTNFDANYCYALGFGAGALLHSGKTGL  464

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R+EW
Sbjct  465  ISSVGNLAAPVEQWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRDEW  524

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY+NPGPIQF+GP ++ +N+TLLLELGA
Sbjct  525  ALKNRYVNPGPIQFLGPAANAINNTLLLELGA  556



>ref|NP_001148574.1| LOC100282190 [Zea mays]
 gb|ACF84415.1| unknown [Zea mays]
 gb|ACG32090.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase beta 
subunit [Zea mays]
Length=564

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL  +  +LFE LP+ IQ+QL+LERDPHGNVQVAKIETEKMLI M
Sbjct  351  ILAHDVVDEAGAWKSKLQAESRELFEFLPKTIQEQLMLERDPHGNVQVAKIETEKMLISM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y+  F+GQ+HFFGYEGRCGLP+NFD+ YCYALGYGAGALLQSGKTGL
Sbjct  411  VETELEKRKAEGRYSAHFRGQAHFFGYEGRCGLPTNFDSNYCYALGYGAGALLQSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVELD APFKK+AS+R+EW
Sbjct  471  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDAAPFKKYASLRDEW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  531  AIKNRYISPGPIQFSGPGSDDSNHTLMLELGA  562



>ref|XP_009357501.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Pyrus x bretschneideri]
Length=570

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA  VVD+ G+WK+KLT Q L+LF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAREVVDEDGLWKKKLTSQSLELFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+L+ RRQ GSYNGQF+GQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  415  VETDLQKRRQEGSYNGQFQGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  475  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  535  AINNRYISPGPIQFHGQASNALSHTLLLELG  565



>gb|KFK30957.1| hypothetical protein AALP_AA6G049400 [Arabis alpina]
Length=557

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA G VD+ G WK+KL  + ++LFE LPQ IQ+QL+LERDPHGNVQV+KIETEKMLIQM
Sbjct  344  ILAQGNVDEEGQWKKKLKEETVKLFEFLPQTIQEQLVLERDPHGNVQVSKIETEKMLIQM  403

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ +++ G+Y  +F GQSHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  404  VETELDKKKKEGTYKREFMGQSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  463

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  464  ISSVANLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  523

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD +NHTLLLELGA
Sbjct  524  ALKNRYISPGPIQFKGPGSDALNHTLLLELGA  555



>emb|CDX94541.1| BnaC09g22950D [Brassica napus]
Length=634

 Score =   368 bits (944),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA G VD+ G WK+ L  + L+LFE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  421  ILAQGNVDEEGQWKKNLKEETLKLFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  480

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE +++ GSY  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  481  VETELEKKKKDGSYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  540

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGT LTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  541  ISSVGNLAAPVEKWTVGGTPLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  600

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD +NHTLLLELGA
Sbjct  601  ALKNRYISPGPIQFKGPGSDTINHTLLLELGA  632



>gb|ADZ96379.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Eriobotrya 
japonica]
Length=569

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LF+ LP AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  ILAHEVVDEDGLWKKKLTSQSLELFDFLPVAIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+LE R+Q GSYNGQF+GQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  416  VETDLEKRKQEGSYNGQFQGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKA+VEL+GAPFKKFAS+R +W
Sbjct  476  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAIVELEGAPFKKFASLRNDW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  536  AINNRYISPGPIQFHGQASNALSHTLLLELG  566



>ref|XP_008364088.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta [Malus domestica]
Length=569

 Score =   365 bits (937),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  ILAHEVVDEDGLWKKKLTSQSLELFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+L  R+Q GSYNG F+GQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  416  VETDLAKRKQEGSYNGHFQGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R +W
Sbjct  476  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRNDW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  536  AINNRYISPGPIQFHGQASNALSHTLLLELG  566



>ref|XP_008230005.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Prunus mume]
Length=600

 Score =   366 bits (939),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AGVWK+KL  Q  +LFE LP  IQ+QLLLERDPHGNVQVAKIETEKML+QM
Sbjct  387  ILAHDVVDEAGVWKKKLQSQSHELFEFLPPTIQEQLLLERDPHGNVQVAKIETEKMLLQM  446

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G Y   F G++HFFGYEGRCGLP+NFDA YCYALG+GAGALL SGKTGL
Sbjct  447  VETELDKRKQEGKYKRDFLGKTHFFGYEGRCGLPTNFDANYCYALGFGAGALLHSGKTGL  506

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS R+EW
Sbjct  507  ISSVGNLAAPVEQWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASFRDEW  566

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY+NPGPIQF+GP ++ +N+TLLLELGA
Sbjct  567  ALKNRYVNPGPIQFLGPAANAINNTLLLELGA  598



>ref|NP_192313.3| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|F4JGR5.1|PFPB2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Protein MATERNAL EFFECT EMBRYO ARREST 
51; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AEE82365.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=569

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  VLAEGNVDEEGQWKKNLKKETLEIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE ++  G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  416  VETELEKKKTEGTYEREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  536  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  567



>ref|XP_010433059.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2 [Camelina sativa]
Length=569

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  VLAEGNVDEEGQWKKNLKEETLKIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ ++++G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  416  VETELDKKKKAGTYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  536  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  567



>ref|XP_010422248.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X2 [Camelina sativa]
Length=569

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  VLAEGNVDEEGQWKKNLKEETLKIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ ++++G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  416  VETELDKKKKAGTYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  536  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  567



>ref|XP_004955203.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Setaria italica]
Length=553

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD+AGVWK KL P+  +LFE LP +IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  340  ILAHDTVDEAGVWKNKLEPESKKLFEFLPPSIQEQLLLERDPHGNVQVAKIETEKMLIAM  399

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y G F GQSHFFGYEGRCG P+NFDA+YCYALGYGAGALLQ GKTGL
Sbjct  400  VETELEKRKAEGKYKGTFIGQSHFFGYEGRCGFPTNFDASYCYALGYGAGALLQCGKTGL  459

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV NLAAPV++WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAP+KKF+S+R+EW
Sbjct  460  ISSVSNLAAPVTEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPYKKFSSLRDEW  519

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+KNRY++PGPIQF+G  +D V+HTLLLELG
Sbjct  520  AVKNRYISPGPIQFIGSGADAVSHTLLLELG  550



>ref|XP_010928237.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Elaeis guineensis]
Length=563

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KL+ Q   LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  349  ILAHDVVDEEGLWKKKLSHQSQLLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLISM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+  G Y  QFKGQSHFFGYEGRCGLP+NFDATYCYALGY  GALL SGKTGL
Sbjct  409  VETELDKRKSEGRYAEQFKGQSHFFGYEGRCGLPTNFDATYCYALGYAGGALLHSGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL GAPFKKF+SMR+EW
Sbjct  469  ISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELQGAPFKKFSSMRDEW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            AL NRY++PGPIQF+GP  + VNHTL LELGA
Sbjct  529  ALNNRYISPGPIQFIGPGCNDVNHTLRLELGA  560



>ref|XP_006826755.1| hypothetical protein AMTR_s00136p00065750 [Amborella trichopoda]
 gb|ERM93992.1| hypothetical protein AMTR_s00136p00065750 [Amborella trichopoda]
Length=568

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ +VD+ G+WK+KL  Q   LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLI M
Sbjct  355  ILANDIVDEGGLWKQKLQHQSRLLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLISM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y GQFKGQSHFFGYEGRCGLPSNFD+ YCYALGY AGALL +GKTGL
Sbjct  415  VETELEKRKLEGKYVGQFKGQSHFFGYEGRCGLPSNFDSMYCYALGYAAGALLHAGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERR GKFKPVIKKAMVEL+GAPF+KF SMR+EW
Sbjct  475  ISSVGNLAAPVDEWTVGGTALTSLMDVERRKGKFKPVIKKAMVELEGAPFQKFVSMRDEW  534

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP S+ +NHTLLLELGA
Sbjct  535  ALKNRYISPGPIQFYGPASNDINHTLLLELGA  566



>gb|AAC28214.1| contains similarity to phosphofructokinases (Pfam; PFK.hmm, score; 
36.60) [Arabidopsis thaliana]
 emb|CAB77872.1| putative phosphofructokinase beta subunit [Arabidopsis thaliana]
Length=583

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  370  VLAEGNVDEEGQWKKNLKKETLEIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  429

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE ++  G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  430  VETELEKKKTEGTYEREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  489

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  490  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  549

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  550  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  581



>gb|EMS58307.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Triticum urartu]
Length=542

 Score =   362 bits (930),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P   +LF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  329  ILAHDVVDEAGAWKSKLEPASRELFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  388

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RR +G Y+  F+GQSHFFGYEGRCGLP+NFD++YCYALGYGAGALLQ GKTGL
Sbjct  389  VETELEKRRAAGKYSAHFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGAGALLQFGKTGL  448

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGK KPVIKKAMVELD APFKKFAS+R+EW
Sbjct  449  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKNKPVIKKAMVELDAAPFKKFASLRDEW  508

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  509  ASKNRYISPGPIQFSGPGSDASNHTLMLELGA  540



>ref|XP_010422247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X1 [Camelina sativa]
Length=594

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  381  VLAEGNVDEEGQWKKNLKEETLKIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  440

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ ++++G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  441  VETELDKKKKAGTYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  500

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  501  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  560

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  561  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  592



>ref|XP_007049157.1| Phosphofructokinase family protein [Theobroma cacao]
 gb|EOX93314.1| Phosphofructokinase family protein [Theobroma cacao]
Length=566

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            IL H VVD+AG+WKRKL  Q  +LFE LPQAIQ+QLLLERDPHGNVQVA+IETEKMLIQM
Sbjct  351  ILVHDVVDEAGMWKRKLRSQSQELFEFLPQAIQEQLLLERDPHGNVQVARIETEKMLIQM  410

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ R+Q G+Y G F+GQ HFFGYEGRCG P+NFDA YCYALGY  G LL SGKTGL
Sbjct  411  VETELDQRKQEGAYKGHFQGQPHFFGYEGRCGFPTNFDANYCYALGYATGVLLHSGKTGL  470

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMV+L+GAPF KFASMR++W
Sbjct  471  ISSVGNLTAPVDEWTVGGTALTSLMDVERRHGKFKPVIKKAMVDLEGAPFMKFASMRDDW  530

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KNRYL+PGP+QFVGP ++ +N+TL+LELGA
Sbjct  531  AAKNRYLSPGPVQFVGPFANDINYTLMLELGA  562



>ref|XP_006287381.1| hypothetical protein CARUB_v10000587mg [Capsella rubella]
 gb|EOA20279.1| hypothetical protein CARUB_v10000587mg [Capsella rubella]
Length=569

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LP  IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  VLAQGNVDEEGQWKKNLKKETLKIFEFLPPTIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
             ETEL+ ++++G+Y   F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  416  AETELDKKKKAGTYKRDFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD +NHTLLLELGA
Sbjct  536  ALKNRYISPGPIQFKGPGSDAINHTLLLELGA  567



>ref|XP_010496159.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like [Camelina sativa]
Length=569

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  VLAEGNVDEEGQWKKNLKEETLKIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL+ ++++G+Y   F G+SHF+GYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  416  VETELDKKKKAGTYRRDFMGKSHFYGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  536  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  567



>gb|EMT25675.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Aegilops tauschii]
Length=550

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK +L P   +LF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  337  ILAHDVVDEAGAWKSELEPASRELFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  396

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RR +G Y+  F+GQSHFFGYEGRCGLP+NFD++YCYALGYGAGALLQ GKTGL
Sbjct  397  VETELEKRRAAGKYSAHFRGQSHFFGYEGRCGLPTNFDSSYCYALGYGAGALLQFGKTGL  456

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGK KPVIKKAMVELD APFKKFAS+R+EW
Sbjct  457  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKNKPVIKKAMVELDAAPFKKFASLRDEW  516

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A KNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  517  ASKNRYISPGPIQFSGPGSDASNHTLMLELGA  548



>ref|NP_001057284.1| Os06g0247500 [Oryza sativa Japonica Group]
 dbj|BAD45669.1| putative pyrophosphate-dependent phosphofructokinase beta subunit 
[Oryza sativa Japonica Group]
 dbj|BAF19198.1| Os06g0247500 [Oryza sativa Japonica Group]
 gb|EAZ00352.1| hypothetical protein OsI_22368 [Oryza sativa Indica Group]
 gb|EAZ36477.1| hypothetical protein OsJ_20808 [Oryza sativa Japonica Group]
Length=567

 Score =   360 bits (924),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+  QLF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  354  ILAHDVVDEAGAWKSKLQPESRQLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  413

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y   F+GQSHFFGYEGRCGLP+ FD+ YCYALGYG+GALLQ GKTGL
Sbjct  414  VETELEKRKAEGKYPAHFRGQSHFFGYEGRCGLPTIFDSNYCYALGYGSGALLQCGKTGL  473

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNLAAPV +WTVGGTALTSLMDVERRHGK+KPVIKKAMVELDGAPFKKFAS+R+EW
Sbjct  474  ITSVGNLAAPVEEWTVGGTALTSLMDVERRHGKYKPVIKKAMVELDGAPFKKFASLRDEW  533

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            +LKN Y++PGPIQF GP S+  NHTL+LELGA
Sbjct  534  SLKNHYISPGPIQFSGPGSNDANHTLMLELGA  565



>ref|XP_010089437.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
 gb|EXB37810.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Morus notabilis]
Length=556

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD  G WK+KL  Q L LFE LP  IQ+QLLLERDPHGNVQVA+IETEKMLIQM
Sbjct  343  ILAHDVVDQEGTWKKKLCSQSLDLFEFLPPEIQEQLLLERDPHGNVQVARIETEKMLIQM  402

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+  G Y GQF+GQSHFFGYEGRCGLPSNFDA YCYALGY AGALL SGKTGL
Sbjct  403  VETELNKRKHEGKYKGQFQGQSHFFGYEGRCGLPSNFDANYCYALGYAAGALLHSGKTGL  462

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGT+LTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS+R++W
Sbjct  463  ISSVGNLGAPVEEWTVGGTSLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASLRDDW  522

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
             LKNRY+NPG +QFVG  ++ +N TL+LELGA
Sbjct  523  TLKNRYVNPGSVQFVGSTANAINETLILELGA  554



>ref|XP_006656840.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Oryza brachyantha]
Length=565

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+   LF+ LP+ IQ+QLLLERDPHGNVQVAKIETEKMLI M
Sbjct  352  ILAHDVVDEAGAWKSKLQPESRLLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAM  411

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y   F+GQSHFFGYEGRCGLP+ FD+ YCYALGYG+GALLQSGKTGL
Sbjct  412  VETELEKRKAEGKYPAHFRGQSHFFGYEGRCGLPTIFDSNYCYALGYGSGALLQSGKTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVELDGAPFKKFAS+R+EW
Sbjct  472  ITSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELDGAPFKKFASLRDEW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            +LKN Y++PGPIQF GP S+  NHTL+LELGA
Sbjct  532  SLKNHYISPGPIQFSGPGSNDANHTLMLELGA  563



>emb|CDP11324.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   354 bits (909),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KL  Q  QLFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  338  ILAHDVVDEEGNWKKKLRSQSHQLFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  397

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE ELE RR  G YN +FKGQ HFFGYEGRCGLPSNFD  YCYALGY AG LL SGKTGL
Sbjct  398  VEAELENRRSKGLYNKEFKGQHHFFGYEGRCGLPSNFDTNYCYALGYAAGVLLHSGKTGL  457

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV  WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL GAPFKKF S+R++W
Sbjct  458  ISSVGNLGAPVEKWTVGGTALTSLMDVERRHGKFKPVIKKAMVELQGAPFKKFESLRDDW  517

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY +PGP+QF G  ++++N+TL+LEL A
Sbjct  518  ALKNRYFSPGPLQFTGKTANEINYTLMLELEA  549



>ref|XP_010035533.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Eucalyptus grandis]
 gb|KCW46957.1| hypothetical protein EUGRSUZ_K00768 [Eucalyptus grandis]
Length=566

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH V+D+AG+WK+KL  Q  +LFE LPQ IQ QLLLERDPHGNVQVAKIETE+MLI+M
Sbjct  353  ILAHDVIDEAGIWKKKLQSQSKELFEFLPQEIQKQLLLERDPHGNVQVAKIETERMLIEM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE RR+ GSY  +F GQ HFFGYEGR GLP++FDA YCYALG+ AGALL SGKTGL
Sbjct  413  VETELEKRRKEGSYGRKFIGQPHFFGYEGRSGLPTDFDANYCYALGHAAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I SV NL+APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFASMR+ W
Sbjct  473  ICSVANLSAPVDEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASMRDGW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKN++++PGPIQFVGP +  VNHTL+LELG
Sbjct  533  ALKNQFISPGPIQFVGPTAKAVNHTLMLELG  563



>ref|XP_006396719.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
 gb|ESQ38172.1| hypothetical protein EUTSA_v10028543mg [Eutrema salsugineum]
Length=570

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA G VD+ G WK+ L  + L LFE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  357  ILAQGNVDEEGQWKKNLKEETLNLFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  416

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE +++ G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQSGKTGL
Sbjct  417  VETELEKKKEEGTYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSGKTGL  476

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAP+  WTVGGT LTSLMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  477  ISSVGNLAAPIEKWTVGGTPLTSLMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  536

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD +NHTLLLELGA
Sbjct  537  ALKNRYISPGPIQFKGPGSDAINHTLLLELGA  568



>gb|KJB42857.1| hypothetical protein B456_007G170900 [Gossypium raimondii]
Length=568

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG+WKRKL      LFE LPQ+IQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDEAGMWKRKLRSHSHDLFEFLPQSIQEQLLLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE EL+ R+Q G+Y GQF+G+ HFFGYEGRCG P+NFDA YC ALGY  G LL SGKTGL
Sbjct  413  VEAELDQRKQKGAYKGQFQGKPHFFGYEGRCGFPTNFDANYCNALGYATGILLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKA+V+L+GAP  KFAS+R++W
Sbjct  473  ISSVGNLTAPVDEWTVGGTALTSLMDVERRHGKFKPVIKKALVDLEGAPMLKFASLRDDW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRYL+ GPIQFVGP ++ +N+TL+LELGA
Sbjct  533  ALKNRYLSSGPIQFVGPYANDINYTLMLELGA  564



>ref|XP_002872678.1| hypothetical protein ARALYDRAFT_490075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48937.1| hypothetical protein ARALYDRAFT_490075 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA G VD+ G WK+ L  + L++FE LPQ IQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  356  VLAEGNVDEEGQWKKNLKKETLKIFEFLPQTIQEQLMLERDPHGNVQVAKIETEKMLIQM  415

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE +++ G+Y  +F G+SHFFGYEGRCGLP+NFDATYCYALGYGAG+LLQS KTGL
Sbjct  416  VETELEKKKEEGAYKREFMGKSHFFGYEGRCGLPTNFDATYCYALGYGAGSLLQSEKTGL  475

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALT+LMDVERRHGKFKPVIKKAMVEL+GAPFKKFAS REEW
Sbjct  476  ISSVGNLAAPVEEWTVGGTALTALMDVERRHGKFKPVIKKAMVELEGAPFKKFASQREEW  535

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            ALKNRY++PGPIQF GP SD  NHTL+LELGA
Sbjct  536  ALKNRYISPGPIQFKGPGSDARNHTLMLELGA  567



>ref|XP_006447632.1| hypothetical protein CICLE_v10014750mg [Citrus clementina]
 gb|ESR60872.1| hypothetical protein CICLE_v10014750mg [Citrus clementina]
Length=412

 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAHG VD  GVWK+KL  Q  +LFEL P+ IQ QLLLERDPHGNVQVAKIETE+MLIQM
Sbjct  191  ILAHGGVDRDGVWKKKLKSQSQELFELFPEEIQKQLLLERDPHGNVQVAKIETERMLIQM  250

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE EL  R++ G+Y GQF GQ HFFGYEGRCG P+NFDA YCYALG+ +GALL +GKTGL
Sbjct  251  VEAELNKRKKKGTYKGQFTGQPHFFGYEGRCGFPTNFDANYCYALGFASGALLHAGKTGL  310

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNL  PV +WTVGGTALTSLM VERRHGKFKPVIKKAMVEL+G PFK FAS+RE+W
Sbjct  311  IASVGNLGEPVEEWTVGGTALTSLMHVERRHGKFKPVIKKAMVELEGKPFKTFASLREDW  370

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
             +KN Y +PGPIQF GP ++ +NHTL+LELG
Sbjct  371  TIKNLYASPGPIQFSGPTANDINHTLMLELG  401



>gb|KJB67273.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=556

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  413  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL APV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVELDGAPFKKFAS+REEW
Sbjct  473  ISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELDGAPFKKFASLREEW  532

Query  196  ALKNRYLNPG  167
            A KN Y++PG
Sbjct  533  ASKNCYISPG  542



>gb|KDO54287.1| hypothetical protein CISIN_1g008310mg [Citrus sinensis]
Length=570

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAHG VD  GVWK+KL  Q  +LFEL P+ IQ QLLLERDPHGNVQVAKIETE+MLIQM
Sbjct  349  ILAHGGVDRDGVWKKKLKSQSQELFELFPEEIQKQLLLERDPHGNVQVAKIETERMLIQM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE EL  R+Q G+Y GQF GQ HFFGYEGRCG P+NFDA YCYALG+ +GALL +GKTGL
Sbjct  409  VEAELNKRKQKGTYKGQFTGQPHFFGYEGRCGFPTNFDANYCYALGFASGALLHAGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNL  PV +WTVGGTALTSLM VERRHGKFKPVIKKAMVEL+G PFK FAS+RE+W
Sbjct  469  IASVGNLGEPVEEWTVGGTALTSLMHVERRHGKFKPVIKKAMVELEGKPFKTFASLREDW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
             +KN Y +PGPIQF GP ++ +NHTL+LELG
Sbjct  529  TIKNLYASPGPIQFSGPTANDINHTLMLELG  559



>ref|XP_010529463.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 2-like isoform X2 [Tarenaya hassleriana]
Length=546

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  +D+ G WK+KL  Q L+LFE LP+ IQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  355  ILAHETIDEEGQWKKKLKEQSLKLFEFLPRTIQEQLLLERDPHGNVQVAKIETEKMLIQM  414

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R Q G+Y G+FKGQSHFFGYEGRCGLP+NFDATYCYALGYGAG LLQSGKTGL
Sbjct  415  VETELEKRNQEGTYKGEFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGVLLQSGKTGL  474

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNLAAPV +WTVGGTALTS+MDVERRHGKFKPVIKKAMVEL+GAPFKKF S REEW
Sbjct  475  ISSVGNLAAPVEEWTVGGTALTSMMDVERRHGKFKPVIKKAMVELEGAPFKKFESQREEW  534

Query  196  ALKNRYLNPG  167
            A+KNRY++PG
Sbjct  535  AMKNRYISPG  544



>ref|XP_006447633.1| hypothetical protein CICLE_v10014750mg [Citrus clementina]
 ref|XP_006469626.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Citrus sinensis]
 gb|ESR60873.1| hypothetical protein CICLE_v10014750mg [Citrus clementina]
Length=570

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAHG VD  GVWK+KL  Q  +LFEL P+ IQ QLLLERDPHGNVQVAKIETE+MLIQM
Sbjct  349  ILAHGGVDRDGVWKKKLKSQSQELFELFPEEIQKQLLLERDPHGNVQVAKIETERMLIQM  408

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE EL  R++ G+Y GQF GQ HFFGYEGRCG P+NFDA YCYALG+ +GALL +GKTGL
Sbjct  409  VEAELNKRKKKGTYKGQFTGQPHFFGYEGRCGFPTNFDANYCYALGFASGALLHAGKTGL  468

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNL  PV +WTVGGTALTSLM VERRHGKFKPVIKKAMVEL+G PFK FAS+RE+W
Sbjct  469  IASVGNLGEPVEEWTVGGTALTSLMHVERRHGKFKPVIKKAMVELEGKPFKTFASLREDW  528

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
             +KN Y +PGPIQF GP ++ +NHTL+LELG
Sbjct  529  TIKNLYASPGPIQFSGPTANDINHTLMLELG  559



>ref|XP_002984967.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
 gb|EFJ13842.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
Length=560

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA G VD+ G W+ KL+PQC  LF+ LP +IQ++LLLERDPHGNVQVAKIETEKMLI M
Sbjct  347  ILASGTVDEEGHWRHKLSPQCHALFDSLPHSIQEELLLERDPHGNVQVAKIETEKMLISM  406

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q GSY G FKGQSHF GYEGRCGLP+NFD+TYCYALGY AGALL +G+TGL
Sbjct  407  VETELLRRKQEGSYTGSFKGQSHFLGYEGRCGLPTNFDSTYCYALGYAAGALLHAGQTGL  466

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNL+A   DWTVGGTALTSLMDVERR GK KPVIKKAMVELDGAPFKKFAS+R++W
Sbjct  467  IASVGNLSASSKDWTVGGTALTSLMDVERRRGKNKPVIKKAMVELDGAPFKKFASVRDKW  526

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+++ Y +PGPIQF GP +++ N+TL LELG
Sbjct  527  AVEDDYRSPGPIQFSGPTAEETNYTLKLELG  557



>ref|XP_002986153.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
 gb|EFJ12684.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
Length=560

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA G VD+ G W+ KL+PQC  LF+ LP +IQ++LLLERDPHGNVQVAKIETEKMLI M
Sbjct  347  ILASGTVDEEGHWRHKLSPQCHALFDSLPHSIQEELLLERDPHGNVQVAKIETEKMLISM  406

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+Q GSY G FKGQSHF GYEGRCGLP+NFD+TYCYALGY AGALL +G+TGL
Sbjct  407  VETELLRRKQEGSYTGNFKGQSHFLGYEGRCGLPTNFDSTYCYALGYAAGALLHAGQTGL  466

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SVGNL+    DWTVGGTALTSLMDVERR GK KPVIKKAMVELDGAPFKKFAS+R++W
Sbjct  467  IASVGNLSTSSKDWTVGGTALTSLMDVERRRGKNKPVIKKAMVELDGAPFKKFASVRDKW  526

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            A+++ Y +PGPIQF GP +++ N+TL LELG
Sbjct  527  AVEDDYRSPGPIQFSGPTAEETNYTLKLELG  557



>ref|XP_008345810.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=178

 Score =   313 bits (802),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  628  LLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSN  449
            +LERDPHGNVQVAKIETEKMLIQMVET+L  R+Q GSYNG F+GQSHFFGYEGRCGLP+N
Sbjct  1    MLERDPHGNVQVAKIETEKMLIQMVETDLAKRKQEGSYNGHFQGQSHFFGYEGRCGLPTN  60

Query  448  FDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKP  269
            FD+TYCYALGY AGALL SGKTGLISSVGNL APV +WTVGGTALTSLMDVERRHGKFKP
Sbjct  61   FDSTYCYALGYAAGALLHSGKTGLISSVGNLDAPVEEWTVGGTALTSLMDVERRHGKFKP  120

Query  268  VIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            VIKKAMVEL+GAPFKKFAS+R +WA+ NRY++PGPIQF G  S+ ++HTLLLELG
Sbjct  121  VIKKAMVELEGAPFKKFASLRNDWAINNRYISPGPIQFHGQASNALSHTLLLELG  175



>gb|KDO54283.1| hypothetical protein CISIN_1g042388mg [Citrus sinensis]
Length=567

 Score =   324 bits (830),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD  G WK+KL  Q  +LFEL P+AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  348  ILAHDGVDQDGAWKKKLKSQSQELFELFPKAIQEQLLLERDPHGNVQVAKIETEKMLIQM  407

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL   +Q G+Y GQF GQSHFFGYEGRCGLP+NFDA YCYALGY A ALL +GKTGL
Sbjct  408  VETELNKMKQKGAYKGQFNGQSHFFGYEGRCGLPTNFDANYCYALGYAAAALLHAGKTGL  467

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL  PV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+G PFK FAS+RE+W
Sbjct  468  ISSVGNLGEPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGIPFKTFASLREDW  527

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
             +KN Y++PGPIQFVGP ++ +NHTL LELG
Sbjct  528  TIKNLYVSPGPIQFVGPNANDINHTLKLELG  558



>ref|XP_006469757.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta 1-like [Citrus sinensis]
Length=567

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD  G WK+KL  Q  +LFEL P+AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  348  ILAHDGVDQDGAWKKKLKSQSQELFELFPKAIQEQLLLERDPHGNVQVAKIETEKMLIQM  407

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL   +Q G+Y GQF GQSHFFGYEGRCGLP+NFDA YCYALGY A ALL +GKTGL
Sbjct  408  VETELNKMKQKGAYKGQFNGQSHFFGYEGRCGLPTNFDANYCYALGYAAAALLHAGKTGL  467

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL  PV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+G PFK FAS+RE+W
Sbjct  468  ISSVGNLGEPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGIPFKTFASLREDW  527

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
             +KN Y++PGPIQFVGP ++ +NHTL LELG
Sbjct  528  TIKNLYVSPGPIQFVGPNANDINHTLKLELG  558



>ref|XP_006447627.1| hypothetical protein CICLE_v10017788mg [Citrus clementina]
 gb|ESR60867.1| hypothetical protein CICLE_v10017788mg [Citrus clementina]
Length=600

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH  VD  G WK+KL  Q  +LFEL P+AIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  381  ILAHDGVDQDGAWKKKLKSQSQELFELFPKAIQEQLLLERDPHGNVQVAKIETEKMLIQM  440

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL   +Q G+Y GQF GQSHFFGYEGRCGLP+NFDA YCYALGY A ALL +GKTGL
Sbjct  441  VETELNKMKQKGAYKGQFNGQSHFFGYEGRCGLPTNFDANYCYALGYAAAALLHAGKTGL  500

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSVGNL  PV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+G PFK FAS+RE+W
Sbjct  501  ISSVGNLGEPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELEGIPFKTFASLREDW  560

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
             +KN Y++PGPIQFVGP ++ +NHTL LELG
Sbjct  561  TIKNLYVSPGPIQFVGPNANDINHTLKLELG  591



>ref|XP_001773466.1| predicted protein [Physcomitrella patens]
 gb|EDQ61666.1| predicted protein [Physcomitrella patens]
Length=567

 Score =   319 bits (818),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+   D+ G WK  L P    LF+ LP +IQ++LLLERDPHGNVQV++IE EKMLI M
Sbjct  352  ILANQGCDEHGHWKSTLKPPSRALFDSLPHSIQEELLLERDPHGNVQVSRIEMEKMLISM  411

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            +ETEL  R+  GSY+GQFKGQ+HFFGYEGRCG+P+NFD TYCYALGY AGAL+  G+TGL
Sbjct  412  IETELFARKHEGSYSGQFKGQAHFFGYEGRCGMPTNFDTTYCYALGYAAGALMHLGQTGL  471

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SV NL AP S+WTVGGTALT LMDVERR+GK KPVIKKAMVEL+GAPFKKFAS+R+ W
Sbjct  472  IASVANLTAPASEWTVGGTALTQLMDVERRNGKNKPVIKKAMVELNGAPFKKFASVRDAW  531

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+++ Y++PGPIQF GP SD  N TL LELGA
Sbjct  532  AVEDSYVSPGPIQFAGPTSDDTNFTLKLELGA  563



>ref|XP_001774878.1| predicted protein [Physcomitrella patens]
 gb|EDQ60290.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   316 bits (809),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA    DD G WK  L P    LF+ LP +IQ++LLLERDPHGNVQV++IE EKMLI M
Sbjct  337  ILASQGCDDHGHWKATLKPSSRALFDSLPHSIQEELLLERDPHGNVQVSRIEMEKMLISM  396

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            +ETEL  RR  G Y+GQFKGQ+HFFGYEGRCG+P+NFDATYCYALG+ AGAL+  G+TGL
Sbjct  397  IETELNARRHEGGYSGQFKGQAHFFGYEGRCGMPTNFDATYCYALGFAAGALMHLGQTGL  456

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SV NL AP ++WTVGGTALT LMDVERR G+ KPVIKKAMVEL GAPFKKFAS+R+ W
Sbjct  457  IASVANLTAPAAEWTVGGTALTQLMDVERRKGRNKPVIKKAMVELGGAPFKKFASVRDVW  516

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+++ Y++PGPIQF GP +D+ N TL LELGA
Sbjct  517  AVEDSYVSPGPIQFAGPTADETNFTLKLELGA  548



>gb|KHN03504.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=439

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  598  QVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALG  419
            +VAKIETEKMLIQMVETELE R+Q GSY G F+GQSHFFGYEGRCGLP+NFD+TYCYALG
Sbjct  272  EVAKIETEKMLIQMVETELEKRKQQGSYKGGFRGQSHFFGYEGRCGLPTNFDSTYCYALG  331

Query  418  YGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELD  239
            YGA ALLQSGKTGLISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+
Sbjct  332  YGAAALLQSGKTGLISSVGNLCAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELE  391

Query  238  GAPFKKFASMREEWALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            GAPFKKFAS+R+EWALKNRY++PGPIQF G  SD +NHTLLLE GA
Sbjct  392  GAPFKKFASLRDEWALKNRYISPGPIQFTGRGSDAINHTLLLEFGA  437



>ref|XP_001770321.1| predicted protein [Physcomitrella patens]
 gb|EDQ64811.1| predicted protein [Physcomitrella patens]
Length=565

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 168/212 (79%), Gaps = 0/212 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            +LA    D  G WK KL P C  LF+ LP  IQ++LLLERDPHGNVQVA+IETEKMLI M
Sbjct  353  LLATQGCDPQGHWKSKLKPACRALFDSLPHNIQEELLLERDPHGNVQVARIETEKMLISM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETEL  R+   ++ G FKGQSHFFGYEGRCGLP+NFDATYCYALG+ A  LL  G+TGL
Sbjct  413  VETELFARQHEETFKGFFKGQSHFFGYEGRCGLPTNFDATYCYALGFAASGLLHMGQTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            I+SV NL AP ++W VGGTALT LMDVERR GK KPVIKKAMVELDGAPFK FASMR++W
Sbjct  473  IASVSNLTAPATEWGVGGTALTQLMDVERRRGKNKPVIKKAMVELDGAPFKTFASMRDQW  532

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            A+++ Y++PGPIQF GP +D   +TL LE GA
Sbjct  533  AVEDSYISPGPIQFTGPTADDTCYTLKLEAGA  564



>gb|KHG11353.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Gossypium arboreum]
Length=465

 Score =   303 bits (776),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  598  QVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALG  419
            +VAKIETEKMLIQMVETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFDA+YCYALG
Sbjct  298  EVAKIETEKMLIQMVETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDASYCYALG  357

Query  418  YGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELD  239
            YGA ALL SGKTGLISSVGNL APV +WTVGGTALTSLMDVERRHGKFKPVIKKAMVEL+
Sbjct  358  YGAAALLHSGKTGLISSVGNLGAPVEEWTVGGTALTSLMDVERRHGKFKPVIKKAMVELE  417

Query  238  GAPFKKFASMREEWALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            GAPFKKFAS+RE+WALKN Y++PGPIQFVGP S+ V+HTLLLELGA
Sbjct  418  GAPFKKFASVREDWALKNCYISPGPIQFVGPSSNAVSHTLLLELGA  463



>gb|KHG16419.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Gossypium arboreum]
Length=509

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  598  QVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALG  419
            +VAKIETEKMLIQMVETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALG
Sbjct  342  EVAKIETEKMLIQMVETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALG  401

Query  418  YGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELD  239
            YGAGALL SGKTGLISSVGNL APV +WTVGGTALTS+MDVERRHGK KPVIKKAMVELD
Sbjct  402  YGAGALLHSGKTGLISSVGNLCAPVEEWTVGGTALTSMMDVERRHGKLKPVIKKAMVELD  461

Query  238  GAPFKKFASMREEWALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            GAPFKKFAS+REEWA+KN Y++PGPIQF GP S+ VNHTLLLELGA
Sbjct  462  GAPFKKFASLREEWAIKNCYISPGPIQFAGPASNAVNHTLLLELGA  507



>ref|XP_009609864.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta {ECO:0000255|HAMAP-Rule:MF_03185}-like [Nicotiana 
tomentosiformis]
Length=159

 Score =   289 bits (740),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  571  MLIQMVETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQS  392
            MLIQMVE ELE +R+ GSY   FKGQSHFFGYEGRCGLPS+FD+ YCYALGYGAGALL S
Sbjct  1    MLIQMVEAELENKRKEGSYTKHFKGQSHFFGYEGRCGLPSSFDSNYCYALGYGAGALLHS  60

Query  391  GKTGLISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS  212
            GKTGLISSVGNL APV DWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS
Sbjct  61   GKTGLISSVGNLGAPVEDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFAS  120

Query  211  MREEWALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            +REEWALKNRY +PGP+QFVGP S+++NHTL+LELGA
Sbjct  121  LREEWALKNRYFSPGPLQFVGPTSNEINHTLMLELGA  157



>gb|KHN40852.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Glycine soja]
Length=474

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 154/179 (86%), Gaps = 13/179 (7%)
 Frame = -2

Query  598  QVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALG  419
            +VAKIETEKMLIQMVETELE R+Q G Y G+FKGQSHFFGYEGRCGLP+NFDATYCYALG
Sbjct  294  EVAKIETEKMLIQMVETELEKRKQEGKYKGEFKGQSHFFGYEGRCGLPTNFDATYCYALG  353

Query  418  YGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTSLMDVERRHG-------------K  278
            YGAGALL SGKTGLISSVGNL APV +WTVGGTALTS+MDVERRHG             K
Sbjct  354  YGAGALLHSGKTGLISSVGNLCAPVKEWTVGGTALTSMMDVERRHGTHFDLWDRVLYPSK  413

Query  277  FKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFVGPVSDQVNHTLLLELGA  101
            FKPVIKKAMVEL+GAPFKKFAS+R+EWALKN Y++PGPIQF GP S+ +NHTLLLEL A
Sbjct  414  FKPVIKKAMVELEGAPFKKFASLRDEWALKNCYISPGPIQFSGPGSEVINHTLLLELEA  472



>gb|AET22421.1| pyrophosphate-dependent phosphofructokinase [Citrus maxima]
Length=260

 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KLT Q LQLFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  106  ILAHEVVDEGGQWKKKLTKQSLQLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  165

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G   GQFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  166  VETELENRKQEGVNKGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  225

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFK  272
            ISSVGNLAAPV +WTV GTALT+LMDVERRHGKFK
Sbjct  226  ISSVGNLAAPVEEWTVSGTALTALMDVERRHGKFK  260



>gb|AET22402.1| pyrophosphate-dependent phosphofructokinase [Citrus sinensis]
Length=260

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G WK+KLT Q LQLFE LPQAIQ+Q +LERDPHGNVQVAKIETEKMLIQM
Sbjct  106  ILAHEVVDEGGQWKKKLTKQSLQLFEFLPQAIQEQSMLERDPHGNVQVAKIETEKMLIQM  165

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G   GQFKGQSHFFGYEGRCGLP+NFDATYCYALGYGAGALL SGKTGL
Sbjct  166  VETELENRKQEGVNKGQFKGQSHFFGYEGRCGLPTNFDATYCYALGYGAGALLHSGKTGL  225

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFK  272
            ISSVGNLAAPV +WTV GTALT+LMDVERRHGKFK
Sbjct  226  ISSVGNLAAPVEEWTVSGTALTALMDVERRHGKFK  260



>ref|XP_008384111.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like [Malus domestica]
Length=565

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 167/212 (79%), Gaps = 7/212 (3%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LF+ LP+AIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  357  ILAHEVVDEDGLWKKKLTSQSLELFDFLPEAIQEQLMLERDPHGNVQVAKIETEKMLIQM  416

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VET+L  R+Q GSYNG F+GQSHFFGYEGRCGLP+NFD+TYCYALGY AGALL SGKTGL
Sbjct  417  VETDLAKRKQEGSYNGHFQGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHSGKTGL  476

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAP-FKKFASMREE  200
            ISSVGNL APV +WTVGGTALTSLMDVERRHG    ++   ++ L G   F +   +  +
Sbjct  477  ISSVGNLDAPVEEWTVGGTALTSLMDVERRHG----IVNLWLLFLCGCRFFSQVLGIPSD  532

Query  199  WALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
              L        PIQF G  S+ ++HTLLLELG
Sbjct  533  HCLSENI--DSPIQFHGQASNALSHTLLLELG  562



>gb|ACS71752.1| pyrophosphate-dependent phosphofructokinase [Camellia sinensis]
Length=260

 Score =   274 bits (700),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA  VVD+ G+WK+KL  Q L+LF+LLP AIQ+QL+LERDPHGNVQVAKIETEKM IQM
Sbjct  106  ILAQEVVDEGGLWKKKLNEQSLKLFDLLPPAIQEQLMLERDPHGNVQVAKIETEKMFIQM  165

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q G+Y G FKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALL  GKTGL
Sbjct  166  VETELEHRKQKGAYKGHFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLHCGKTGL  225

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFK  272
            ISSV NLAAPV +WTVGGTALTSLMDVERRHGKFK
Sbjct  226  ISSVANLAAPVEEWTVGGTALTSLMDVERRHGKFK  260



>gb|KJB69225.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=545

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDEDGIWKKKLTNQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGA ALL SGKTGL
Sbjct  413  VETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAAALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHG  281
            ISSVGNL APV +WTVGGTALTSLMDVERRHG
Sbjct  473  ISSVGNLGAPVEEWTVGGTALTSLMDVERRHG  504



>gb|KJB67275.1| hypothetical protein B456_010G184300 [Gossypium raimondii]
Length=502

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDENGLWKKKLTDQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY   FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGAGALL SGKTGL
Sbjct  413  VETELEKRKQEGSYKANFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAGALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERR  287
            ISSVGNL APV +WTVGGTALTS+MDVERR
Sbjct  473  ISSVGNLCAPVEEWTVGGTALTSMMDVERR  502



>emb|CDY31232.1| BnaC08g15270D [Brassica napus]
Length=332

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 161/211 (76%), Gaps = 18/211 (9%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ VVD++G  K+KL  Q L+LF+LLP+AIQ+QL+LER+PHGNVQVAKIETEKMLIQM
Sbjct  138  ILANEVVDESGERKKKLAEQSLKLFDLLPEAIQEQLILEREPHGNVQVAKIETEKMLIQM  197

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
                L L R S S+              GRCGLP+NFDATYCYALGYGAG LL SGKTGL
Sbjct  198  ----LVLTRDS-SWGSLISS--------GRCGLPTNFDATYCYALGYGAGVLLNSGKTGL  244

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEW  197
            ISSV  +         G    +SLMDVERRHGKFK VIK+AMVEL+GAPFKKFAS+RE W
Sbjct  245  ISSVLTVMG-----ACGELGCSSLMDVERRHGKFKFVIKQAMVELEGAPFKKFASLREVW  299

Query  196  ALKNRYLNPGPIQFVGPVSDQVNHTLLLELG  104
            ALKNRY++PGPIQF GP SD ++HTLLL+LG
Sbjct  300  ALKNRYISPGPIQFTGPGSDALSHTLLLKLG  330



>gb|KJB69224.1| hypothetical protein B456_011G011600 [Gossypium raimondii]
Length=501

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+ G+WK+KLT Q L+LFE LPQAIQ+QL+LERDPHGNVQVAKIETEKMLIQM
Sbjct  353  ILAHDVVDEDGIWKKKLTNQSLKLFEFLPQAIQEQLMLERDPHGNVQVAKIETEKMLIQM  412

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+Q GSY G FKGQSHFFGYEGRCGLP+NFDA+YCYALGYGA ALL SGKTGL
Sbjct  413  VETELEKRKQEGSYKGHFKGQSHFFGYEGRCGLPTNFDASYCYALGYGAAALLHSGKTGL  472

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMD  299
            ISSVGNL APV +WTVGGTALTSLMD
Sbjct  473  ISSVGNLGAPVEEWTVGGTALTSLMD  498



>ref|XP_009788354.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit beta-like isoform X2 [Nicotiana sylvestris]
Length=516

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILA+ V+D+AG WK+KL  Q  +LFE LPQAIQ+QLLLERDPHGNVQVAKIETEKMLIQM
Sbjct  344  ILANDVIDEAGNWKKKLRSQSHELFEFLPQAIQEQLLLERDPHGNVQVAKIETEKMLIQM  403

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VE ELE +R+  SY   FKGQSHFFGYEGRCGLPSNFD+ YCYALGYGAGALL SGKTGL
Sbjct  404  VEAELENKRKESSYTKHFKGQSHFFGYEGRCGLPSNFDSNYCYALGYGAGALLHSGKTGL  463

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMDVERRH  284
            ISSVGNL APV DWTVGGTALTSLMDVERRH
Sbjct  464  ISSVGNLGAPVEDWTVGGTALTSLMDVERRH  494



>gb|ADE76702.1| unknown [Picea sitchensis]
Length=146

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  529  QSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAA  350
            + G+Y G FKGQSHFFGYEGRCGLP+NFDATYCYALGY AG LL +G TGLI+SVGNLAA
Sbjct  2    EEGTYKGHFKGQSHFFGYEGRCGLPTNFDATYCYALGYAAGVLLHAGHTGLIASVGNLAA  61

Query  349  PVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNP  170
            P  DW VGGTALT LMDVERR GKFKPVI+KAMV LDGAPFKKFAS+REEWAL+N+Y++P
Sbjct  62   PAKDWIVGGTALTQLMDVERRQGKFKPVIQKAMVALDGAPFKKFASLREEWALQNKYISP  121

Query  169  GPIQFVGPVSDQVNHTLLLELGA  101
            GPIQF GP +D+ N TL+LELGA
Sbjct  122  GPIQFFGPTADKSNFTLMLELGA  144



>gb|ABL10096.1| pyrophosphate-fructose-6-phosphate1-phosphotransferase beta subunit 
[Saccharum spontaneum]
Length=215

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  736  ILAHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQM  557
            ILAH VVD+AG WK KL P+  +LFE LP+ IQ+QL+LERDPHGNVQVAKIETEKMLI M
Sbjct  70   ILAHDVVDEAGAWKSKLQPESKELFEFLPETIQEQLMLERDPHGNVQVAKIETEKMLISM  129

Query  556  VETELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGL  377
            VETELE R+  G Y+  F+GQ+HFFGYEGRCGLP+NFD+ YCYALGYGAGALLQSGKTGL
Sbjct  130  VETELEKRKAEGRYSAHFRGQAHFFGYEGRCGLPTNFDSNYCYALGYGAGALLQSGKTGL  189

Query  376  ISSVGNLAAPVSDWTVGGTALTSLMD  299
            ISSVGN AAPV +WTVGGTALTSLMD
Sbjct  190  ISSVGNFAAPVEEWTVGGTALTSLMD  215



>ref|WP_009036818.1| diphosphate-fructose-6-phosphate 1-phosphotransferase, partial 
[Bacteroides sp. D20]
 gb|EFA21232.1| putative diphosphate--fructose-6-phosphate 1-phosphotransferase, 
partial [Bacteroides sp. D20]
Length=237

 Score =   241 bits (616),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  38   RKLSPENAVIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKF  97

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  98   VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  157

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  158  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAMETDYVYPGPIQY  217

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  218  FGPTEVCDQATKTLQLE  234



>ref|WP_006745515.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
coprosuis]
 gb|EGJ72360.1| diphosphate/fructose-6-phosphate1-phosphotransferase [Bacteroides 
coprosuis DSM 18011]
Length=547

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            + ++ +  +++  LPQ +  QL L+RDPHGNVQV+ IETEK+L +MV  +LE  R  G Y
Sbjct  348  KNISKENAKIYASLPQGVARQLTLDRDPHGNVQVSLIETEKLLSEMVANKLEEWRAEGKY  407

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
            NG+F  Q HFFGYEGRC  PSN+DA YCY+LGY A AL+ +GKTG +SSV N  AP ++W
Sbjct  408  NGKFSRQHHFFGYEGRCAAPSNYDADYCYSLGYTASALIANGKTGYMSSVRNTTAPAAEW  467

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+VELDGAPFKKFA+ RE+WA+  +Y+ PGPIQ+
Sbjct  468  IAGGVPITMMMNMERRHGEMKPVIQKALVELDGAPFKKFAASREDWAINTQYIYPGPIQY  527

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TLLLE G
Sbjct  528  FGPTEVCDQPTQTLLLEQG  546



>ref|XP_005652109.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase beta-subunit 
[Coccomyxa subellipsoidea C-169]
 gb|EIE27565.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase beta-subunit 
[Coccomyxa subellipsoidea C-169]
Length=515

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            +L+P  L +FE LP + + QLLL+RDPHGNVQV++IETE++L+Q+V+ ELE RR+ G + 
Sbjct  312  RLSPANLAVFEFLPASTRQQLLLDRDPHGNVQVSRIETEQLLLQLVDVELEKRRKEGKFA  371

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F G +H+FGYEGRC  P+NFDA YC  LGY AGAL+  GKTGL+++  +L  P +DWT
Sbjct  372  GKFAGITHYFGYEGRCSFPTNFDAAYCSTLGYVAGALVAGGKTGLMATASSLDKPCADWT  431

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
            VGG  L  +M +ERR GK KPVIKKA+VEL+G  FK F  MR +WA  + + +PGPIQF 
Sbjct  432  VGGYPLIDMMCIERRRGKDKPVIKKALVELEGPVFKAFQQMRRKWAQGDCFRSPGPIQFS  491

Query  151  GPVSDQVNHTLLLELGA*S*VN  86
            GP +D  N TL LELG    +N
Sbjct  492  GPNADAANFTLALELGTTKQIN  513



>ref|XP_004340159.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Acanthamoeba 
castellanii str. Neff]
 gb|ELR18139.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Acanthamoeba 
castellanii str. Neff]
Length=572

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = -2

Query  715  DDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELEL  536
            + A V   KLT +   +F+ LP AI+ +LLL+RDPHGNVQV+KIETEK+ I +V  EL+ 
Sbjct  359  NSADVVGEKLTEESRAVFDFLPSAIRHELLLDRDPHGNVQVSKIETEKLFIHLVTKELKR  418

Query  535  RRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNL  356
            R+ +G + G F    HFFGYEGRCGLPSNFD+ YCYALG  AGALL  G TG ++SV NL
Sbjct  419  RKANGQFKGSFSAMGHFFGYEGRCGLPSNFDSNYCYALGRTAGALLDHGLTGYMASVSNL  478

Query  355  AAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYL  176
             AP   W  GG  LT+LM++ERR GK  PVI+KA+V+LD AP+K+    RE+WA    Y 
Sbjct  479  TAPPEQWKSGGLPLTALMNMERRKGKNVPVIRKALVDLDAAPYKELLRHREKWARGEHYR  538

Query  175  NPGPIQFVGPVSDQVNHTLLLELG  104
            NPGPIQF GP S +VN TL LE G
Sbjct  539  NPGPIQFYGPASGEVNITLQLEFG  562



>ref|WP_018109477.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
propionicifaciens]
Length=547

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -2

Query  688  LTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYNG  509
            L+ +   +F  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV  +LE  R  G YNG
Sbjct  350  LSKENAAIFASLPAGVARQLTLDRDPHGNVQVSLIETEKLLSEMVADKLEAWRAEGKYNG  409

Query  508  QFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWTV  329
            +F  Q HFFGYEGRC  PSNFDA YCYALGY A AL+ +GKTG +SSV N  AP ++W  
Sbjct  410  KFSRQHHFFGYEGRCAAPSNFDADYCYALGYTASALIANGKTGYMSSVRNTTAPAAEWIA  469

Query  328  GGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFVG  149
            GG  +T LM++ERRHG  KPVI+KA+VELDGAPFK FA+ RE+WAL   Y+ PGPIQ+ G
Sbjct  470  GGVPITMLMNMERRHGMMKPVIQKALVELDGAPFKTFAANREDWALNTCYVYPGPIQYFG  529

Query  148  P--VSDQVNHTLLLELG  104
            P  V DQ   TL+LE G
Sbjct  530  PTQVCDQPTKTLVLEQG  546



>ref|WP_004307609.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEO53860.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_2_4]
 gb|EFF53530.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus SD CMC 3f]
 gb|EFS29958.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. D2]
 gb|EGM97315.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus 3_8_47FAA]
 emb|CDB59258.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus CAG:22]
 gb|KDS14869.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus str. 3725 D1 iv]
 gb|KDS20610.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fragilis str. 3725 D9 ii]
 gb|KDS44387.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus str. 3725 D9 iii]
Length=548

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FAS RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFASQRERWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_008648305.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 3_1_23]
 gb|EFI40664.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 3_1_23]
Length=548

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FAS RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFASQRERWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_009120576.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
clarus]
 gb|EGF54414.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
clarus YIT 12056]
Length=548

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   ++ G Y
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVAAKLAQWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  DW
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEDW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQPTKTLQLEQG  547



>ref|WP_004297384.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus]
 gb|EDO12506.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus ATCC 8483]
 gb|EIY65099.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus CL02T12C04]
Length=548

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_022043359.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
caccae CAG:21]
 emb|CCZ73781.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
caccae CAG:21]
Length=548

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQATKTLQLEQG  547



>ref|WP_022217804.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
clarus CAG:160]
 emb|CDB83182.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
clarus CAG:160]
Length=548

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   ++ G Y
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVAAKLAQWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  DW
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEDW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQPTKTLQLEQG  547



>ref|WP_005680621.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
caccae]
 gb|EIY21525.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
caccae CL03T12C61]
Length=548

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQATKTLQLEQG  547



>ref|WP_013548412.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
helcogenes]
 gb|ADV44825.1| pyrophosphate-dependent phosphofructokinase [Bacteroides helcogenes 
P 36-108]
Length=548

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPADEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAMETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_005677832.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
caccae]
 gb|EDM20812.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
caccae ATCC 43185]
Length=548

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQATKTLQLEQG  547



>ref|WP_016661325.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
stercoris]
 gb|EPH21200.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
stercoris CC31F]
Length=548

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   ++ G Y
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVAAKLAQWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V LDGAPFK FA+ RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVRLDGAPFKTFAAQRERWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPAEVCDQPTKTLQLEQG  547



>ref|WP_022103660.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 emb|CDA49604.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
stercoris CAG:120]
Length=548

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   ++ G Y
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVAAKLAQWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V LDGAPFK FA+ RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVRLDGAPFKAFAAQRERWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPAEVCDQPTKTLQLEQG  547



>ref|WP_022275035.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
finegoldii CAG:203]
 emb|CDC52556.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
finegoldii CAG:203]
Length=548

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_007758927.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
finegoldii]
 gb|EKJ92992.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
finegoldii CL09T03C10]
Length=548

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_007757428.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
finegoldii]
 gb|EEX43624.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
finegoldii DSM 17565]
Length=548

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_004314973.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEO49402.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. D1]
 gb|EEZ03477.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_22]
 gb|EFF57275.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
xylanisolvens SD CC 2a]
 gb|EFG13128.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
xylanisolvens SD CC 1b]
 gb|EFI11846.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. D22]
 gb|EIY65025.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
ovatus CL03T12C18]
 emb|CDL99890.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Bacteroides xylanisolvens SD CC 2a]
 emb|CDM06287.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Bacteroides xylanisolvens SD CC 1b]
Length=548

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   +++G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLASWKEAGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_024986627.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
acidifaciens]
Length=548

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_008021833.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 ref|YP_007792228.1| pyrophosphate-dependent phosphofructokinase [Bacteroides xylanisolvens 
XB1A]
 emb|CBK66647.1| pyrophosphate-dependent phosphofructokinase [Bacteroides xylanisolvens 
XB1A]
 gb|EGM99660.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 1_1_30]
 gb|EIY87557.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
xylanisolvens CL03T12C04]
Length=548

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAIETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_018669292.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
gallinarum]
Length=548

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVATKLAQWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQPTKTLQLEQG  547



>ref|WP_009123978.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fluxus]
 gb|EGF58971.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
fluxus YIT 12057]
Length=548

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPADEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAMETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V D+   TL LE
Sbjct  529  FGPTEVCDEPTKTLQLE  545



>ref|WP_010537577.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
faecis]
Length=548

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEDGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_016267907.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
thetaiotaomicron]
 gb|EOS01307.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
thetaiotaomicron dnLKV9]
Length=548

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEDGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_008760603.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 ref|NP_809220.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
thetaiotaomicron VPI-5482]
 gb|AAO75414.1| phosphofructokinase [Bacteroides thetaiotaomicron VPI-5482]
 gb|EES69858.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 1_1_6]
 gb|EFI05761.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 1_1_14]
 emb|CDE79583.1| phosphofructokinase [Bacteroides thetaiotaomicron CAG:40]
Length=548

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEDGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_005826644.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EDO54869.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis ATCC 8492]
 gb|EFV26366.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 4_1_36]
 gb|EIY73204.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis CL03T00C23]
 gb|EIY77838.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis CL03T12C37]
 gb|EOS07820.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis dnLKV2]
 emb|CDE02058.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis CAG:3]
 gb|KDS51490.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis str. 3978 T3 ii]
 gb|KDS60632.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis str. 3978 T3 i]
Length=548

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAMETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>gb|EDS15317.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
stercoris ATCC 43183]
Length=571

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   ++ G Y
Sbjct  372  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVAAKLAQWKEEGKY  431

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  432  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  491

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V LDGAPFK FA+ RE WA++  Y+ PGPIQ+
Sbjct  492  IAGGVPITMMMNMERRHGEMKPVIQKALVRLDGAPFKAFAAQRERWAVETDYVYPGPIQY  551

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  552  FGPAEVCDQPTKTLQLEQG  570



>emb|CDA83182.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:754]
Length=548

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLASWKEEGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAVETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQATKTLQLE  545



>ref|WP_002561703.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EIY52362.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
nordii CL02T12C05]
 gb|EOA55468.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. HPS0048]
Length=547

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   +  G Y
Sbjct  348  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLATWKAEGKY  407

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A  L+ +GKTG +SSV N  AP  +W
Sbjct  408  VGKFAAQHHFFGYEGRCAAPSNYDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEW  467

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+MR++WA+   Y+ PGPIQ+
Sbjct  468  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKTFAAMRDQWAMTTDYVYPGPIQY  527

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  528  FGPTEVCDQPTKTLQLE  544



>ref|WP_005923725.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EIY62959.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
salyersiae CL02T12C01]
 gb|EOA51424.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
salyersiae WAL 10018 = DSM 18765 = JCM 12988]
 emb|CCY51654.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:189]
Length=547

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   +  G Y
Sbjct  348  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLATWKAEGKY  407

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A  L+ +GKTG +SSV N  AP  +W
Sbjct  408  VGKFAAQHHFFGYEGRCAAPSNYDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEW  467

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+MR++WA+   Y+ PGPIQ+
Sbjct  468  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKTFAAMRDQWAMTTDYVYPGPIQY  527

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  528  FGPTEVCDQPTKTLQLE  544



>ref|WP_021846571.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:598]
 emb|CCX62273.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:598]
Length=548

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P    ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  350  KLSPANSAVYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKYV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+  GKTG +SSV N  AP  +W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTAAALIGEGKTGYMSSVRNTTAPAEEWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE+WA++  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQREQWAMETAYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  530  GPTEVCDQPTKTLQLEQG  547



>ref|WP_044468201.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
uniformis]
Length=548

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWAMETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQAAKTLQLE  545



>ref|WP_004292707.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii]
 gb|EFV31548.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii 1_2_48FAA]
Length=548

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G + 
Sbjct  350  KLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAQWKEEGKFV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKSFAAQRDRWAIETDYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  530  GPTEVCDQPTKTLQLEQG  547



>ref|WP_022020075.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:661]
 emb|CCZ48793.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:661]
Length=548

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P    ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  350  KLSPANSAVYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKYV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+  GKTG +SSV N  AP  +W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTAAALIGEGKTGYMSSVRNTTAPAEEWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE+WA++  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQREQWAMETAYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  530  GPTEVCDQPTKTLQLE  545



>ref|WP_025074602.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
faecichinchillae]
Length=548

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KLTP+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  350  KLTPENSAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVATKLATWKEEGKYV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FAS R+ WA +  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFASQRDRWATETDYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V D+   TL LE G
Sbjct  530  GPTEVCDEPTKTLQLEQG  547



>ref|WP_008144348.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEF77411.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
coprophilus DSM 18228 = JCM 13818]
 emb|CDC53645.1| putative uncharacterized protein [Bacteroides coprophilus CAG:333]
Length=547

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 143/196 (73%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KLTP+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  349  KLTPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFKKFA+ RE WA +  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKKFAACREAWAKETAYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLE  110
            GP  V D+   TL LE
Sbjct  529  GPTEVCDEPTKTLQLE  544



>ref|WP_004290431.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii]
 gb|EEC53640.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
eggerthii DSM 20697]
Length=548

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 143/196 (73%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G + 
Sbjct  350  KLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAQWKEEGKFV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A AL+ +GKTG +SSV N  AP  +W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYAASALIANGKTGYMSSVRNTTAPAEEWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WA++  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKSFAAQRDRWAIETDYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  530  GPTEVCDQPTKTLQLE  545



>ref|WP_025831498.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
stercorirosoris]
Length=548

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_013758252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense]
 gb|AEE16544.1| diphosphate/fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense DSM 12168]
Length=553

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 138/198 (70%), Gaps = 2/198 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            K  L+    + F+ LP AI  Q L +RDPHGNVQV++IETEK+L  MVE  L   +++GS
Sbjct  354  KSNLSAASYETFDSLPDAIAAQFLADRDPHGNVQVSRIETEKLLASMVEKRLAEMKKAGS  413

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            Y G+F   +HFFGYEGRC  PSNFDA YCYALGY A  L+ SG TG +SSV NL AP   
Sbjct  414  YTGKFSAYTHFFGYEGRCAFPSNFDADYCYALGYTAFMLIASGVTGYLSSVRNLTAPAEK  473

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            WT GG  LT +M++E+RHG  KPVI+KA+VELDG PFK FA+ R+EWA+K  YL PG IQ
Sbjct  474  WTAGGIPLTMMMNMEQRHGSKKPVIRKALVELDGKPFKTFAAHRDEWAVKTSYLFPGAIQ  533

Query  157  FVGP--VSDQVNHTLLLE  110
            + GP  V D    T+ LE
Sbjct  534  YYGPAEVCDLTTKTIKLE  551



>ref|WP_007570582.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EDV00131.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
coprocola DSM 17136]
 emb|CDA72399.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
coprocola CAG:162]
Length=547

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KLTP+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  349  KLTPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA +  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRETWAKETAYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  529  GPTEVCDQPTKTLQLE  544



>ref|WP_022130193.1| hypothetical protein [Bacteroides sp. CAG:530]
 emb|CDA74844.1| putative uncharacterized protein [Bacteroides sp. CAG:530]
Length=547

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 143/196 (73%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KLTP+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G + 
Sbjct  349  KLTPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGRFV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V LDGAPFK FA++REEWA +  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVRLDGAPFKAFAAVREEWAKETAYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  529  GPTEVCDQPTKTLQLE  544



>ref|WP_009131195.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
oleiciplenus]
 gb|EKU89345.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
oleiciplenus YIT 12058]
Length=548

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP   W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_021966993.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
intestinalis CAG:564]
 emb|CCY88162.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
intestinalis CAG:564]
Length=548

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP   W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_007214428.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEF87321.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
cellulosilyticus DSM 14838]
 gb|EIY28952.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
cellulosilyticus CL02T12C19]
 emb|CDB72962.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
cellulosilyticus CAG:158]
Length=548

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP   W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_044264258.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Bacteroides timonensis]
Length=548

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP   W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_022392567.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
intestinalis CAG:315]
 emb|CDD92987.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
intestinalis CAG:315]
Length=548

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENAAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP   W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_007663913.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
intestinalis]
 gb|EDV03696.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
intestinalis DSM 17393]
Length=548

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G +
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLAAWKEEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A +L+ +GKTG +SSV N  AP   W
Sbjct  409  VGKFASQHHFFGYEGRCAAPSNYDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R++WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDQWAITTDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  529  FGPTEVCDQPTKTLQLE  545



>ref|WP_024752338.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis]
 emb|CEM61263.1| Diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis]
Length=555

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 2/200 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            ++ L+   +Q+F  LP+ I  QLL++RDPHGNVQV++IETEK+L+ +V+ EL  R+ +G+
Sbjct  352  EKTLSKTSVQVFASLPEEISKQLLMDRDPHGNVQVSRIETEKLLLGLVQKELAARKNAGT  411

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            Y G F G +HFFGYEGRC  PSNFDA YCY+LG+ A  L+  G TG +SSV NL AP  +
Sbjct  412  YKGSFSGYTHFFGYEGRCAFPSNFDADYCYSLGFTAFLLIAQGLTGYLSSVRNLTAPADE  471

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            W  GG  LT +M++E+RHG  KPVIKKA+VELDG PF++FA  R++WA+   YL PG IQ
Sbjct  472  WQAGGVPLTMMMNMEQRHGSKKPVIKKALVELDGKPFQEFAKNRDKWAITTSYLYPGAIQ  531

Query  157  FVGP--VSDQVNHTLLLELG  104
            + GP  V D  + TL LE G
Sbjct  532  YYGPTEVCDAASKTLQLEQG  551



>ref|WP_005936237.1| MULTISPECIES: diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EOA58122.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
massiliensis B84634 = Timone 84634 = DSM 17679 = JCM 13223]
 emb|CDF13041.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:98]
Length=547

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  349  KLSKENSAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVATKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFKKFAS+R++WA +  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKKFASLRDKWATETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V D+   TL LE G
Sbjct  529  GPTEVCDEPTKTLQLEQG  546



>ref|WP_042372185.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroidaceae 
bacterium MS4]
Length=547

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+ +   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L + ++ G +
Sbjct  348  RKLSAENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVAAKLAVWKEEGKF  407

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
            +G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A  L+ +GKTG +SSV N  AP S+W
Sbjct  408  DGKFAAQHHFFGYEGRCAAPSNYDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPASEW  467

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ R+ WAL   Y+ PGPIQ+
Sbjct  468  IAGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRDRWALTTDYVYPGPIQY  527

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL LE
Sbjct  528  FGPTEVCDQPTKTLQLE  544



>ref|WP_021909550.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:755]
 emb|CCY15229.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:755]
Length=216

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 138/199 (69%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            + L+ +   ++  LP+ +  QL +ERDPHGNVQV+ IETEK+L +MV  +L   ++ G Y
Sbjct  17   KNLSKENADIYASLPEGVARQLTMERDPHGNVQVSLIETEKLLSEMVSKKLAQWKKEGKY  76

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSN+DA YCYALG  A  L+ +GKTG ++ V N  AP  +W
Sbjct  77   AGKFAAQHHFFGYEGRCAAPSNYDADYCYALGTSAAQLVANGKTGYMAIVKNTTAPAEEW  136

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVIKKA+V+LDGAPFK FA+ R+EWA    ++ PGPIQ+
Sbjct  137  VAGGVPITMMMNMERRHGEMKPVIKKALVKLDGAPFKTFAAHRDEWAKDTCFVYPGPIQY  196

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  197  FGPTEVCDQCTATLKLEQG  215



>ref|WP_027325820.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
pyogenes]
 dbj|GAE20126.1| pyrophosphate-dependent fructose 6-phosphate-1-kinase [Bacteroides 
pyogenes DSM 20611 = JCM 6294]
Length=548

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV T+L+  +++G Y 
Sbjct  350  KLSPENSAIYASLPDGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLDSWKKAGKYV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEWL  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V LDGAPFK FA+ R+ WA +  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVRLDGAPFKAFAAQRDRWAAETDYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  530  GPTEVCDQPTKTLQLE  545



>ref|WP_008979581.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Erysipelotrichaceae 
bacterium 5_2_54FAA]
 gb|EFE45588.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Erysipelotrichaceae 
bacterium 5_2_54FAA]
Length=552

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 143/208 (69%), Gaps = 9/208 (4%)
 Frame = -2

Query  706  GVWKRK-------LTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVET  548
              WK K       LT   + +F +LP+ IQ QL LERDPHGNVQV+ IE+EK+   +V+ 
Sbjct  343  ATWKEKYAFIENGLTKASMDVFAILPEGIQQQLFLERDPHGNVQVSLIESEKLFSALVKD  402

Query  547  ELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISS  368
            +LE RR++G+YNG+F    HFFGYEGRC  PSNFD+ YCY+LGY A  L+Q G TG +S 
Sbjct  403  KLEERRKAGTYNGKFNPLHHFFGYEGRCAFPSNFDSDYCYSLGYNAFMLIQYGYTGYLSK  462

Query  367  VGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALK  188
            + NL+ P S+W  GG  +T +M+VERRHG+ KPVI+KA+VELDG PFK F + REEWA +
Sbjct  463  ISNLSKPASEWVAGGMPITKMMNVERRHGEDKPVIRKALVELDGKPFKFFEAHREEWASE  522

Query  187  NRYLNPGPIQFVGP--VSDQVNHTLLLE  110
              ++ PG IQ+ GP  V D    TL LE
Sbjct  523  TCFVYPGAIQYYGPAEVCDITTRTLALE  550



>ref|WP_008689162.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Eubacterium 
sp. 3_1_31]
 gb|EHO83861.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Eubacterium 
sp. 3_1_31]
Length=552

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 143/208 (69%), Gaps = 9/208 (4%)
 Frame = -2

Query  706  GVWKRK-------LTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVET  548
              WK K       LT   + +F +LP+ IQ QL LERDPHGNVQV+ IE+EK+   +V+ 
Sbjct  343  ATWKEKYAFIENGLTKASMDVFAILPEGIQQQLFLERDPHGNVQVSLIESEKLFSALVKD  402

Query  547  ELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISS  368
            +LE RR++G+YNG+F    HFFGYEGRC  PSNFD+ YCY+LGY A  L+Q G TG +S 
Sbjct  403  KLEERRKAGTYNGKFNPLHHFFGYEGRCAFPSNFDSDYCYSLGYNAFMLIQYGYTGYLSK  462

Query  367  VGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALK  188
            + NL+ P S+W  GG  +T +M+VERRHG+ KPVI+KA+VELDG PFK F + REEWA +
Sbjct  463  ISNLSKPASEWVAGGMPITKMMNVERRHGEDKPVIRKALVELDGKPFKFFEAHREEWASE  522

Query  187  NRYLNPGPIQFVGP--VSDQVNHTLLLE  110
              ++ PG IQ+ GP  V D    TL LE
Sbjct  523  TCFVYPGAIQYYGPAEVCDITTRTLALE  550



>ref|WP_006843040.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
mossii]
 gb|EGK03602.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
mossii DSM 22836]
Length=548

 Score =   238 bits (606),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 145/206 (70%), Gaps = 2/206 (1%)
 Frame = -2

Query  715  DDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELEL  536
            D     ++ L+ +  ++F  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV  +L  
Sbjct  342  DQLAYIQKNLSAENAKIFASLPSGVARQLTLDRDPHGNVQVSLIETEKLLAEMVGNKLAE  401

Query  535  RRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNL  356
             + +G Y G+F  Q HFFGYEGRC  PSN+D+ YCY+LGY A AL+ +GKTG +SSV N 
Sbjct  402  MKAAGKYKGKFAAQEHFFGYEGRCATPSNYDSDYCYSLGYTAAALIAAGKTGYMSSVRNT  461

Query  355  AAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYL  176
             AP S+W  GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPF+ FA+ REEWA+   ++
Sbjct  462  TAPASEWIAGGVPVTMMMNMERRHGEMKPVIQKALVKLDGAPFQYFAAHREEWAVGTEFV  521

Query  175  NPGPIQFVGP--VSDQVNHTLLLELG  104
             PGPIQF GP  V DQ   TL LE G
Sbjct  522  YPGPIQFFGPSEVCDQPTVTLRLEQG  547



>ref|WP_022419924.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Eubacterium 
dolichum CAG:375]
 emb|CDE23747.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Eubacterium 
dolichum CAG:375]
Length=345

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 141/207 (68%), Gaps = 9/207 (4%)
 Frame = -2

Query  703  VWKRK-------LTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETE  545
             WK K       LT + +++F +LP+AIQ QL LERDPHGNVQV+ IE+EK+   +V  +
Sbjct  137  TWKEKYAFIENGLTKESMEVFAILPEAIQQQLFLERDPHGNVQVSLIESEKLFSALVADK  196

Query  544  LELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSV  365
            L  R+ +G+YNG+F    HFFGYEGRC  PSNFD+ YCY+LGY A  L+Q G  G +S +
Sbjct  197  LAQRKAAGTYNGKFNALHHFFGYEGRCAFPSNFDSDYCYSLGYNAFMLIQYGYNGYLSKI  256

Query  364  GNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKN  185
             NL+ P ++W  GG  +T +M++ERRHG+ KPVI+KA+VEL+G PFK F + REEWA   
Sbjct  257  SNLSKPANEWVAGGMPITKMMNIERRHGEDKPVIRKALVELEGKPFKFFEAHREEWAENT  316

Query  184  RYLNPGPIQFVGP--VSDQVNHTLLLE  110
             ++ PG IQ+ GP  V D    TL LE
Sbjct  317  CFVYPGAIQYYGPAEVCDITTRTLALE  343



>dbj|GAE16760.1| pyrophosphate-dependent fructose 6-phosphate-1-kinase [Bacteroides 
pyogenes JCM 6292]
Length=543

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV T+L+  +++G Y 
Sbjct  345  KLSPENSAIYASLPDGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLDSWKKAGKYV  404

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W 
Sbjct  405  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEWL  464

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V LDGAPFK FA+ R+ WA +  Y+ PGPIQ+ 
Sbjct  465  AGGVPITMMMNMERRHGEMKPVIQKALVRLDGAPFKAFAAQRDRWAAETDYVYPGPIQYF  524

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  525  GPTEVCDQPTKTLQLE  540



>ref|WP_013968126.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
caldaria]
 gb|AEJ18814.1| diphosphate/fructose-6-phosphate1-phosphotransfe rase [Treponema 
caldaria DSM 7334]
Length=551

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            +KL+ +  ++F  LP  I  QLL++RDPHGNVQV++IETEK+LI MVE  L   +++GSY
Sbjct  353  KKLSAESAKVFASLPAEIAKQLLMDRDPHGNVQVSRIETEKLLIGMVEQRLAELKKTGSY  412

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F   +HFFGYEGRC  PSNFDA Y YALG+ A  L+ SG TG +SSV NL AP   W
Sbjct  413  TGKFSALAHFFGYEGRCAFPSNFDADYTYALGFTAFVLIASGLTGYLSSVKNLTAPADQW  472

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  LT +M++E+RHG  KPVI+KA+VELDG PFK FA+ R EWA+K  +L PG IQ+
Sbjct  473  VAGGVPLTMMMNMEQRHGSKKPVIRKALVELDGKPFKAFAAKRAEWAVKTSFLFPGAIQY  532

Query  154  VGP--VSDQVNHTLLLE  110
             GP  V DQ   TL+LE
Sbjct  533  YGPSEVCDQPTKTLILE  549



>ref|WP_022499090.1| pyrophosphate-dependent phosphofructokinase [Firmicutes bacterium 
CAG:95]
 emb|CDF08762.1| pyrophosphate-dependent phosphofructokinase [Firmicutes bacterium 
CAG:95]
Length=553

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            ++ LT + +++F +LPQAIQ QL LERDPHGNVQV+ IE+EK+   +V+ +L  R+ +G+
Sbjct  353  EKGLTKESMEVFAILPQAIQQQLFLERDPHGNVQVSLIESEKLFSALVKDKLAARKAAGT  412

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            YNG+F    HF GYEGRC  PSNFD+ YCY+LGY A  L+Q G  G +S V NL+AP S+
Sbjct  413  YNGKFSALHHFLGYEGRCAFPSNFDSDYCYSLGYNAFMLIQYGYNGYLSKVSNLSAPASE  472

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            W  GG  +T +M++ERRHG+ KPVIKKA+VELDGAPFK F + REEW++   +  PG IQ
Sbjct  473  WVAGGMPITKMMNIERRHGEDKPVIKKALVELDGAPFKYFEAHREEWSVDTCFKYPGAIQ  532

Query  157  FVGP--VSDQVNHTLLLE  110
            + GP  V D    TL LE
Sbjct  533  YYGPTEVCDITTVTLALE  550



>ref|WP_002701079.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis]
 gb|EFW36626.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
phagedenis F0421]
Length=558

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 2/200 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            ++ L+   +Q+F  LP+ I  QLL++RDPHGNVQV++IETEK+L+ +V+ EL  R+ +G+
Sbjct  352  EKTLSKTSVQVFASLPEEISKQLLMDRDPHGNVQVSRIETEKLLLGLVQKELAARKNAGT  411

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            Y G F G +HFFGYEGRC  PSNFDA YCY+LG+ A  L+  G TG +SSV NL AP  +
Sbjct  412  YKGSFSGYTHFFGYEGRCAFPSNFDADYCYSLGFTAFLLIAQGLTGYLSSVRNLTAPADE  471

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            W  GG  LT +M++E+RHG  KPVIKKA+VELDG PF++FA  R++WA+   YL PG IQ
Sbjct  472  WQAGGVPLTMMMNMEQRHGSKKPVIKKALVELDGKPFQEFAKNRDKWAITTSYLYPGAIQ  531

Query  157  FVGP--VSDQVNHTLLLELG  104
            + GP  V D  + TL LE G
Sbjct  532  YYGPTEVCDAPSKTLQLEQG  551



>ref|WP_022023024.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Acinetobacter 
sp. CAG:196]
 emb|CCZ50942.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Acinetobacter 
sp. CAG:196]
Length=559

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = -2

Query  667  LFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSH  488
            +F+ LP  I+ QLL++RDPHGNVQV+KIETEK+LI M+E +L   ++ G Y+G+F  QSH
Sbjct  364  VFKSLPSLIKSQLLMDRDPHGNVQVSKIETEKLLISMIEEKLAGLKKEGKYSGKFSTQSH  423

Query  487  FFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTS  308
            FFGYEGRC  PSNFDA YCY+LG+ A AL+  G TG +SSV NL  P +DW  GG  LT 
Sbjct  424  FFGYEGRCAFPSNFDADYCYSLGFNAFALINFGLTGYLSSVRNLTEPANDWIAGGVPLTM  483

Query  307  LMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFVGP--VSDQ  134
            +M++ERRHG+ KPVIKKA+VELDG  FKK    RE+WA+ +RYL PG IQ+ GP  V D 
Sbjct  484  MMNMERRHGEMKPVIKKALVELDGPVFKKLEENREDWAMNDRYLFPGAIQYFGPSSVCDI  543

Query  133  VNHTLLLE  110
               TL LE
Sbjct  544  TTVTLQLE  551



>ref|WP_022458553.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Fusobacterium 
sp. CAG:439]
 emb|CDE58901.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Fusobacterium 
sp. CAG:439]
Length=559

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = -2

Query  667  LFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYNGQFKGQSH  488
            +F+ LP  I+ QLL++RDPHGNVQV+KIETEK+LI M+E +L   ++ G Y+G+F  QSH
Sbjct  364  VFKSLPSLIKSQLLMDRDPHGNVQVSKIETEKLLISMIEEKLAGLKKEGKYSGKFSTQSH  423

Query  487  FFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWTVGGTALTS  308
            FFGYEGRC  PSNFDA YCY+LG+ A AL+  G TG +SSV NL  P +DW  GG  LT 
Sbjct  424  FFGYEGRCAFPSNFDADYCYSLGFNAFALINFGLTGYLSSVRNLTEPANDWIAGGVPLTM  483

Query  307  LMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFVGP--VSDQ  134
            +M++ERRHG+ KPVIKKA+VELDG  FKK    RE+WA+ +RYL PG IQ+ GP  V D 
Sbjct  484  MMNMERRHGEMKPVIKKALVELDGPVFKKLEENREDWAMNDRYLFPGAIQYFGPSSVCDI  543

Query  133  VNHTLLLE  110
               TL LE
Sbjct  544  TTVTLQLE  551



>ref|WP_022231625.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:443]
 emb|CDB99241.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:443]
Length=547

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G Y 
Sbjct  349  KLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA +  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRETWAKETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  529  GPSEVCDQPTKTLQLE  544



>ref|WP_032945214.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus]
 gb|KDS32096.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus str. 3775 SL(B) 10 (iv)]
Length=547

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_005846138.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|ABR39945.1| phosphofructokinase [Bacteroides vulgatus ATCC 8482]
 gb|EET15757.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 4_3_47FAA]
 gb|EFG16238.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus PC510]
 gb|EFV67184.1| phosphofructokinase [Bacteroides sp. 3_1_40A]
 gb|EIY82003.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus CL09T03C04]
 gb|EOS05879.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus dnLKV7]
 emb|CDF19673.1| phosphofructokinase [Bacteroides vulgatus CAG:6]
 gb|KDS29549.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus str. 3775 SR(B) 19]
 gb|KDS55713.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus str. 3975 RP4]
Length=547

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_038605987.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
 gb|AII68372.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
Length=547

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_008652858.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEZ23442.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 3_1_33FAA]
 gb|AII62468.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
Length=547

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_007842406.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEO44717.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei 5_1_36/D4]
 gb|EEO61472.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 9_1_42FAA]
 gb|EIY30074.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CL02T00C15]
 gb|EIY38335.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CL02T12C06]
 gb|EIY39999.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CL03T12C01]
 emb|CDB37748.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CAG:222]
Length=547

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_021916966.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Brachyspira 
sp. CAG:484]
 emb|CCY23872.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Brachyspira 
sp. CAG:484]
Length=560

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 147/209 (70%), Gaps = 2/209 (1%)
 Frame = -2

Query  730  AHGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVE  551
            A  + D   + + +L P   +++  LP  I+ QLL +RDPHGNVQV+KIETEK+LI+M++
Sbjct  344  ATTIRDKFEIVENRLEPANAKVYNSLPALIKGQLLADRDPHGNVQVSKIETEKLLIEMIQ  403

Query  550  TELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLIS  371
            T L+  +  G Y G+F  QSHFFGYEGRC  PSNFDA YCY+LGY A AL+  G TG +S
Sbjct  404  TRLDELKSQGDYIGKFSAQSHFFGYEGRCAFPSNFDADYCYSLGYNAFALINFGLTGYLS  463

Query  370  SVGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWAL  191
            SV NL AP ++W  GG  LT +M++E+RHG+ KPVI+KA+V+LDG  FK+  + RE+WA+
Sbjct  464  SVRNLTAPAAEWVAGGIPLTMMMNMEKRHGEMKPVIQKALVKLDGPVFKQLEANREDWAI  523

Query  190  KNRYLNPGPIQFVGP--VSDQVNHTLLLE  110
             +RYL PG IQ+ GP  V D    TL LE
Sbjct  524  NDRYLFPGAIQYFGPSCVCDVTTCTLQLE  552



>ref|WP_025017895.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sartorii]
Length=547

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAVETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_016276863.1| MULTISPECIES: diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EOS11933.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
massiliensis dnLKV3]
Length=547

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAVETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_022163440.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:633]
 emb|CDB10683.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:633]
Length=548

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            RKL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   +  G +
Sbjct  349  RKLSPENSAIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLSQWKAEGKF  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
             G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A +L+ +GKTG +SSV N  AP  +W
Sbjct  409  VGKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTAASLIANGKTGYMSSVRNTTAPAEEW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERR+G+ KPVI+KA+V+LDGAPFK FA+ R+ WA +  Y+ PGPIQ+
Sbjct  469  IAGGVPITMMMNMERRNGEMKPVIQKALVKLDGAPFKTFAAQRDRWAKETDYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LE G
Sbjct  529  FGPTEVCDQPTKTLQLEQG  547



>ref|WP_007837134.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
 gb|EEB23867.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei DSM 17855]
Length=547

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G Y 
Sbjct  349  KLSKENSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKYV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIVNGKTGYMSSVRNTTAPAEEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE WA++  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAQRERWAIETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLELG  104
            GP  V DQ   TL LE G
Sbjct  529  GPTEVCDQATKTLQLEQG  546



>ref|WP_021645136.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
pyogenes]
 gb|ERI85452.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
pyogenes F0041]
Length=548

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 140/196 (71%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV T+L+  +++G Y 
Sbjct  350  KLSPENSAIYASLPDGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLDSWKKAGKYV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEWL  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V LD APFK FA+ R+ WA +  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVRLDAAPFKAFAAQRDRWAAETDYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  530  GPTEVCDQPTKTLQLE  545



>ref|WP_026625143.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
capnocytophagoides]
Length=548

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  694  RKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSY  515
            + L+     ++E LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   +++G Y
Sbjct  349  KNLSAVNAAIYESLPEGVARQLTLDRDPHGNVQVSLIETEKLLAEMVGNKLAEWKKAGKY  408

Query  514  NGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDW  335
            +G+F  Q HFFGYEGRC  PSN+DA YCY+LGY A A++ +GKTG +SSV N  AP   W
Sbjct  409  SGKFASQVHFFGYEGRCAAPSNYDADYCYSLGYTASAIIAAGKTGYMSSVRNTTAPADQW  468

Query  334  TVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQF  155
              GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ RE+WA+   Y+ PGPIQ+
Sbjct  469  IAGGVPVTMMMNMERRHGEMKPVIQKALVKLDGAPFKFFAANREKWAVGTEYVYPGPIQY  528

Query  154  VGP--VSDQVNHTLLLELG  104
             GP  V DQ   TL LELG
Sbjct  529  FGPTEVCDQPTITLKLELG  547



>ref|WP_007658653.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Parabacteroides]
 gb|EKN07938.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
goldsteinii CL02T12C30]
 gb|EMZ30988.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
sp. ASF519]
 gb|EOS17848.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
goldsteinii dnLKV18]
Length=548

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KLT +   L+  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L+  +++G YN
Sbjct  350  KLTKENSDLYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGKKLDEWKKAGKYN  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F    HFFGYEGRC  PSN+DA YCY+LGY A  L+ +GKTG +SSV N  AP   W 
Sbjct  410  GKFSALHHFFGYEGRCAAPSNYDADYCYSLGYTASCLIAAGKTGYMSSVRNTTAPAEKWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++E+RHG+ KPVI+KA+V+LDGAPFKKFA+ R+EWAL   Y+ PGPIQ+ 
Sbjct  470  AGGIPVTMMMNMEKRHGEMKPVIQKALVKLDGAPFKKFAANRDEWALTTSYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V D+   TL LE
Sbjct  530  GPTEVCDEPTKTLQLE  545



>ref|WP_022356272.1| pyrophosphate-dependent phosphofructokinase [Faecalitalea cylindroides]
 emb|CDD50968.1| pyrophosphate-dependent phosphofructokinase [Firmicutes bacterium 
CAG:308]
 gb|ERK47342.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [ [Faecalitalea 
cylindroides ATCC 27803]
Length=552

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 143/207 (69%), Gaps = 9/207 (4%)
 Frame = -2

Query  703  VWKRK-------LTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETE  545
             WK K       LT + + +F +LP+ IQ QL LERDPHGNVQV+ IE+EK+   +V+ +
Sbjct  344  TWKDKYEFIENGLTKESMSVFAILPETIQQQLFLERDPHGNVQVSLIESEKLFSALVKDK  403

Query  544  LELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSV  365
            LE R+++G+YNG+F    HF GYEGRC  PSNFD+ YCY+LGY A  L+Q G  G +S +
Sbjct  404  LEERKKNGTYNGKFNPLHHFLGYEGRCAFPSNFDSDYCYSLGYNAFMLIQYGYNGYLSKI  463

Query  364  GNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKN  185
             NL+ P S+W  GG  +T +M++ERRHG+ KPVIKKA+VELDG PFK F + REEWA++ 
Sbjct  464  SNLSKPASEWVAGGMPITKMMNIERRHGEDKPVIKKALVELDGKPFKYFEAHREEWAVET  523

Query  184  RYLNPGPIQFVGP--VSDQVNHTLLLE  110
             ++ PG IQ+ GP  V D    TL LE
Sbjct  524  SFVYPGAIQYYGPTEVCDITTKTLALE  550



>ref|WP_034542387.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
pyogenes]
 dbj|GAE21082.1| pyrophosphate-dependent fructose 6-phosphate-1-kinase [Bacteroides 
pyogenes JCM 10003]
Length=548

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 140/196 (71%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV T+L+  +++G Y 
Sbjct  350  KLSPENSAIYASLPDGVARQLTLDRDPHGNVQVSLIETEKLLSEMVATKLDSWKKAGKYV  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG +SSV N  AP ++W 
Sbjct  410  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIADGKTGYMSSVRNTTAPAAEWL  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V LD APFK FA+ R+ WA +  Y+ PGPIQ+ 
Sbjct  470  AGGVPITMMMNMERRHGEMKPVIQKALVRLDAAPFKAFAAQRDRWAAETDYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  530  GPTEVCDQPTKTLQLE  545



>emb|CBK24494.2| unnamed protein product [Blastocystis hominis]
 emb|CBK25089.2| unnamed protein product [Blastocystis hominis]
 emb|CBK20473.2| unnamed protein product [Blastocystis hominis]
Length=538

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -2

Query  727  HGVVDDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVET  548
            H   DD       L P   +LF+ LPQ+++DQL L+RD HGNV+V++IETEK ++  V+ 
Sbjct  327  HTAQDDIAA---HLQPASRELFDYLPQSLRDQLTLDRDSHGNVKVSQIETEKFIVSCVQK  383

Query  547  ELELRRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISS  368
            EL+  +  G Y+G F  Q HFFGYEGRCGLPS FD  YCYALGY AG L+  G  G++S+
Sbjct  384  ELDALKAQGVYSGSFNAQCHFFGYEGRCGLPSCFDTNYCYALGYNAGVLIHEGLNGMMST  443

Query  367  VGNLAAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALK  188
            + NL APV  WT GG  +T +M++ERR+GK +PVIKKA+VELDG P+++F    ++W L 
Sbjct  444  ISNLDAPVEAWTAGGVPVTMMMNIERRNGKDEPVIKKALVELDGLPYRRFVEQAKKWRLG  503

Query  187  NRYLNPGPIQFVGPVSDQVNHTLLLEL  107
            + Y  PGPIQF GP ++ +N TL  E+
Sbjct  504  DCYSFPGPIQFTGPAANVINQTLAYEI  530



>ref|WP_026475518.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alkaliflexus 
imshenetskii]
Length=549

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 140/196 (71%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +   +FE LP  I +QL+L+RDPHGNVQV+ IETEKMLI MV+ +L+  +++G + 
Sbjct  351  KLSKESALVFESLPNNIANQLMLDRDPHGNVQVSMIETEKMLIDMVKAKLKKMKKAGEFT  410

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F GQ HFFGYEGRC  PSNFDA YCY+LGY A  L+  GKTG ++SV NL  P   W 
Sbjct  411  GKFAGQGHFFGYEGRCAAPSNFDADYCYSLGYTASLLISEGKTGYMASVKNLTKPADQWV  470

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++E+RHG  KPVI+KA+V LDG PF+K  S REEWA+   Y+ PGPIQ+ 
Sbjct  471  AGGAPITMMMNMEKRHGHMKPVIQKALVMLDGKPFQKLESCREEWAIGTMYVYPGPIQYF  530

Query  151  GP--VSDQVNHTLLLE  110
            GP  V D   HTL LE
Sbjct  531  GPSEVCDTTTHTLRLE  546



>ref|WP_029901822.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. 10(H)]
Length=548

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 141/200 (71%), Gaps = 2/200 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            K  L+    ++F  LP  +  QL L+RDPHGNVQV+ IETEK+L +MV  +L   + +G 
Sbjct  348  KNNLSADNAKVFTSLPDGVARQLTLDRDPHGNVQVSLIETEKLLAEMVGNKLAEMKAAGE  407

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            Y G+F    HFFGYEGRC  PSN+DA YCY+LGY A AL+ +GKTG +SSV N  AP ++
Sbjct  408  YKGKFSALVHFFGYEGRCAAPSNYDADYCYSLGYTAAALIGAGKTGYMSSVRNTTAPANE  467

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            W  GG  +T +M++ERRHG+ KPVI+KA+VELDGAPFK FA+ RE WAL  +++ PGPIQ
Sbjct  468  WVAGGVPVTMMMNMERRHGEMKPVIRKALVELDGAPFKYFAANREAWALGTKFVYPGPIQ  527

Query  157  FVGP--VSDQVNHTLLLELG  104
            + GP  V DQ   TL LE G
Sbjct  528  YFGPTEVCDQSTVTLKLEQG  547



>ref|WP_024994586.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
paurosaccharolyticus]
Length=547

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+    +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L  MV  +L   ++ G + 
Sbjct  349  KLSKANSEIYASLPEGVARQLTLDRDPHGNVQVSLIETEKLLSDMVAVKLAQWKEEGKFV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LG+ A  L+ +G+TG +SSV NL AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGFTASVLIANGETGYMSSVRNLTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+ REEWA+K  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKFFAANREEWAIKTDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL LE
Sbjct  529  GPSSVCDQATRTLQLE  544



>ref|WP_028727537.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
gordonii]
Length=548

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KLT +   L+  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV  +L+  +++G YN
Sbjct  350  KLTKENSDLYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGKKLDEWKKAGKYN  409

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F    HFFGYEGRC  PSN+DA YCY+LGY A  L+ +GKTG +SSV N  AP   W 
Sbjct  410  GKFSALHHFFGYEGRCAAPSNYDADYCYSLGYTASCLIAAGKTGYMSSVRNTTAPADKWI  469

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++E+RHG+ KPVI+KA+V+LDGAPFKKFA+ R+EWA+   Y+ PGPIQ+ 
Sbjct  470  AGGIPVTMMMNMEKRHGEMKPVIQKALVKLDGAPFKKFAANRDEWAMTTSYVYPGPIQYF  529

Query  151  GP--VSDQVNHTLLLE  110
            GP  V D+   TL LE
Sbjct  530  GPTEVCDEPTKTLQLE  545



>ref|WP_034931503.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Erysipelotrichaceae 
bacterium NK3D112]
Length=553

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 2/206 (1%)
 Frame = -2

Query  715  DDAGVWKRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELEL  536
            D     ++ LTP+ + +F +LPQ IQ QL LERDPHGNVQV+ IE+EK+   +V+ +L+ 
Sbjct  347  DKYAFIEKGLTPESMAVFAILPQTIQQQLFLERDPHGNVQVSLIESEKLFSALVKAKLDE  406

Query  535  RRQSGSYNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNL  356
            R+ +G+Y G+F    HFFGYEGRC  PSNFDA YCY+LGY A  L+Q G  G +S + NL
Sbjct  407  RKAAGTYKGKFSALHHFFGYEGRCAFPSNFDADYCYSLGYNAFMLIQYGYNGYLSKISNL  466

Query  355  AAPVSDWTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYL  176
            + P  +W  GG  +T +M++ERRHG+ KPVI+KA+VELDG PFK F + R+ WA++  Y 
Sbjct  467  SKPADEWVAGGMPITKMMNMERRHGEDKPVIRKALVELDGKPFKYFEAHRDAWAVETAYT  526

Query  175  NPGPIQFVGP--VSDQVNHTLLLELG  104
             PG IQ+ GP  V D    TL LE G
Sbjct  527  YPGAIQYYGPSSVCDITTRTLALEKG  552



>ref|WP_034449876.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Butyrivibrio 
sp. AE2032]
Length=552

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            K  L+    ++F++LPQ IQ QL LERDPHGNVQV+ IE+EK+  +MV+ EL  R+++G+
Sbjct  353  KAGLSADAFKVFDILPQGIQQQLFLERDPHGNVQVSLIESEKLFSEMVKNELAKRKEAGT  412

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            Y G+F  Q HFFGYEGRC  PSNFDA YCY+LG+ A  L+Q G TG +S V N++ P  +
Sbjct  413  YKGKFGAQHHFFGYEGRCAFPSNFDADYCYSLGFNAFMLIQYGYTGYLSKVSNISKPADE  472

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            W  GG  +T +M++ERR+G  KPVI+KA+VELDG PFK F + RE+WA++  +  PG IQ
Sbjct  473  WVAGGMPITKMMNMERRNGADKPVIRKALVELDGKPFKYFEANREKWAVETAFTFPGAIQ  532

Query  157  FVGP--VSDQVNHTLLLELG  104
            + GP  V D+   TL LE G
Sbjct  533  YFGPSEVCDRTTVTLALEKG  552



>ref|WP_022353894.1| hypothetical protein [Bacteroides sp. CAG:875]
 emb|CDD48165.1| putative uncharacterized protein [Bacteroides sp. CAG:875]
Length=547

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+P+   ++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV T+L   ++ G + 
Sbjct  349  KLSPENAAIYASLPEGVARQLSLDRDPHGNVQVSLIETEKLLSEMVGTKLAQWKEEGKFV  408

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F  Q HFFGYEGRC  PSNFDA YCY+LGY A  L+ +GKTG +SSV N  AP ++W 
Sbjct  409  GKFAAQHHFFGYEGRCAAPSNFDADYCYSLGYTASMLIANGKTGYMSSVRNTTAPAAEWI  468

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+V+LDGAPFK FA+MR+ WA +  Y+ PGPIQ+ 
Sbjct  469  AGGVPITMMMNMERRHGEMKPVIQKALVKLDGAPFKAFAAMRDTWAKETDYVYPGPIQYF  528

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ   TL  E
Sbjct  529  GPSEVCDQPTKTLQYE  544



>ref|WP_021887993.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Firmicutes 
bacterium CAG:110]
 emb|CCX91598.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Firmicutes 
bacterium CAG:110]
Length=552

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 137/198 (69%), Gaps = 2/198 (1%)
 Frame = -2

Query  697  KRKLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGS  518
            K  LT Q + +F +LPQ+IQ QL LERDPHGNVQV+ IE+EK+   +V   L  R+ +G+
Sbjct  353  KNGLTKQSMDVFAILPQSIQQQLFLERDPHGNVQVSLIESEKLFSALVRDNLAARKAAGT  412

Query  517  YNGQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSD  338
            YNG+F  Q HF GYEGRC  PSNFDA YCY+LGY A  L+Q G TG +S V NL+ P  +
Sbjct  413  YNGKFSTQHHFLGYEGRCAFPSNFDADYCYSLGYNAFMLIQYGYTGYLSKVSNLSKPAEE  472

Query  337  WTVGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQ  158
            W  GG  +T +M++ERR+GK KPVI+KA+VELDG PF+ FA  R EWA +  Y+ PG IQ
Sbjct  473  WVAGGMPITKMMNMERRNGKDKPVIRKALVELDGKPFRFFAEHRAEWAAETCYVYPGAIQ  532

Query  157  FVGP--VSDQVNHTLLLE  110
            + GP  V D    TL LE
Sbjct  533  YFGPREVCDLTTRTLALE  550



>ref|WP_019540988.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Proteiniphilum 
acetatigenes]
Length=552

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -2

Query  691  KLTPQCLQLFELLPQAIQDQLLLERDPHGNVQVAKIETEKMLIQMVETELELRRQSGSYN  512
            KL+ +  +++  LP+ +  QL L+RDPHGNVQV+ IETEK+L +MV+  L+   Q G Y 
Sbjct  351  KLSRENAEIYASLPETVARQLTLDRDPHGNVQVSLIETEKLLAEMVKKRLDAWTQEGRYK  410

Query  511  GQFKGQSHFFGYEGRCGLPSNFDATYCYALGYGAGALLQSGKTGLISSVGNLAAPVSDWT  332
            G+F   +HFFGYEGRC  PSN+DA YCY+LGY A  L+ +GKTG +SSV N  AP  +W 
Sbjct  411  GKFSSITHFFGYEGRCAAPSNYDADYCYSLGYTASMLIAAGKTGYMSSVRNTTAPAKEWI  470

Query  331  VGGTALTSLMDVERRHGKFKPVIKKAMVELDGAPFKKFASMREEWALKNRYLNPGPIQFV  152
             GG  +T +M++ERRHG+ KPVI+KA+VELDGAPFK F S R++WA++  Y+ PGPIQ+ 
Sbjct  471  AGGVPITMMMNMERRHGELKPVIQKALVELDGAPFKYFESQRDQWAIETDYVYPGPIQYF  530

Query  151  GP--VSDQVNHTLLLE  110
            GP  V DQ + TL LE
Sbjct  531  GPTEVCDQPSKTLQLE  546



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500