BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025B11

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           274   1e-87   Sesamum indicum [beniseed]
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                273   3e-87   Prunus mume [ume]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                271   1e-86   Eucalyptus grandis [rose gum]
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                271   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                271   2e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     271   3e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           270   3e-86   Nicotiana tomentosiformis
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     270   4e-86   
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           270   6e-86   
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           270   7e-86   Nicotiana sylvestris
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     271   8e-86   Eucalyptus grandis [rose gum]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         269   1e-85   Prunus mume [ume]
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           269   1e-85   
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   269   1e-85   
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                269   2e-85   Solanum lycopersicum
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           268   2e-85   Solanum tuberosum [potatoes]
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   268   2e-85   
emb|CDP18434.1|  unnamed protein product                                270   2e-85   Coffea canephora [robusta coffee]
gb|KJB71614.1|  hypothetical protein B456_011G133700                    268   2e-85   Gossypium raimondii
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         268   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           268   3e-85   Fragaria vesca subsp. vesca
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                268   3e-85   Fragaria vesca subsp. vesca
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           268   4e-85   Nicotiana tomentosiformis
ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                267   5e-85   Nicotiana sylvestris
ref|NP_001274803.1|  uncharacterized protein LOC102577675               267   8e-85   Solanum tuberosum [potatoes]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     267   8e-85   Eucalyptus grandis [rose gum]
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             266   9e-85   Prunus persica
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           266   1e-84   Solanum tuberosum [potatoes]
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         266   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           268   2e-84   
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         265   5e-84   Malus domestica [apple tree]
gb|KJB84075.1|  hypothetical protein B456_N001600                       261   5e-84   Gossypium raimondii
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                265   5e-84   Nicotiana tomentosiformis
ref|XP_002524859.1|  ribosomal protein L5, putative                     265   6e-84   Ricinus communis
emb|CDP17898.1|  unnamed protein product                                266   7e-84   Coffea canephora [robusta coffee]
gb|KJB84074.1|  hypothetical protein B456_N001600                       263   8e-84   Gossypium raimondii
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  264   9e-84   Citrus sinensis [apfelsine]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           264   1e-83   Citrus sinensis [apfelsine]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                264   1e-83   Solanum lycopersicum
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             263   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           263   2e-83   Nicotiana sylvestris
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           263   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                263   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002524558.1|  ribosomal protein L5, putative                     263   3e-83   Ricinus communis
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                263   3e-83   Populus euphratica
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           263   4e-83   
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                263   4e-83   Cucumis melo [Oriental melon]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         262   5e-83   Tarenaya hassleriana [spider flower]
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           262   5e-83   
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         262   6e-83   Brachypodium distachyon [annual false brome]
gb|KJB84073.1|  hypothetical protein B456_N001600                       262   6e-83   Gossypium raimondii
gb|KJB84072.1|  hypothetical protein B456_N001600                       262   7e-83   Gossypium raimondii
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                262   8e-83   
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             264   9e-83   
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                261   1e-82   Pyrus x bretschneideri [bai li]
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             261   1e-82   Citrus clementina [clementine]
gb|EMT04099.1|  60S ribosomal protein L5-2                              261   1e-82   
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         261   2e-82   Jatropha curcas
gb|ABK93596.1|  unknown                                                 261   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             261   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                261   2e-82   Nelumbo nucifera [Indian lotus]
gb|KHN27258.1|  60S ribosomal protein L5                                260   4e-82   Glycine soja [wild soybean]
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           259   4e-82   Glycine max [soybeans]
gb|KJB27798.1|  hypothetical protein B456_005G010200                    259   5e-82   Gossypium raimondii
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    259   5e-82   Glycine max [soybeans]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           261   6e-82   Glycine max [soybeans]
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                259   6e-82   Elaeis guineensis
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           259   6e-82   Glycine max [soybeans]
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                259   7e-82   Malus domestica [apple tree]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                259   8e-82   Vitis vinifera
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           259   8e-82   Phoenix dactylifera
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           259   8e-82   Populus euphratica
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           259   9e-82   Citrus sinensis [apfelsine]
ref|XP_010101365.1|  60S ribosomal protein L5                           259   1e-81   
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   259   1e-81   Citrus sinensis [apfelsine]
emb|CBI24704.3|  unnamed protein product                                260   1e-81   Vitis vinifera
gb|ACU23594.1|  unknown                                                 259   1e-81   Glycine max [soybeans]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   259   1e-81   
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    259   1e-81   
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    259   1e-81   Elaeis guineensis
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           258   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    259   2e-81   
gb|EMS47485.1|  60S ribosomal protein L5-1                              257   2e-81   Triticum urartu
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           258   2e-81   Populus euphratica
gb|KHN36792.1|  60S ribosomal protein L5                                258   2e-81   Glycine soja [wild soybean]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           258   2e-81   Glycine max [soybeans]
gb|ACJ85054.1|  unknown                                                 258   2e-81   Medicago truncatula
ref|NP_001267659.1|  60S ribosomal protein L5                           258   3e-81   Cucumis sativus [cucumbers]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   259   3e-81   
dbj|BAB33422.1|  putative senescence-associated protein                 257   3e-81   Pisum sativum [garden pea]
gb|AEV92989.1|  60S ribosomal protein L5                                257   4e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              258   4e-81   Tarenaya hassleriana [spider flower]
gb|ADR71225.1|  60S ribosomal protein L5A                               257   5e-81   Hevea brasiliensis [jebe]
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           257   5e-81   Cicer arietinum [garbanzo]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           257   6e-81   Tarenaya hassleriana [spider flower]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           257   8e-81   Phoenix dactylifera
gb|AES74307.2|  60S ribosomal protein L5-2                              256   1e-80   Medicago truncatula
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             256   1e-80   Phaseolus vulgaris [French bean]
gb|AFW84308.1|  hypothetical protein ZEAMMB73_937605                    253   1e-80   
gb|ABK95722.1|  unknown                                                 256   1e-80   Populus trichocarpa [western balsam poplar]
gb|AFK41086.1|  unknown                                                 256   2e-80   Medicago truncatula
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             256   2e-80   
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   256   2e-80   Phaseolus vulgaris [French bean]
tpg|DAA56364.1|  TPA: hypothetical protein ZEAMMB73_635593              253   2e-80   
ref|XP_003604056.1|  60S ribosomal protein L5                           256   2e-80   
gb|ADR71226.1|  60S ribosomal protein L5B                               255   3e-80   Hevea brasiliensis [jebe]
dbj|BAJ89012.1|  predicted protein                                      255   3e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              254   5e-80   Brachypodium distachyon [annual false brome]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           254   5e-80   Cicer arietinum [garbanzo]
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             254   5e-80   Phaseolus vulgaris [French bean]
gb|ABK93902.1|  unknown                                                 254   5e-80   Populus trichocarpa [western balsam poplar]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             254   6e-80   Phaseolus vulgaris [French bean]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         254   6e-80   Setaria italica
gb|AFK36106.1|  unknown                                                 254   7e-80   Lotus japonicus
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         254   7e-80   Brachypodium distachyon [annual false brome]
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    254   8e-80   
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    254   8e-80   Phoenix dactylifera
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         253   1e-79   Jatropha curcas
gb|ACR38045.1|  unknown                                                 253   2e-79   Zea mays [maize]
gb|AFK39593.1|  unknown                                                 253   2e-79   Lotus japonicus
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    253   2e-79   Oryza brachyantha
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-79   
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    253   2e-79   
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                253   2e-79   Sesamum indicum [beniseed]
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         253   2e-79   Zea mays [maize]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              253   3e-79   Zea mays [maize]
gb|ACG36552.1|  60S ribosomal protein L5-1                              253   3e-79   Zea mays [maize]
gb|KJB22668.1|  hypothetical protein B456_004G060400                    253   3e-79   Gossypium raimondii
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             253   3e-79   Eutrema salsugineum [saltwater cress]
gb|EMS59984.1|  60S ribosomal protein L5-2                              253   3e-79   Triticum urartu
gb|AHA84189.1|  60S ribosomal protein L5                                252   3e-79   Phaseolus vulgaris [French bean]
gb|KJB22669.1|  hypothetical protein B456_004G060400                    252   4e-79   Gossypium raimondii
gb|AFK46994.1|  unknown                                                 252   4e-79   Lotus japonicus
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           252   5e-79   Sesamum indicum [beniseed]
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          252   5e-79   
ref|NP_001189970.1|  60S ribosomal protein L5-1                         248   6e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34395.1|  unknown                                                 251   8e-79   Lotus japonicus
gb|EMT23062.1|  60S ribosomal protein L5-2                              251   8e-79   
gb|EMT20601.1|  60S ribosomal protein L5-2                              251   9e-79   
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-78   Cucumis melo [Oriental melon]
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           251   2e-78   Cucumis sativus [cucumbers]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               251   2e-78   Erythranthe guttata [common monkey flower]
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      250   3e-78   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045083.1|  Os01g0896800                                       250   3e-78   
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        250   3e-78   Oryza sativa Indica Group [Indian rice]
ref|NP_001151284.1|  60S ribosomal protein L5-1                         250   4e-78   Zea mays [maize]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           250   4e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          249   4e-78   Sorghum bicolor [broomcorn]
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        249   4e-78   
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         249   5e-78   Tarenaya hassleriana [spider flower]
dbj|BAD82173.1|  putative ribosomal protein L5                          249   6e-78   Oryza sativa Japonica Group [Japonica rice]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    249   6e-78   Gossypium raimondii
dbj|BAH20263.1|  AT3G25520                                              245   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           248   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_566767.1|  60S ribosomal protein L5-1                            248   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             248   2e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         248   2e-77   Oryza brachyantha
gb|KJB10810.1|  hypothetical protein B456_001G226000                    246   7e-77   Gossypium raimondii
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           248   7e-77   Elaeis guineensis
ref|XP_002876523.1|  predicted protein                                  246   9e-77   Arabidopsis lyrata subsp. lyrata
gb|KHN15970.1|  60S ribosomal protein L5                                246   1e-76   Glycine soja [wild soybean]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         246   1e-76   
ref|NP_198790.1|  60S ribosomal protein L5-2                            246   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              246   2e-76   
gb|AAM64753.1|  ribosomal protein, putative                             245   2e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52294.1|  BnaA03g57870D                                          246   2e-76   Brassica napus [oilseed rape]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    245   2e-76   Camelina sativa [gold-of-pleasure]
emb|CDY27889.1|  BnaA07g04790D                                          245   2e-76   Brassica napus [oilseed rape]
emb|CDY15088.1|  BnaC03g44490D                                          246   2e-76   Brassica napus [oilseed rape]
emb|CDY52293.1|  BnaA03g57860D                                          246   3e-76   Brassica napus [oilseed rape]
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             244   4e-76   Capsella rubella
emb|CDY50258.1|  BnaC07g47930D                                          244   7e-76   Brassica napus [oilseed rape]
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         244   7e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             243   1e-75   Capsella rubella
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         243   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         243   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         243   1e-75   Brassica rapa
emb|CDY15089.1|  BnaC03g44500D                                          243   2e-75   Brassica napus [oilseed rape]
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             243   2e-75   
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             242   3e-75   
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    242   5e-75   Arabis alpina [alpine rockcress]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    241   8e-75   Brassica rapa
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         241   1e-74   Brassica rapa
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             240   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_009384265.1|  PREDICTED: 60S ribosomal protein L5-like iso...    238   2e-74   
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    239   3e-74   Arabis alpina [alpine rockcress]
emb|CDX86312.1|  BnaA06g30290D                                          239   6e-74   
emb|CDX85331.1|  BnaC07g26420D                                          241   2e-73   
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             236   1e-72   Capsella rubella
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    235   2e-72   
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            231   3e-71   
gb|ABK21084.1|  unknown                                                 231   5e-71   Picea sitchensis
gb|KJB71615.1|  hypothetical protein B456_011G133700                    225   8e-69   Gossypium raimondii
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     226   8e-69   Eucalyptus grandis [rose gum]
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   224   1e-68   Citrus sinensis [apfelsine]
gb|KCW63927.1|  hypothetical protein EUGRSUZ_G016041                    220   1e-68   Eucalyptus grandis [rose gum]
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  223   5e-68   Citrus sinensis [apfelsine]
ref|XP_010648788.1|  PREDICTED: 60S ribosomal protein L5-like           220   6e-68   Vitis vinifera
ref|XP_009384264.1|  PREDICTED: 60S ribosomal protein L5-like iso...    219   8e-68   
ref|XP_001759628.1|  predicted protein                                  222   2e-67   
ref|XP_001767871.1|  predicted protein                                  220   1e-66   
ref|XP_001783411.1|  predicted protein                                  218   1e-65   
ref|XP_001783620.1|  predicted protein                                  217   1e-65   
gb|EPS61271.1|  hypothetical protein M569_13526                         213   8e-65   Genlisea aurea
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         213   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          210   8e-63   
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   207   1e-61   Phaseolus vulgaris [French bean]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    204   2e-60   
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             201   3e-59   Selaginella moellendorffii
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             199   3e-58   Selaginella moellendorffii
gb|KHG04393.1|  60S ribosomal L5                                        190   1e-55   Gossypium arboreum [tree cotton]
gb|EYU36673.1|  hypothetical protein MIMGU_mgv1a0142632mg               183   2e-54   Erythranthe guttata [common monkey flower]
gb|KHG14330.1|  60S ribosomal L5                                        187   3e-54   Gossypium arboreum [tree cotton]
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  185   1e-53   Citrus sinensis [apfelsine]
gb|KHG10378.1|  60S ribosomal protein L5                                181   8e-52   Gossypium arboreum [tree cotton]
gb|KHG10377.1|  60S ribosomal protein L5                                181   1e-51   Gossypium arboreum [tree cotton]
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           177   2e-50   
gb|KHF99386.1|  60S ribosomal L5                                        173   6e-49   Gossypium arboreum [tree cotton]
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              174   1e-48   Chlorella variabilis
gb|KHG15135.1|  60S ribosomal L5                                        172   2e-48   Gossypium arboreum [tree cotton]
ref|XP_011399144.1|  60S ribosomal protein L5-1                         172   2e-48   Auxenochlorella protothecoides
ref|XP_010451808.1|  PREDICTED: 60S ribosomal protein L5-1-like         165   4e-47   
sp|P93779.1|RL5_SOLME  RecName: Full=60S ribosomal protein L5           161   4e-46   Solanum melongena [aubergine]
gb|KJB10809.1|  hypothetical protein B456_001G226000                    164   5e-46   Gossypium raimondii
gb|KDD76608.1|  ribosomal L18p/L5e                                      163   7e-45   Helicosporidium sp. ATCC 50920
gb|EPS64989.1|  hypothetical protein M569_09790                         160   2e-44   Genlisea aurea
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             156   2e-42   
ref|XP_006447906.1|  hypothetical protein CICLE_v10016107mg             154   3e-42   
ref|XP_009383145.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    152   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO51034.1|  hypothetical protein CISIN_1g022424mg                   152   2e-41   Citrus sinensis [apfelsine]
gb|KJB22672.1|  hypothetical protein B456_004G060400                    151   6e-41   Gossypium raimondii
gb|KJB22671.1|  hypothetical protein B456_004G060400                    151   6e-41   Gossypium raimondii
ref|XP_003856228.1|  60S ribosomal protein L5                           152   1e-40   Zymoseptoria tritici IPO323
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             152   3e-40   Emiliania huxleyi CCMP1516
ref|XP_005643753.1|  60S ribosomal protein L5                           149   2e-39   Coccomyxa subellipsoidea C-169
ref|XP_011197235.1|  PREDICTED: 60S ribosomal protein L5                149   2e-39   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004533872.1|  PREDICTED: 60S ribosomal protein L5-like           149   2e-39   Ceratitis capitata [medfly]
ref|XP_011191002.1|  PREDICTED: 60S ribosomal protein L5                148   7e-39   Zeugodacus cucurbitae [melon fruit fly]
gb|ADQ73874.1|  60S ribosomal protein L5                                148   8e-39   Laodelphax striatella
gb|EME50014.1|  hypothetical protein DOTSEDRAFT_31141                   148   9e-39   Dothistroma septosporum NZE10
gb|EMF17397.1|  60S ribosomal protein L5                                147   1e-38   Sphaerulina musiva SO2202
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   146   2e-38   Coptotermes formosanus
ref|XP_008198550.1|  PREDICTED: 60S ribosomal protein L5                147   2e-38   Tribolium castaneum [rust-red flour beetle]
dbj|BAN20290.1|  ribosomal protein L5                                   147   2e-38   Riptortus pedestris
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       147   2e-38   Necator americanus
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     146   4e-38   Ancylostoma ceylanicum
sp|Q56FG6.1|RL5_LYSTE  RecName: Full=60S ribosomal protein L5           145   8e-38   Lysiphlebus testaceipes
ref|XP_006611949.1|  PREDICTED: 60S ribosomal protein L5-like           145   9e-38   Apis dorsata [rock honeybee]
ref|XP_624620.2|  PREDICTED: 60S ribosomal protein L5                   145   9e-38   Apis mellifera [bee]
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 144   1e-37   Ixodes scapularis [blacklegged tick]
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           144   2e-37   Caenorhabditis briggsae
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      144   2e-37   Caenorhabditis briggsae
ref|XP_007920104.1|  hypothetical protein MYCFIDRAFT_54807              144   3e-37   Pseudocercospora fijiensis CIRAD86
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           144   3e-37   Suberites domuncula
emb|CAJ17229.1|  ribosomal protein L5e                                  143   3e-37   Carabus granulatus
ref|NP_001037008.1|  60S ribosomal protein L5                           144   3e-37   Bombyx mori [silk moth]
ref|NP_495811.1|  Protein RPL-5                                         143   4e-37   Caenorhabditis elegans [roundworm]
ref|NP_001036387.1|  ribosomal protein L5, isoform A                    143   4e-37   Drosophila melanogaster
gb|AAV34814.1|  ribosomal protein L5                                    143   4e-37   Bombyx mori [silk moth]
ref|XP_001973913.1|  GG21448                                            143   4e-37   
ref|XP_002675028.1|  predicted protein                                  143   5e-37   Naegleria gruberi strain NEG-M
ref|XP_002109848.1|  expressed hypothetical protein                     143   5e-37   Trichoplax adhaerens
dbj|GAM82159.1|  hypothetical protein ANO11243_001380                   143   5e-37   fungal sp. No.11243
ref|XP_002044351.1|  GM26730                                            143   6e-37   Drosophila sechellia
gb|KDR11979.1|  60S ribosomal protein L5                                142   9e-37   Zootermopsis nevadensis
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      142   9e-37   Caenorhabditis brenneri
ref|XP_003487475.1|  PREDICTED: 60S ribosomal protein L5-like           142   1e-36   Bombus impatiens
gb|AAN73355.1|  ribosomal protein L5                                    141   1e-36   Branchiostoma lanceolatum [common lancelet]
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  142   1e-36   Daphnia pulex
gb|KDO24705.1|  hypothetical protein SPRG_10239                         142   1e-36   Saprolegnia parasitica CBS 223.65
ref|XP_002066772.1|  GK24660                                            142   2e-36   Drosophila willistoni
ref|XP_002023101.1|  GL21177                                            142   2e-36   Drosophila persimilis
gb|KHJ99496.1|  ribosomal L18p/L5e family protein                       142   2e-36   Oesophagostomum dentatum [nodule worm]
gb|KID66354.1|  Ribosomal protein L5, eukaryotic/archaeal               141   2e-36   Metarhizium anisopliae ARSEF 549
ref|XP_008605837.1|  50S ribosomal protein L5e                          141   2e-36   Saprolegnia diclina VS20
ref|XP_003693438.1|  PREDICTED: 60S ribosomal protein L5-like           141   2e-36   
ref|XP_003394373.1|  PREDICTED: 60S ribosomal protein L5-like           142   2e-36   
gb|KID85893.1|  Ribosomal protein L5, eukaryotic/archaeal               141   3e-36   
ref|XP_007816229.1|  Ribosomal protein L5, eukaryotic/archaeal          141   3e-36   
ref|XP_008022306.1|  hypothetical protein SETTUDRAFT_167313             139   3e-36   
ref|XP_007674186.1|  hypothetical protein BAUCODRAFT_146209             141   3e-36   
gb|KHN36791.1|  60S ribosomal protein L5                                139   3e-36   
gb|KID72246.1|  Ribosomal protein L5, eukaryotic/archaeal               141   3e-36   
ref|XP_002002621.1|  GI17484                                            146   4e-36   
gb|ACH56834.1|  60S ribosomal protein L5                                139   4e-36   
ref|XP_001966910.1|  GF22760                                            141   4e-36   
gb|KEQ82579.1|  hypothetical protein M438DRAFT_398586                   140   4e-36   
gb|KGG50093.1|  60S ribosomal protein L5-2                              141   4e-36   
ref|XP_005188116.1|  PREDICTED: 60S ribosomal protein L5                140   5e-36   
ref|XP_008553482.1|  PREDICTED: 60S ribosomal protein L5                140   5e-36   
gb|KEF55260.1|  60S ribosomal protein L5                                140   5e-36   
gb|KEQ95896.1|  hypothetical protein AUEXF2481DRAFT_39748               140   5e-36   
emb|CBN08634.1|  small nucleolar RNA, C/D box 21                        140   7e-36   
ref|XP_011264134.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    140   7e-36   
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           140   8e-36   
emb|CCE29368.1|  probable 60S ribosomal protein L5                      140   8e-36   
emb|CEJ93107.1|  Putative 60S ribosomal protein L5 (CPR4)               138   8e-36   
ref|XP_009492195.1|  50S ribosomal protein L5e                          139   9e-36   
gb|EKG20809.1|  Ribosomal protein L18/L5                                139   1e-35   
gb|EMR84013.1|  putative 60s ribosomal protein l5 protein               139   1e-35   
gb|KFY83677.1|  hypothetical protein V500_10007                         139   1e-35   
ref|XP_005107604.1|  PREDICTED: 60S ribosomal protein L5-like           139   1e-35   
gb|KHN80572.1|  60S ribosomal protein L5                                140   1e-35   
ref|XP_011302246.1|  PREDICTED: 60S ribosomal protein L5                139   1e-35   
ref|XP_003424029.1|  PREDICTED: 60S ribosomal protein L5                139   1e-35   
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   139   1e-35   
ref|XP_001912102.1|  hypothetical protein                               139   1e-35   
ref|XP_001547892.1|  60S ribosomal protein L5                           139   2e-35   
ref|XP_011264968.1|  PREDICTED: 60S ribosomal protein L5-like           139   2e-35   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     139   2e-35   
gb|ACB37346.1|  Ts5 protein                                             139   2e-35   
gb|KFY58522.1|  hypothetical protein V496_06088                         139   2e-35   
gb|EUB56475.1|  60S ribosomal protein L5                                139   2e-35   
gb|EFZ13276.1|  hypothetical protein SINV_12586                         139   2e-35   
gb|KFY37418.1|  hypothetical protein V494_04756                         139   2e-35   
ref|XP_011167373.1|  PREDICTED: 60S ribosomal protein L5                139   2e-35   
emb|CCU97371.1|  unnamed protein product                                139   2e-35   
ref|XP_011150405.1|  PREDICTED: 60S ribosomal protein L5-like           139   2e-35   
gb|EPZ34992.1|  60S ribosomal protein L5                                139   2e-35   
gb|KEZ38694.1|  hypothetical protein SAPIO_CDS10715                     138   3e-35   
gb|KFZ19673.1|  hypothetical protein V501_00580                         138   3e-35   
emb|CDS19989.1|  ribosomal protein l5                                   138   3e-35   
gb|KEQ61687.1|  hypothetical protein M437DRAFT_67147                    138   3e-35   
ref|XP_003708145.1|  PREDICTED: 60S ribosomal protein L5-like           138   3e-35   
gb|EFN62403.1|  60S ribosomal protein L5                                139   3e-35   
gb|ACZ13335.1|  60S ribosomal protein L5                                138   4e-35   
gb|KFY22525.1|  hypothetical protein V493_06526                         138   4e-35   
emb|CCF48291.1|  probable RPL5-60S large subunit ribosomal protei...    138   4e-35   
gb|EFN77280.1|  60S ribosomal protein L5                                139   4e-35   
gb|KEQ78036.1|  hypothetical protein M436DRAFT_59974                    138   4e-35   
ref|XP_007813241.1|  60S ribosomal protein L5                           138   5e-35   
gb|EHL03541.1|  putative 60S ribosomal protein L5                       138   5e-35   
ref|XP_008083855.1|  Translational machinery component                  138   5e-35   
emb|CDI98331.1|  ribosomal protein l5                                   137   5e-35   
ref|XP_009847564.1|  hypothetical protein NEUTE1DRAFT_75066             137   6e-35   
ref|XP_003117386.1|  CRE-RPL-5 protein                                  137   7e-35   
gb|EHK26573.1|  hypothetical protein TRIVIDRAFT_77851                   137   7e-35   
ref|XP_001800680.1|  hypothetical protein SNOG_10409                    136   7e-35   
gb|KHN96356.1|  60S ribosomal protein L5                                137   7e-35   
ref|XP_002176750.1|  predicted protein                                  137   7e-35   
ref|XP_004337717.1|  ribosomal L18p/L5e family                          137   7e-35   
emb|CEJ93106.1|  Putative 60S ribosomal protein L5 (CPR4)               137   7e-35   
ref|XP_002051284.1|  GJ15046                                            143   7e-35   
gb|KFY16774.1|  hypothetical protein V492_01113                         137   7e-35   
gb|EHJ70750.1|  ribosomal protein L5                                    137   7e-35   
ref|XP_001648896.1|  AAEL004325-PA                                      137   7e-35   
sp|O22608.1|RL5_DUNSA  RecName: Full=60S ribosomal protein L5           136   8e-35   
gb|EMD90558.1|  hypothetical protein COCHEDRAFT_1022415                 137   8e-35   
ref|XP_008474018.1|  PREDICTED: 60S ribosomal protein L5                137   8e-35   
ref|XP_011054859.1|  PREDICTED: 60S ribosomal protein L5                137   8e-35   
ref|NP_001104213.1|  uncharacterized protein LOC100126642               137   8e-35   
ref|XP_007687883.1|  hypothetical protein COCMIDRAFT_36698              137   8e-35   
gb|KFY79291.1|  hypothetical protein V499_01707                         137   9e-35   
ref|XP_003715227.1|  60S ribosomal protein L5                           137   1e-34   
ref|XP_008861011.1|  hypothetical protein H310_00139                    137   1e-34   
ref|XP_003349274.1|  60S ribosomal protein L5                           137   1e-34   
gb|KIW03639.1|  60S ribosomal protein L5                                137   1e-34   
gb|KDB12690.1|  60S ribosomal protein L5                                137   2e-34   
ref|XP_001588768.1|  60S ribosomal protein L5                           136   2e-34   
ref|XP_007712612.1|  hypothetical protein COCCADRAFT_5332               136   2e-34   
ref|XP_007705225.1|  hypothetical protein COCSADRAFT_41417              136   2e-34   
ref|XP_001940200.1|  60S ribosomal protein L5                           136   2e-34   
gb|KIW74224.1|  60S ribosomal protein L5                                136   2e-34   
gb|KFM66007.1|  60S ribosomal protein L5-A                              135   2e-34   
ref|XP_001268969.1|  60S ribosomal protein L5                           136   2e-34   
ref|XP_007290078.1|  60S ribosomal protein L5                           136   2e-34   
ref|XP_009830190.1|  hypothetical protein H257_06606                    136   3e-34   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           136   3e-34   
gb|AEL28875.1|  ribosomal protein L5                                    135   3e-34   
ref|XP_960578.1|  60s ribosomal protein l5                              136   3e-34   
gb|KIW09974.1|  60S ribosomal protein L5                                135   3e-34   
gb|ACK44339.1|  ribosomal protein L5                                    134   3e-34   
ref|XP_001634531.1|  predicted protein                                  135   3e-34   
gb|KIK30810.1|  hypothetical protein PISMIDRAFT_86523                   135   3e-34   
ref|XP_003842266.1|  similar to 60S ribosomal protein L5                136   4e-34   
gb|KFX88354.1|  hypothetical protein V490_07682                         135   4e-34   
ref|XP_011147768.1|  PREDICTED: 60S ribosomal protein L5-like           135   4e-34   
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                135   4e-34   
ref|XP_007746291.1|  60S ribosomal protein L5                           135   4e-34   
ref|XP_001993074.1|  GH13292                                            140   5e-34   
gb|EJK70557.1|  hypothetical protein THAOC_08069                        135   5e-34   
gb|ADV40159.1|  putative 60S ribosomal protein L5                       135   5e-34   
ref|XP_003006324.1|  60S ribosomal protein L5                           135   5e-34   
ref|XP_004310188.1|  PREDICTED: 60S ribosomal protein L5-2-like         132   5e-34   
ref|XP_007581033.1|  putative 60s ribosomal protein l5 protein          135   5e-34   
gb|KIW93473.1|  60S ribosomal protein L5                                135   5e-34   
emb|CCU76476.1|  60S ribosomal protein L5                               135   5e-34   
ref|XP_011506330.1|  PREDICTED: 60S ribosomal protein L5                135   5e-34   
ref|XP_003298671.1|  60S ribosomal protein L5                           135   6e-34   
gb|EFN62999.1|  60S ribosomal protein L5                                140   6e-34   
ref|XP_007337949.1|  hypothetical protein AURDEDRAFT_110414             135   6e-34   
dbj|BAM19090.1|  ribosomal protein L5                                   135   6e-34   
ref|XP_002478553.1|  60S ribosomal protein L5                           135   6e-34   
ref|XP_008730876.1|  60S ribosomal protein L5                           135   6e-34   
gb|KIW58102.1|  60S ribosomal protein L5                                135   7e-34   
ref|XP_006460296.1|  hypothetical protein AGABI2DRAFT_142569            135   7e-34   
ref|XP_008715217.1|  60S ribosomal protein L5                           135   7e-34   
gb|KIX96197.1|  60S ribosomal protein L5                                135   7e-34   
gb|EFN79020.1|  60S ribosomal protein L5                                135   7e-34   
gb|ACG27083.1|  60S ribosomal protein L5-2                              135   7e-34   
ref|XP_007329342.1|  hypothetical protein AGABI1DRAFT_84575             135   7e-34   
ref|NP_001187210.1|  ribosomal protein L5b                              135   7e-34   
emb|CCX32875.1|  Similar to 60S ribosomal protein L5; acc. no. O5...    134   7e-34   
gb|KFA64074.1|  hypothetical protein S40285_06737                       135   7e-34   
ref|XP_005706768.1|  60S ribosomal protein L5e                          134   7e-34   
emb|CCQ18634.1|  60S ribosomal protein L5                               134   8e-34   
ref|XP_006968241.1|  ribosomal protein L5                               134   8e-34   
gb|ADT80695.1|  ribosomal protein L5                                    134   8e-34   
emb|CDI55135.1|  probable RPL5-60S large subunit ribosomal protei...    134   9e-34   
ref|XP_009648689.1|  60S ribosomal protein L5                           134   9e-34   
gb|KHJ35883.1|  putative 60s ribosomal protein l5                       134   9e-34   
ref|XP_007880337.1|  hypothetical protein PFL1_04620                    134   9e-34   
ref|XP_001392690.2|  60S ribosomal protein L5                           134   1e-33   
emb|CAK45545.1|  unnamed protein product                                134   1e-33   
ref|XP_001854652.1|  60S ribosomal protein L5                           134   1e-33   
ref|XP_001639289.1|  predicted protein                                  134   1e-33   
ref|XP_001951987.1|  PREDICTED: 60S ribosomal protein L5                134   1e-33   
ref|XP_002295395.1|  RL5, ribosomal protein 5, 60S large ribosoma...    134   1e-33   
gb|KEY69974.1|  hypothetical protein S7711_03992                        134   1e-33   
ref|NP_983506.1|  60S ribosomal protein L5                              134   1e-33   
ref|XP_011390982.1|  ribosomal 60S subunit protein L5                   134   1e-33   
ref|XP_003743796.1|  PREDICTED: 60S ribosomal protein L5-like           134   1e-33   
gb|KFY01844.1|  hypothetical protein O988_02499                         134   1e-33   
sp|Q5XUC7.1|RL5_TOXCI  RecName: Full=60S ribosomal protein L5           134   2e-33   
ref|XP_003662289.1|  hypothetical protein MYCTH_78218                   134   2e-33   
dbj|GAC94774.1|  60S ribosomal protein                                  134   2e-33   
ref|XP_002786530.1|  60S ribosomal protein L5, putative                 134   2e-33   
ref|XP_002784462.1|  60S ribosomal protein L5, putative                 134   2e-33   
ref|XP_001119361.1|  PREDICTED: 60S ribosomal protein L5-like           134   2e-33   
gb|ELR09388.1|  60S ribosomal protein L5                                133   2e-33   
dbj|BAM17686.1|  ribosomal protein L5                                   133   2e-33   
gb|KIO13004.1|  hypothetical protein M404DRAFT_706860                   134   2e-33   
ref|XP_007268728.1|  60S ribosomal protein L5                           134   2e-33   
ref|XP_007762113.1|  60S ribosomal protein L5                           133   2e-33   
gb|ABO26701.1|  ribosomal protein l5                                    132   2e-33   
gb|ACY95338.1|  ribosomal protein L5                                    133   2e-33   
ref|XP_007738723.1|  60S ribosomal protein L5                           133   3e-33   
ref|XP_001837210.1|  60S ribosomal protein L5                           133   3e-33   
gb|KIV84110.1|  60S ribosomal protein L5                                133   3e-33   
ref|XP_003649901.1|  60S ribosomal protein L5                           133   3e-33   
ref|XP_002146254.1|  60S ribosomal protein L5                           133   3e-33   
gb|KDR83692.1|  hypothetical protein GALMADRAFT_236026                  133   3e-33   
gb|EQL01602.1|  Ribosomal protein L5, eukaryotic/archaeal               133   3e-33   
emb|CAF96378.1|  unnamed protein product                                133   3e-33   
gb|KIX05556.1|  60S ribosomal protein L5                                133   3e-33   
emb|CBQ69062.1|  probable RPL5-60S large subunit ribosomal protei...    133   3e-33   
ref|XP_007568808.1|  PREDICTED: 60S ribosomal protein L5-like           133   3e-33   
ref|XP_005536050.1|  60S ribosomal protein L5                           133   3e-33   
gb|EHK45382.1|  hypothetical protein TRIATDRAFT_300024                  133   3e-33   
ref|XP_007915920.1|  putative 60s ribosomal protein l5 protein          133   4e-33   
ref|XP_003648419.1|  hypothetical protein Ecym_8324                     132   4e-33   
gb|ETP30123.1|  hypothetical protein F442_20806                         133   4e-33   
gb|ETK72498.1|  hypothetical protein L915_20400                         133   4e-33   
emb|CCF72893.1|  unnamed protein product                                133   4e-33   
emb|CEF66000.1|  60S ribosomal protein L5                               132   4e-33   
gb|ETL25956.1|  hypothetical protein L916_20260                         132   4e-33   
gb|AEE61390.1|  unknown                                                 132   4e-33   
gb|ETO60855.1|  hypothetical protein F444_21002                         132   4e-33   
ref|XP_008911988.1|  hypothetical protein PPTG_15526                    132   4e-33   
gb|KIH60424.1|  ribosomal L18p/L5e family protein                       131   4e-33   
gb|ETI32113.1|  hypothetical protein F443_20998                         132   4e-33   
gb|KIW40012.1|  60S ribosomal protein L5                                132   5e-33   
gb|KIW62448.1|  60S ribosomal protein L5                                132   5e-33   
gb|EST08870.1|  60S ribosomal protein                                   132   5e-33   
gb|EKC36296.1|  60S ribosomal protein L5                                135   5e-33   
ref|XP_003437833.1|  PREDICTED: 60S ribosomal protein L5-like           132   5e-33   
gb|EGI65189.1|  60S ribosomal protein L5                                138   6e-33   
gb|KDN36129.1|  putative RPL5-60S large subunit ribosomal protein...    132   7e-33   
gb|EPT03783.1|  hypothetical protein FOMPIDRAFT_1022326                 132   7e-33   
gb|EPQ65986.1|  Protein component of the large (60S) ribosomal su...    132   8e-33   
gb|KDQ29411.1|  hypothetical protein PLEOSDRAFT_1055401                 132   8e-33   
emb|CAD91421.1|  ribosomal protein L5                                   131   9e-33   
ref|XP_002497480.1|  60S ribosomal protein L5                           132   9e-33   
ref|XP_007235270.1|  PREDICTED: 60S ribosomal protein L5-like           132   9e-33   
ref|XP_007275120.1|  60s ribosomal protein l5                           132   1e-32   
ref|XP_007800448.1|  60S ribosomal protein L5                           131   1e-32   
ref|XP_002736904.1|  PREDICTED: 60S ribosomal protein L5-like           131   1e-32   
gb|KIW22485.1|  60S ribosomal protein L5                                131   1e-32   
ref|XP_009223169.1|  60S ribosomal protein L5                           131   1e-32   
ref|XP_002375890.1|  60S ribosomal protein L5                           131   1e-32   
ref|XP_004828633.1|  60S ribosomal protein L5e, putative                131   1e-32   
gb|AGO11355.1|  AaceriACR104Cp                                          131   1e-32   
ref|XP_006786853.1|  PREDICTED: 60S ribosomal protein L5-like           131   1e-32   
ref|XP_003727972.1|  PREDICTED: 60S ribosomal protein L5-like           131   1e-32   
ref|XP_001727600.2|  60S ribosomal protein L5                           132   1e-32   
ref|XP_008277284.1|  PREDICTED: 60S ribosomal protein L5-like           131   1e-32   
gb|KIL96266.1|  60s ribosomal protein l5                                131   1e-32   
ref|XP_666127.1|  ribosomal protein L5A                                 131   1e-32   
gb|KIY49257.1|  hypothetical protein FISHEDRAFT_72600                   131   2e-32   
gb|ABS18358.1|  ribosomal protein L5                                    127   2e-32   
gb|KDN68874.1|  putative ribosomal L18p/L5e family protein              131   2e-32   
ref|XP_011107683.1|  hypothetical protein H072_1692                     131   2e-32   
gb|EQB57780.1|  hypothetical protein CGLO_02053                         131   2e-32   
ref|XP_625505.1|  60S ribosomal protein L5                              131   2e-32   
gb|EFQ28351.1|  ribosomal L18p/L5e family protein                       130   2e-32   
gb|AFM89421.1|  ribosomal protein L5                                    131   2e-32   
gb|EYC37225.1|  hypothetical protein Y032_0814g2491                     131   2e-32   
gb|ERL91204.1|  hypothetical protein D910_08542                         130   2e-32   



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K +MD+EYEGNVEATGED+SVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLD
Sbjct  112  KLDMDKEYEGNVEATGEDFSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KD+K LDAEVHRKYIYGGHV+AYMN+L EDEPEKYQ+HFS YIKK IE
Sbjct  172  IPHSDKRFAGFSKDNKQLDAEVHRKYIYGGHVSAYMNTLMEDEPEKYQSHFSEYIKKSIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             DNIEA+YKKVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKLIERLNALNAAA
Sbjct  232  PDNIEAMYKKVHAAIRADPTEKKSEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNAAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADNIEA+YKKVHAAIRADP+ KK EKQPPKEHKR+N KKLTY+ER+ KLIERLNA N+AA
Sbjct  232  ADNIEAVYKKVHAAIRADPTAKKIEKQPPKEHKRYNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+S+EP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIYGGHV+AYM+SL EDEPEKYQ+HFS YIKKGIE D
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            + EALYKKVHAAIRADP+ KKS+K  PKEHKRFN KKLTY+ER+ KLIERLNALN+AAG
Sbjct  234  DFEALYKKVHAAIRADPTLKKSDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  292



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAG+ KD+K LD EVHRKYIYGGHVA+YMN+L EDEP+KYQ+HFS Y+KKG+EAD
Sbjct  174  HSDKRFAGYNKDNKQLDPEVHRKYIYGGHVASYMNTLMEDEPDKYQSHFSKYVKKGVEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            NIE +YKKVHAAIRADP+PKKS+KQ PK+HKR+N KKLTY+ER+AKLIERLNALNAAAGN
Sbjct  234  NIEEMYKKVHAAIRADPTPKKSDKQQPKQHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMDQEYEGNVEATGED+SVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KD K LDAE HRKYIYGGHV+ YM +L EDEPEKYQTHFS Y+K+GI+
Sbjct  172  IPHSDKRFAGFSKDGKQLDAEAHRKYIYGGHVSGYMKTLMEDEPEKYQTHFSEYVKRGID  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +EALYKKVHAAIRADP+ K+SEK+ PK HKR+N KKLTYDER+A LIERLNALNAAA
Sbjct  232  ADGLEALYKKVHAAIRADPTAKQSEKEAPKTHKRYNLKKLTYDERKASLIERLNALNAAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD++YEGNVEATGEDYSVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEDYEGNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAE HRKYIYGGHVA YM +L EDEPEKYQTHFS Y+K+GIEAD
Sbjct  174  HSDKRFAGFSKDGKQLDAETHRKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             +EALYKKVHAAIRADPS KKSEK  P++HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  234  GLEALYKKVHAAIRADPSVKKSEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYQGNTEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+E
Sbjct  172  IPHSEKRFAGFSKDSKQLDADVHRKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E +YKKVHAAIRADPSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADDLEEMYKKVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD++YEGNVEATGEDYSVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  116  EMDEDYEGNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  175

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAE HRKYIYGGHVA YM +L EDEPEKYQTHFS Y+K+GIEAD
Sbjct  176  HSDKRFAGFSKDGKQLDAETHRKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEAD  235

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             +EALYKKVHAAIRADPS KKSEK  P++HKR+N KKLTYDER+A LIERLNALNAAAG
Sbjct  236  GLEALYKKVHAAIRADPSVKKSEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  294



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   270 bits (689),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN++  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYQGNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAG++KDSK LDAEVHRKYIYGGHVAAYMN+L EDEPEKYQTHFS YIK G+E
Sbjct  172  IPHSEKRFAGYSKDSKQLDAEVHRKYIYGGHVAAYMNTLMEDEPEKYQTHFSLYIKAGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADN+E +YKKVHAAIRADPSPKKS KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA 
Sbjct  232  ADNLEEMYKKVHAAIRADPSPKKSGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAG  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYQGNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+E
Sbjct  172  IPHSEKRFAGFSKDSKQLDADVHRKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E +YKKVHAAIRADPSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADDLEEMYKKVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+S+EP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  178  EMDSEYEGNVEATGEDFSIEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  237

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIYGGHV+AYM+SL EDEPEKYQ+HFS YIKKGIE D
Sbjct  238  HSEKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPD  297

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            + EALYKKVHAAIRADP+ KKS+K  PKEHKRFN KKLTY+ER+ KLIERLNALN+AAG
Sbjct  298  DFEALYKKVHAAIRADPTLKKSDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  356



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EM  EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMADEYEGNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            +PHSEKRFAGF+KD+K LD++VHRKYIYGGHVAAYM  L+EDEPEK+QTHFSGYIKKG+E
Sbjct  172  VPHSEKRFAGFSKDNKQLDSDVHRKYIYGGHVAAYMGILSEDEPEKFQTHFSGYIKKGVE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            A+ IE +YKKVHAAIRADP+ K +EK+  KEHKRFN KKLTYDER+ KLIERLNA N+AA
Sbjct  232  AEGIEEMYKKVHAAIRADPTVKLTEKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAA  291

Query  217  GN  212
            G+
Sbjct  292  GD  293



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDAEVHRKYIYGGHVAAYMN+L EDEPEKYQTHFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  230
            ADNIE LYKKVHAAIRADP+ KK+EKQPPKEHKR+N KKLT+DER+ KL+ERL A 
Sbjct  232  ADNIEELYKKVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  113  KLEMDDEYEGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  172

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LDAEVHRKY+YGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  173  IPHSDKRFAGFSKDSKQLDAEVHRKYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIE  232

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++EALYKKVHAAIRADP+ KKSEK+PPKEHKRFN KKLTY+ER+AKLIERL+ LN+AA
Sbjct  233  ADDLEALYKKVHAAIRADPTAKKSEKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAA  292

Query  217  G  215
            G
Sbjct  293  G  293



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN+E  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNLEVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQTHFS YIKKG E
Sbjct  172  IPHSEKRFAGFSKDSKQLDADVHRKYIYGGHVATYMQTLIEDEPEKYQTHFSQYIKKGFE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E +YKKVHAAIRADPSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADGLEEMYKKVHAAIRADPSPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN+E  GEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNLEVNGEDYSVEPAENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDAEVHRKYIYGGHVA YM +L EDEPEKYQTHFS YIKKG+E
Sbjct  172  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVATYMKTLIEDEPEKYQTHFSEYIKKGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E +YKKVHAAIRADP PKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADGLEEMYKKVHAAIRADPCPKKSEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LDAEVHRKY+YGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFSKDSKQLDAEVHRKYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++EALYKKVHAAIRADP+ KKSEK+PPKEHKRFN KKLTY+ER+AKLIERL+ LN+AA
Sbjct  232  ADDLEALYKKVHAAIRADPTAKKSEKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +MD+EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  144  QMDEEYEGNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  203

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            H EKRFAGF K+SK LD EVHRKYIYGGHVAAYM +L EDEPE+YQ+HFS YIK+G+EAD
Sbjct  204  HGEKRFAGFDKESKQLDPEVHRKYIYGGHVAAYMRTLIEDEPERYQSHFSEYIKRGLEAD  263

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            NIE LYKKVHAAIRAD S KKSEK+PPKEHKR+N KKLTY+ERRAKLIERLNALN+AAGN
Sbjct  264  NIEELYKKVHAAIRADSSAKKSEKEPPKEHKRYNLKKLTYEERRAKLIERLNALNSAAGN  323



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIP
Sbjct  114  EMDEEYQGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD+K LDAEVH KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            NIE+LYKKVHAAIRADP+ KK+EK+PPK+HKRFN KKLTY+ER+AKLIERL+ LNAAAG+
Sbjct  234  NIESLYKKVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKAKLIERLHTLNAAAGD  293



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDAEVHRKYIYGGHVAAYMN+L EDEPEKYQTHFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  230
            ADNIE LYKKVHAAIRADP+PKK+EKQPP EHKR+N KKLT+DER+ KL+ERL A 
Sbjct  232  ADNIEELYKKVHAAIRADPTPKKTEKQPPTEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN+EATGED+SVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYEGNLEATGEDFSVEPGESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            +PHSEKRFAGF+KDSK+LDAE HRKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIE
Sbjct  172  VPHSEKRFAGFSKDSKSLDAETHRKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            A+ IE LYKKVHAAIRADP  KK+ K  PK+HKRFN KKLTY+ER+ KLIERLNA N+AA
Sbjct  232  AEGIEELYKKVHAAIRADPLEKKTAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVH KYIYGGHVAAYM +L EDEPEKYQTHFS Y+KKGIEAD
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHHKYIYGGHVAAYMRTLMEDEPEKYQTHFSEYLKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            NIE +YKKVHAAIRADP+ KKS K  P EHKR+N KKLTY+ER+ KLIERLNA N+AA
Sbjct  234  NIEEVYKKVHAAIRADPTMKKSSKPQPSEHKRWNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN++  GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYEGNLDVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF KDSK LDA+VHRKYIYGGHV+AYM +L EDEPEKYQ+HFS YIK G+E
Sbjct  172  IPHSEKRFAGFGKDSKQLDADVHRKYIYGGHVSAYMKTLMEDEPEKYQSHFSEYIKTGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E +YKKVHAAIRADPS KKS+KQPPK+HKR+N KKLTYDER+A+LIERLNALNAAA
Sbjct  232  ADDLEEMYKKVHAAIRADPSSKKSDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN+EA GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYEGNLEANGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDA+VHR YIYGGHVA YM +L EDEPEKYQ+HFS YIKKG+E
Sbjct  172  IPHSEKRFAGFSKDSKQLDADVHRNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E +YKKVHAAIRADP+ KKS+KQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADGLEEMYKKVHAAIRADPTFKKSDKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN++  GEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYQGNLDVNGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAG++KDSK LDAEVHRK+IYGGHV AYMN+L EDEPEKYQTHFS YIK G+E
Sbjct  172  IPHSEKRFAGYSKDSKQLDAEVHRKFIYGGHVTAYMNTLMEDEPEKYQTHFSLYIKAGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADN+E +YKKVHAAIRADP PKKS KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA 
Sbjct  232  ADNLEEMYKKVHAAIRADPCPKKSGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAG  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMDQEYEGNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LD +VHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+E
Sbjct  172  IPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E LYKKVHAAIRADP  KKSEK+PPKEHKRFN +KLTY+ER+AKL+ERLNALN+A 
Sbjct  232  ADDLEGLYKKVHAAIRADPILKKSEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAG  291

Query  217  G  215
            G
Sbjct  292  G  292



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   266 bits (681),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EM  EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMADEYEGNVEATGEDYSVEPSESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            +PHSEKRFAGF+KD+K LD++VHRKYIYGGHVAAYM  L+EDEPEK+QTHFS YIKKG+E
Sbjct  172  VPHSEKRFAGFSKDNKQLDSDVHRKYIYGGHVAAYMGILSEDEPEKFQTHFSAYIKKGVE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            A+ IE +YKKVHAAIRADP+ K +EK+  KEHKRFN KKLTYDER+ KLIERLNA N+AA
Sbjct  232  AEGIEEMYKKVHAAIRADPTVKLTEKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAA  291

Query  217  GN  212
            G+
Sbjct  292  GD  293



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN EA+GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYQGNPEASGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPH EKRFAGF+KDSK LDA+VHRKYIYGGHVA YM +L EDEPEKYQ+HFS YIK+G+E
Sbjct  172  IPHGEKRFAGFSKDSKQLDADVHRKYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKRGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADN+E +YKKVHAAIRA+PSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADNLEEMYKKVHAAIRAEPSPKKSEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDAEVHRKYIYGGHVAAYM +L +DEPEKYQ+HFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMTTLADDEPEKYQSHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            ADNIE LYKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N A
Sbjct  232  ADNIEELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEA  290



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMDQEYEGNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  193  KLEMDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLD  252

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LD +VHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+E
Sbjct  253  IPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLE  312

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E LYKKVHAAIRADP  KKSEK+PPKEHKRFN +KLTY+ER+AKL+ERLNALN+A 
Sbjct  313  ADDLEGLYKKVHAAIRADPILKKSEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAG  372

Query  217  G  215
            G
Sbjct  373  G  373



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDAEVHRKYIYGGHVAAYM +L +DEPEK+Q+HFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMTTLADDEPEKFQSHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            ADNIE LYKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N A
Sbjct  232  ADNIEELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEA  290



>gb|KJB84075.1| hypothetical protein B456_N001600 [Gossypium raimondii]
 gb|KJB84076.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=186

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            MD EYEGNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIPH
Sbjct  1    MDAEYEGNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPH  60

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEADN
Sbjct  61   SEKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADN  120

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  121  LEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  178



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN+E  GEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYQGNLEVNGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LDA+VHR YIYGGHVA YM +L EDEPEKYQ+HFS YIKKG+E
Sbjct  172  IPHSEKRFAGFSKDSKQLDADVHRNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E +YKKVHAAIRADP+ KKS+K PPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADHLEEMYKKVHAAIRADPTFKKSDKHPPKQHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYQGNVEATGEDFSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KD K LD+EVHRKYIYGGHVAAYMN+L EDEPEKYQ+HFS YIK G+EAD
Sbjct  174  HSEKRFAGFSKDGKQLDSEVHRKYIYGGHVAAYMNTLMEDEPEKYQSHFSKYIKSGVEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            +IEALYKKVHAAIRADPSPKKSEKQPPKEHKR+N KKLTY+ER+AKLIERL ALN+
Sbjct  234  DIEALYKKVHAAIRADPSPKKSEKQPPKEHKRYNLKKLTYEERKAKLIERLQALNS  289



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEPG+SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  166  KLEMDEEYEGNVEATGEDYSVEPGDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  225

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF K++K LD EVHRKYI+GGHVAAYM +L EDEPE+YQ+HFS Y K+G+E
Sbjct  226  IPHSEKRFAGFDKETKQLDPEVHRKYIFGGHVAAYMRTLAEDEPERYQSHFSEYHKRGLE  285

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADN+E LYKKVHAAIRADP+PKKSEK PPKEHKR+N KKLTY+ER+A LIERLNALN+AA
Sbjct  286  ADNLEELYKKVHAAIRADPTPKKSEKAPPKEHKRYNLKKLTYEERKASLIERLNALNSAA  345

Query  217  GN  212
            GN
Sbjct  346  GN  347



>gb|KJB84074.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=252

 Score =   263 bits (671),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIP
Sbjct  66   EMDAEYEGNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIP  125

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  126  HSEKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEAD  185

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  186  NLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  244



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   264 bits (675),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD
Sbjct  174  HSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A 
Sbjct  234  GLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  291



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD
Sbjct  174  HSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A 
Sbjct  234  GLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  291



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EY+GN EA+GEDYSVE  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYQGNPEASGEDYSVELAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPH EKRFAGF+KDSK LDAEVHRKYIYGGHVA YM +L EDEPEKY +HFSGYIK+G+E
Sbjct  172  IPHGEKRFAGFSKDSKQLDAEVHRKYIYGGHVATYMKTLIEDEPEKYLSHFSGYIKRGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADN+E +YKKVHAAIRA+PSPKKSEKQPPK+HKR+N KKLTY+ER+AKLIERLNALN+AA
Sbjct  232  ADNLEEMYKKVHAAIRAEPSPKKSEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD
Sbjct  174  HSDKRFAGFAKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKL+ERLNALN+AA
Sbjct  234  GMEALYKKVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN++  GEDYSVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGG+D
Sbjct  112  KLEMDEEYEGNLDVNGEDYSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGID  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF KDSK LDA+VHRKYIYGGHV+AYM +L EDEPEKYQ+HF+ YIK G+E
Sbjct  172  IPHSEKRFAGFGKDSKQLDADVHRKYIYGGHVSAYMKTLMEDEPEKYQSHFNEYIKTGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD++E +YKKVHAAIRADPS KK +KQPPK+HKR+N KKLTYDER+A+LIERLNALNAAA
Sbjct  232  ADDLEEMYKKVHAAIRADPSSKKFDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAA  291

Query  217  GN  212
            GN
Sbjct  292  GN  293



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EM+ EY+GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMEDEYQGNVEATGEDYSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LD EVHRKYIYGGHVA+YM +LNEDEPEKYQ+HFS YI KGI+AD
Sbjct  174  HSDKRFAGFKKEEKQLDPEVHRKYIYGGHVASYMRALNEDEPEKYQSHFSEYINKGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE LY+KVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ERR+KLIERLNALN+AAG
Sbjct  234  NIEELYRKVHAAIRADPTTKKSEKQPPKEHKRYNLKKLTYEERRSKLIERLNALNSAAG  292



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYQGNVEATGEDFSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHRKYI+GGHVA+YM +L EDEPEKYQ HFS YIKKGI+ D
Sbjct  174  HSDKRFAGFKKDEKQLDAEVHRKYIFGGHVASYMKTLMEDEPEKYQAHFSEYIKKGIDPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++E +YKKVHAAIRADP   KS K PPKEHKR+N KKLTY+ER+AKLIERLNALNA+AG
Sbjct  234  DMEEMYKKVHAAIRADPIAVKSTKPPPKEHKRYNLKKLTYEERKAKLIERLNALNASAG  292



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN EATGEDYSVEPGESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNTEATGEDYSVEPGESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF K+SK LD+EVHRKYIYGGHVAAYM  L EDEPEKYQ+HFS YIKKG++ D
Sbjct  174  HSEKRFAGFNKESKQLDSEVHRKYIYGGHVAAYMRMLLEDEPEKYQSHFSEYIKKGVDPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            N+E +YKKVHAAIRADPS KK+EKQPPKEHKR+N KKLTY+ER+AKLIERL ALN+AA +
Sbjct  234  NMEEMYKKVHAAIRADPSAKKTEKQPPKEHKRYNLKKLTYEERKAKLIERLTALNSAADD  293



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAG+ KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD
Sbjct  174  HSDKRFAGYAKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEKQP KEHKR+N KKLTY+ER+AKL+ERLNALN+AA
Sbjct  234  GMEALYKKVHAAIRADPTAKKSEKQPSKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKK IE
Sbjct  172  IPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKCIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADNIE LYKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N  A
Sbjct  232  ADNIEELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DA  290

Query  217  GN  212
            GN
Sbjct  291  GN  292



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   263 bits (671),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAG+TK+S+ LD EVHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD
Sbjct  174  HSDKRFAGYTKNSQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ++E LYKKVHAAIRA+P+ KKS+K  PK HKR+N KKLTYDER+A+L+ERLNALN+AA
Sbjct  234  DLEGLYKKVHAAIRANPTVKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+SK LD EVHRKYIYGGH+A YM  LNEDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFNKESKQLDPEVHRKYIYGGHIADYMRLLNEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+EALYKKVHAAIRADPS KKSEKQPPKEHKRFN KKLTY+ER+A+LIERL ALN+A G
Sbjct  234  NMEALYKKVHAAIRADPSVKKSEKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKK IE
Sbjct  172  IPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKXIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ADNIE LYKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N  A
Sbjct  232  ADNIEELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DA  290

Query  217  GN  212
            GN
Sbjct  291  GN  292



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            E+DQEYEGNVEATGEDYSVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  ELDQEYEGNVEATGEDYSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHRKYIYGGHVA YM SL ++EPEK+Q+HFS YIKKGI AD
Sbjct  174  HSDKRFAGFKKDEKQLDAEVHRKYIYGGHVADYMRSLADEEPEKFQSHFSEYIKKGISAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EALYKKVHAAIRADPS  KS K+PPK HKR+N KKLTYDER+A L++RLNALNA+AG
Sbjct  234  DMEALYKKVHAAIRADPSMAKSTKEPPKTHKRYNLKKLTYDERKASLVQRLNALNASAG  292



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   262 bits (669),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIP
Sbjct  111  EMDAEYEGNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIP  170

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  171  HSEKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEAD  230

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  231  NLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   262 bits (669),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEPGESRRPFR+LLDVGL+RTTTGNRVFG LKGALDGG+DIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPGESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSEKRFAGFNKDNKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  234  NLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   262 bits (669),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KD K LDAE+HRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDGKQLDAEIHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD+IE +YKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A N  A
Sbjct  232  ADDIEEVYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFN-DA  290

Query  217  GN  212
            GN
Sbjct  291  GN  292



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  201  EMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIP  260

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD
Sbjct  261  HSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDAD  320

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A 
Sbjct  321  GLEALYKKVHAAIRADPTTKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  378



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMRNLAEDEPEKYQSHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  230
            ADNIE LYKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL+ERL A 
Sbjct  232  ADNIEELYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVERLKAF  287



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEAD
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            N+E LYKKVHAAIRADP+ KKSEK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  234  NLEELYKKVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  111  DLDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  170

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIEAD
Sbjct  171  HSDKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEAD  230

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+EALYKKVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  231  NMEALYKKVHAAIRADPTMAKSTKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  289



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYQGNVEATGEDFSVEPTDNRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGFTKD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQTHFS Y+K+GIE D
Sbjct  174  HSDKRFAGFTKDNKQLDAEVHRKYIYGGHVAAYMKTLMEDEPEKYQTHFSEYVKRGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            N+EALYKKVHAAIRADP+ KK EKQPPKEHKR+N +KLTY+ER+AKLIERL ALN+
Sbjct  234  NLEALYKKVHAAIRADPTLKKIEKQPPKEHKRYNLRKLTYEERKAKLIERLQALNS  289



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             DN+E LYKKVHAAIRADP+ KKSEKQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  232  PDNMEELYKKVHAAIRADPTAKKSEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             DN+E LYKKVHAAIRADP+ KKSEKQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  232  PDNMEELYKKVHAAIRADPTAKKSEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EM+ EYEGNVEATGEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMEDEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFKKEDKQLDPEVHRKYIYGGHVASYMRALMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE LYKKVHAAIRADP+ KKSEK+PPKEHKR+N KKLTY+ER++KLIERLNALN+AAG
Sbjct  234  NIEELYKKVHAAIRADPTIKKSEKEPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  117  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  176

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  177  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  236

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYKKVHAAIRADP+ KKS+KQ PKEHKR+N KKLTY+ER+AKLI R+ +LN+AA N
Sbjct  237  GIEALYKKVHAAIRADPTLKKSDKQLPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  296



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYKKVHAAIRADP+ KKS+KQPPKEHKR+N KKLTY+ER+AKLI R+ +LN+AA N
Sbjct  234  GIEALYKKVHAAIRADPTLKKSDKQPPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  293



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIP
Sbjct  114  EMDDEYQGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHR YIYGGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFSKDGKQLDAEVHRNYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE+LYKKVHAAIRADPS KKSEK PPK+H RFN KKLTY+ER+AKLI+RL+ LNAAAG
Sbjct  234  NIESLYKKVHAAIRADPSAKKSEKAPPKQHMRFNLKKLTYEERKAKLIDRLHTLNAAAG  292



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYK VHAAIRADP+ KKS+KQ PKEHKR+N KKLTY+ER+AKLI R+ ALN+AA N
Sbjct  234  GIEALYKNVHAAIRADPTLKKSDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  293



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  155  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  214

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  215  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  274

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYKKVHAAIRADPS KKSEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  275  GIEALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  334



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHRKYI+GGHVA+YM  L EDEPEKYQTHFS YIK+GIE D
Sbjct  174  HSDKRFAGFSKDDKQLDAEVHRKYIFGGHVASYMRMLMEDEPEKYQTHFSEYIKRGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ++E LYKKVHAAIRADP+  KS K+PPKEHKR+N +KLTY+ER+AKLI+RLNALNA A
Sbjct  234  DMEGLYKKVHAAIRADPTMVKSAKEPPKEHKRYNLRKLTYEERKAKLIDRLNALNARA  291



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   259 bits (662),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYKKVHAAIRADP+ +KS+KQPPKEHKR+N KKLTY+ER+AKL+ R+ A+N+AA N
Sbjct  234  GIEALYKKVHAAIRADPTLRKSDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAADN  293



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KD K LDAE+HRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDGKQLDAEIHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            AD+IE +YKKVHAAIRADP+ KK+EK  P+EHKR+N KKLT+DER+ KL++RL A N
Sbjct  232  ADDIEEVYKKVHAAIRADPTIKKTEKPAPQEHKRYNLKKLTFDERKKKLVDRLKAFN  288



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   259 bits (662),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDGEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KDSK LDAEVHRKYIYGGHV+AYM +L EDEPEKYQ+HFS YIKKG+E D
Sbjct  174  HSDKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            +IE +YKKVHAAIRA+P  KK EKQPPKEHKR+N KKLTY+ER+AKLIERLNALN+
Sbjct  234  DIEEMYKKVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  289



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   259 bits (662),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHRKYI+GGHVA+YM  L EDEPEKYQTHFS YI++GIE D
Sbjct  174  HSDKRFAGFNKDGKQLDAEVHRKYIFGGHVASYMRILMEDEPEKYQTHFSEYIQRGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            ++E LYKKVHAAIRAD +  KS ++PPKEHKR+N KKLTY+ER+A+LIERLNALNA+
Sbjct  234  DLEELYKKVHAAIRADATMAKSTREPPKEHKRYNLKKLTYEERKARLIERLNALNAS  290



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   259 bits (661),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+GI+AD
Sbjct  174  HSEKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+ KL+ERLN  N+AA
Sbjct  234  CMEALYKKVHAAIRADPTTKKSEKQPPKEHKRYNLKKLTYEERKEKLVERLNTFNSAA  291



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEG+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEAD
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            N+E LYKKVHAAIRADP+ KKSEK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  234  NLEELYKKVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  119  EMDGEYEGNVEATGEDFSVEPTENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIP  178

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIYGGHVAAYM +L EDEPEK+  HFS Y+K+GI+AD
Sbjct  179  HSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRTLAEDEPEKFLAHFSEYLKRGIDAD  238

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            N+E LYKKVHAAIRADP+ +KSEKQPPKEHKR+N KKLTY+ER+AKLIERLNA N+AA
Sbjct  239  NLEELYKKVHAAIRADPTGRKSEKQPPKEHKRYNLKKLTYEERKAKLIERLNAFNSAA  296



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEG+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEAD
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            N+E LYKKVHAAIRADP+ KKSEK+PP EHKR+N KKLTY+ER+A+L+ERL ALNAA
Sbjct  234  NLEELYKKVHAAIRADPNQKKSEKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  146  EMDGEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  205

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KDSK LDAEVHRKYIYGGHV+AYM +L EDEPEKYQ+HFS YIKKG+E D
Sbjct  206  HSDKRFAGFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPD  265

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            +IE +YKKVHAAIRA+P  KK EKQPPKEHKR+N KKLTY+ER+AKLIERLNALN+
Sbjct  266  DIEEMYKKVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  321



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPVESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYKKVHAAIRADPS KKSEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  234  GIEALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  293



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIP
Sbjct  116  EMDAEYEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIP  175

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D
Sbjct  176  HSDKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPD  235

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E LYKKVHAAIRAD   KKSE++PP EHKR+N KKL+YDER+A+LI+RL  LN+AAG
Sbjct  236  NMEGLYKKVHAAIRADSEAKKSEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  294



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIP
Sbjct  116  EMDEEYQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIP  175

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHR YI GGHVA+YM ++ EDEPEKYQ HFS YIK+GIE D
Sbjct  176  HSDKRFAGFKKDEKQLDAEVHRNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPD  235

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            ++E +YKKVHAAIRADP   KS K+PPKEHKRFN KKLTY+ER+A+LIERLNALNA+AG 
Sbjct  236  SMEEMYKKVHAAIRADPIAIKSTKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  295



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVF ALKGA DGGLDIP
Sbjct  114  EMDEEYQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHR YI GGHVA+YM ++ EDEPEKYQ HFS YIK+GIE D
Sbjct  174  HSDKRFAGFKKDEKQLDAEVHRNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            ++E +YKKVHAAIRADP   KS K+PPKEHKRFN KKLTY+ER+A+LIERLNALNA+AG 
Sbjct  234  SMEEMYKKVHAAIRADPIAIKSTKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  293



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF  D K LDAEVHR YI+GGHVA+YM +L EDEP+KYQTHFS YIKKGIE D
Sbjct  174  HSDKRFAGFKNDEKQLDAEVHRNYIFGGHVASYMRALMEDEPDKYQTHFSEYIKKGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE +YKKVHAAIRADPS  KS K+PP EHKR+N KKLTY+ER+AKLIERLNALNA+ G
Sbjct  234  DIEEMYKKVHAAIRADPSAIKSTKEPPTEHKRYNLKKLTYEERKAKLIERLNALNASGG  292



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  132  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  191

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  192  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  251

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYK VHAAIRADP+ KKS+KQ PKEHKR+N KKLTY+ER+AKLI R+ ALN+AA N
Sbjct  252  GIEALYKNVHAAIRADPTLKKSDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  311



>gb|EMS47485.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=269

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  82   DLDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  141

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIE D
Sbjct  142  HSDKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEID  201

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EALYKKVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  202  DMEALYKKVHAAIRADPTVAKSTKEPPKTHKRYNPKKLTYEQRKANLVERLNALNSSAG  260



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFNKDGKQLDAEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             DN+E LYKKVHAAIR DP+ KKS KQ PKEHKR+N KKLTY+ER+AKL+ERL ALN+
Sbjct  232  PDNMEELYKKVHAAIREDPTAKKSGKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             IEALYKKVHAAIRADP+ +KS+KQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA
Sbjct  234  GIEALYKKVHAAIRADPTLRKSDKQPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             IEALYKKVHAAIRADP+ +KS+K+PPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA
Sbjct  234  GIEALYKKVHAAIRADPTLRKSDKEPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +E LYKKVHAAIRADP+ KKSEKQPPK+HKR+N KKLTY+ER+AKL+ RL ALNAA 
Sbjct  234  GLEELYKKVHAAIRADPTIKKSEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAG+ K+ + LD EVHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIKKGIEAD
Sbjct  174  HSDKRFAGYAKNGQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +E LYKKVHAAIRA+P  KKS+K  PK HKR+N KKLTYDER+A+L+ERLNALN+AA
Sbjct  234  ELEGLYKKVHAAIRANPIAKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGGLDIP
Sbjct  170  EMDAEYEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIP  229

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D
Sbjct  230  HSDKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPD  289

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E LYKKVHAAIRAD   KKSE++PP EHKR+N KKL+YDER+A+LI+RL  LN+AAG
Sbjct  290  NMEGLYKKVHAAIRADSEAKKSEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  348



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEA+GEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  94   EMDEEYEGNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  153

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHV AYM +L EDEPEKYQTHFS YIKKGIEAD
Sbjct  154  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQTHFSQYIKKGIEAD  213

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             IE LYKKVHAAIRADP+ KK+EKQPPKEHKR+N KKLTYDERR KLI RL ALN+A 
Sbjct  214  GIEELYKKVHAAIRADPANKKAEKQPPKEHKRYNLKKLTYDERRTKLIARLEALNSAV  271



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   257 bits (657),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  DLDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIE D
Sbjct  174  HSDKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEID  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EALYKKVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  234  DMEALYKKVHAAIRADPTVAKSTKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF K++K LD E HR YI+GGHVA YM  L EDEPEKYQTHFSGY+KKGIEAD
Sbjct  174  HSEKRFAGFNKENKQLDPETHRNYIFGGHVANYMKVLTEDEPEKYQTHFSGYVKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+EA+YKKVHAAIRADP+ KKSEK  P EHKR+N KKLTY+ER+ +LIERL ALN+ AG
Sbjct  234  NLEAMYKKVHAAIRADPTLKKSEKSAPTEHKRYNLKKLTYEERKERLIERLKALNSGAG  292



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN EATGEDYSVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LDAEVHRKYIYGGHVAAYM  L EDEPEKYQ HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRMLMEDEPEKYQLHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             D++E LYKKVHAAIRADP+ KKSEKQPPKEHKR+N +K+TY+ER+AKLIERL ALN+
Sbjct  232  PDDMEELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEA+GEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHV AYM +L EDEPEKYQTHFS YIK+G+EAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQTHFSEYIKRGVEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE LYKKVHAAIRADP+ KKS KQPPKEHKR+N KKLTY+ER+AKLI RL ALN+AAG
Sbjct  234  GIEELYKKVHAAIRADPTIKKSGKQPPKEHKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   257 bits (656),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEA+GED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNVEASGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+SK LDAEVHRKYIYG HVA YM  + EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFNKESKQLDAEVHRKYIYGVHVADYMRVMMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+EALYKKVHAAIRADP+ KKSEKQPPKEHKRFN KKLTY+ER+A+LIERL ALN+A G
Sbjct  234  NMEALYKKVHAAIRADPTIKKSEKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   257 bits (656),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATG+D+SVE  ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGDDFSVESAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHRKYI+GGHVA+YM  L EDEPEKYQTHF  YIK+GIE D
Sbjct  174  HSDKRFAGFKKDEKQLDAEVHRKYIFGGHVASYMRMLMEDEPEKYQTHFIEYIKRGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ++E LYKKVHAAIRADP+  KS K+PPKEHKRFN KKLTYDER+A+LIERLNALN++A
Sbjct  234  DMEELYKKVHAAIRADPTLVKSSKEPPKEHKRFNLKKLTYDERKARLIERLNALNSSA  291



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNV ATGEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHVAAYM +L EDEPEKYQTHFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE LYKKVHAAIRADPS KK EKQPPKEHKR+N KKLTY+ER+ KL+ RL ALN+AAG
Sbjct  234  GIEELYKKVHAAIRADPSIKKPEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  292



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+GIE
Sbjct  172  IPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E LYKKVHAAIRADP+ KKSEK+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  232  ADCLEDLYKKVHAAIRADPTFKKSEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>gb|AFW84308.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=229

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  43   LDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  102

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA+ HR+YIYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EAD 
Sbjct  103  SEKRFAGFKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADE  162

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            IEALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  163  IEALYKKVHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD
Sbjct  174  HSEKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             +EALYKKVHAAIRADP+ KKSEK+P KEHKR+N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  234  CMEALYKKVHAAIRADPTTKKSEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGL++TT GNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +E LYKKVHAAIRADP+ KKSEKQPPK+HKR+N KKLTY+ER+AKL+ RL ALNAA 
Sbjct  234  GLEELYKKVHAAIRADPTIKKSEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  109  EMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  168

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD
Sbjct  169  HSEKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDAD  228

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEK+P KEHKR+N KKLTY+ER+ KL+ERLN  N+AA
Sbjct  229  CMEALYKKVHAAIRADPTTKKSEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAA  286



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+GIE
Sbjct  172  IPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E LYKKVHAAIRADP+ KK EK+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  232  ADGLEDLYKKVHAAIRADPTFKKFEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>tpg|DAA56364.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=229

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  43   LDKEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  102

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD+
Sbjct  103  SEKRFAGFKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADD  162

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  163  MEALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNV ATGEDYSVEP +SRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  145  EMDDEYEGNVVATGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  204

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHVAAYM +L EDEPEKYQTHFS YIK+GIEAD
Sbjct  205  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEAD  264

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE LYKKVHAAIRADPS KK EKQPPKEHKR+N KKLTY+ER+ KL+ RL ALN+AAG
Sbjct  265  GIEELYKKVHAAIRADPSIKKPEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  323



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGN EATGEDYSVEP E+RRPFRALLDVGL+RTTTGN VFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNEEATGEDYSVEPAETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQLHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             D++E LYKKVHAAIRADP+ KKSEKQPPKEHKR+N +K+TY+ER+AKLIERL ALN+
Sbjct  232  PDDMEELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  DLDQEYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAE+HRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGIEAD
Sbjct  174  HSDKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             +EALYKKVHAAIRADP+  KS K+PPK HK++N KKLTY++R+A L+ERLNALN++ G
Sbjct  234  GMEALYKKVHAAIRADPTIAKSTKEPPKTHKKYNPKKLTYEQRKASLVERLNALNSSGG  292



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEA+GED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  DLDQEYEGNVEASGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVHRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEA 
Sbjct  174  HSDKRFAGFKKDEKQLDAEVHRKYIYGGHVADYMKTLAEEEPEKYQSHFSEYIKKGIEAG  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             +EALYKKVHAAIRADP+  KS K+PPK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  234  GMEALYKKVHAAIRADPTLAKSTKEPPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEA+GED+SVEP ++RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEASGEDFSVEPADTRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKYI+GGHV+AYM +L EDEPEKYQTHFS YIKKGIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +E LYKKVHAAIRADPS KKSEK P KEHKRFN KKLTY+ER+AKLI RL ALNAA 
Sbjct  234  GLEELYKKVHAAIRADPSIKKSEKPPRKEHKRFNLKKLTYEERKAKLIARLQALNAAV  291



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+G+E
Sbjct  172  IPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLMEDEPEKYQTHFSDYIKRGVE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E LYKKVHAAIRADP+ KKS K+ PKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  232  ADGLEDLYKKVHAAIRADPTFKKSSKEAPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDFSVEPADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KD+K LDAEVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS Y+K+ I+AD
Sbjct  174  HSEKRFAGFGKDNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             +EALYKKVHAAIRADP+ KKSEK+P KEHK++N KKLTY+ER+ KL+ERLN  N+AA +
Sbjct  234  CMEALYKKVHAAIRADPTTKKSEKEPLKEHKKYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LDA++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+GIE
Sbjct  172  IPHSDKRFAGFDKDKKELDADIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             DN+E +YKKVHAAIRADP+ KKSEK+PPKEHKR+N KKLTY+ER+AKL+ RL ALN+AA
Sbjct  232  PDNLEEVYKKVHAAIRADPTFKKSEKEPPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  115  DLDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD KNLDAE+HRKYIYGGHVA YM +L E+EPEKYQ HFS YIKKGIEAD
Sbjct  175  HSDKRFAGFKKDEKNLDAEIHRKYIYGGHVADYMRTLAEEEPEKYQAHFSEYIKKGIEAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EALYKKVHAAIR +P+  K  KQPPKEHKR+N KKLTY++R+A L+ERLNALN++ G
Sbjct  235  DMEALYKKVHAAIRGEPTMAKITKQPPKEHKRYNPKKLTYEQRKASLVERLNALNSSGG  293



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   254 bits (649),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF K+ K LDAEVHRKYI+GGHVA+YM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSEKRFAGFDKEKKELDAEVHRKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            AD +E LYKKVHAAIRADPS KKS K  PKEHKR+N KKLTYDER+ KLI RL ALN+
Sbjct  232  ADGLEELYKKVHAAIRADPSTKKSGKPEPKEHKRYNLKKLTYDERKNKLIARLQALNS  289



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   254 bits (649),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP   RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  DLDQEYEGNVEATGEDFSVEPSGERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LD+EVHRKYIYGGHVA YM SL ++EPEKYQ+HFS YIKKGI AD
Sbjct  174  HSDKRFAGFKKDEKQLDSEVHRKYIYGGHVADYMRSLADEEPEKYQSHFSEYIKKGISAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE++YKKVHAAIRADP+  KS K+ PK HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  234  DIESVYKKVHAAIRADPTLVKSTKEAPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   254 bits (649),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GN+EATG D+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIP
Sbjct  116  EMDEEYQGNIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIP  175

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LD EVHRKYI+GGHVA+YM ++ EDEPEKYQ HFS YIKKGIE D
Sbjct  176  HSDKRFAGFKKDEKQLDEEVHRKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPD  235

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKK HAAIRADP+  KS K+ PKEH+RFN KKLTY+ER+A+LIERLNALN +AG
Sbjct  236  NMEEIYKKAHAAIRADPTMIKSTKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  294



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   254 bits (649),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GN+EATG D+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLDIP
Sbjct  114  EMDEEYQGNIEATGLDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LD EVHRKYI+GGHVA+YM ++ EDEPEKYQ HFS YIKKGIE D
Sbjct  174  HSDKRFAGFKKDEKQLDEEVHRKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKK HAAIRADP+  KS K+ PKEH+RFN KKLTY+ER+A+LIERLNALN +AG
Sbjct  234  NMEEIYKKAHAAIRADPTMIKSTKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  292



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +MD EYEGNVEATGED+SVEP   RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  QMDGEYEGNVEATGEDFSVEPAGERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KDSK LDAE+HRKYIYGGHVAAYM  L EDEPEKYQ+HFS Y+K+GI+AD
Sbjct  174  HSDKRFAGFSKDSKQLDAELHRKYIYGGHVAAYMRILMEDEPEKYQSHFSEYVKRGIDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            N+E LYKKVH+AIRADP  KK+EKQPPKEHKR+N KKLTY+ER+ KLIERL ALN+AA
Sbjct  234  NMEELYKKVHSAIRADPITKKTEKQPPKEHKRYNLKKLTYEERKNKLIERLKALNSAA  291



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA+ HR+YIYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EAD 
Sbjct  176  SEKRFAGFKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADE  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            IEALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  236  IEALYKKVHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP E+R PFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +E LYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTYDER+ KLI RL ALN+AA
Sbjct  234  GLEELYKKVHAAIRADPTSKKSEKPQPKEHKRYNLKKLTYDERKNKLIARLQALNSAA  291



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD KNLDA++HRKYI+GGHVA YM S+ E+EPEKYQ HFS Y+K+GI+AD 
Sbjct  176  SDKRFAGFKKDEKNLDADIHRKYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADG  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADP+  KS K+PP  HKR+N KKLTY++R+A+L+ERLNALN++AG
Sbjct  236  MEALYKKVHAAIRADPTMAKSTKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  293



>ref|XP_004171975.1| PREDICTED: 60S ribosomal protein L5-like, partial [Cucumis sativus]
Length=246

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  57   KLEMDDEYEGNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  116

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            +PHS KRFAGF+K +  L+A+VHRKYI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE
Sbjct  117  VPHSVKRFAGFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIE  176

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             DNIE L KKVH+AIRA+P  K +EKQPPK HKR+N KKLTY++R+AKL+ERLNALN+AA
Sbjct  177  PDNIEELLKKVHSAIRAEPLVKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAA  236

Query  217  G  215
            G
Sbjct  237  G  237



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  119  LDQEYEGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  178

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD KNLDA++HRKYI+GGHVA YM S+ E+EPEKYQ HFS Y+K+GI+AD 
Sbjct  179  SDKRFAGFKKDEKNLDADIHRKYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADG  238

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADP+  KS K+PP  HKR+N KKLTY++R+A+L+ERLNALN++AG
Sbjct  239  MEALYKKVHAAIRADPTMAKSTKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  296



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  131  EMDDEYQGNLEATGEDYSVEPADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIP  190

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KDSK LDAEVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS Y+KKG+EAD
Sbjct  191  HSDKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMTNLMEDEPEKYQSHFSKYVKKGLEAD  250

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            N+E LYKKVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  251  NLEELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLIER  300



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  115  DLDQEYEGNVEATGEDFSVEPAEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDA++HRKYIYG HVA YM +L ++EPEKYQ HFS YIKKGIEAD
Sbjct  175  HSDKRFAGFKKDDKQLDADIHRKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EALYKKVHAAIRADPS  KS K  PKEHKR+N KKLTY++R+A+L+ERLNALN++ G
Sbjct  235  DMEALYKKVHAAIRADPSMAKSTKAQPKEHKRYNPKKLTYEQRKARLVERLNALNSSGG  293



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDKEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD+
Sbjct  176  SEKRFAGFKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADD  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  236  MEALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDKEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEAD+
Sbjct  176  SEKRFAGFKKDDKQLDADIHRKYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADD  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  236  MEALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIP
Sbjct  114  EMDAEYEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D
Sbjct  174  HSDKRFAGFNKDGKQLDPEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVHAAIRA P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  234  TIEGMYKKVHAAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+SK LDAE+HR YIYGGHV+ YM  L EDEPEK+QTHFS Y+KKG++A+
Sbjct  174  HSDKRFAGFNKESKQLDAEIHRNYIYGGHVSNYMKLLTEDEPEKFQTHFSQYVKKGVDAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE LYKKVHAAIRADP+PKK+ K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  NIEELYKKVHAAIRADPNPKKTVKAAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  115  DLDEEYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K+LDAE+HRKYI+GGHVA YM SL ++EPEKYQTHFS YIK+GI AD
Sbjct  175  HSDKRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKYQTHFSEYIKRGISAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EA+YKKVHAAIRADP+  KS K PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  235  DMEAVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  293



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF KD K LD ++HRKY++GGHVA+YM +L EDEPEKYQTHFS YIK+G+E
Sbjct  172  IPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGVE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E LYKKVHAAIRADP+ KKS K+ PKEHKR+N KKLTY+ER+AKL+ RL A N+AA
Sbjct  232  ADGLEDLYKKVHAAIRADPTFKKSSKEAPKEHKRYNLKKLTYEERKAKLVARLQAFNSAA  291



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIP
Sbjct  111  EMDAEYEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIP  170

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D
Sbjct  171  HSDKRFAGFNKDGKQLDPEVHRKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPD  230

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVHAAIRA P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  231  TIEGMYKKVHAAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGED+SVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDFSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF K+ K LDAEVHRKYI+GGHVA+YM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSEKRFAGFDKEKKELDAEVHRKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            AD +E LYKKVHAAIRADPS KKS K  PKEHKR+N KKLTYDER+ +LI RL ALN+
Sbjct  232  ADGLEELYKKVHAAIRADPSTKKSGKPEPKEHKRYNLKKLTYDERKNELIARLQALNS  289



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EY+GN+EATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYQGNLEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LDAEVHRKYIYGGHVA+YM +L EDEPEKYQ+HF  Y+KKG+E
Sbjct  172  IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMTTLMEDEPEKYQSHFGLYVKKGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
             DN+E LYKKVHAAIRADP+ KKSEKQPPKEHKR+N KKLTY+ER+AKLIER
Sbjct  232  PDNLEELYKKVHAAIRADPTAKKSEKQPPKEHKRYNLKKLTYEERKAKLIER  283



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNVEATGEDYSVEPAESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAG++KD K+LDAEVHRKYIYGGHVAAYM+ L EDEPEKYQ+HF  Y+K+ IE +
Sbjct  174  HSDKRFAGYSKDDKSLDAEVHRKYIYGGHVAAYMSMLREDEPEKYQSHFVEYLKREIEPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            +IE +YKKVH AIRAD      +K  PKEHKR+N KKLTY+ER+AKL+ERLNALN+AAG+
Sbjct  234  SIEEMYKKVHTAIRAD-PSSVKKKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAAGD  292



>ref|NP_001189970.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AEE77020.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=190

 Score =   248 bits (633),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  3    EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  62

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  63   HSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAE  122

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  123  SIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  181



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPAETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF K+ K LD EVHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIK+GIE
Sbjct  172  IPHSDKRFAGFEKEKKELDPEVHRKYIFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +E LYKKVHAAIRADP+ KK+EK+PPK+ KR+N KKLTY+ER+AKLI RL ALN+AA
Sbjct  232  ADGLEDLYKKVHAAIRADPTIKKAEKKPPKKSKRYNLKKLTYEERKAKLIARLQALNSAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  111  DLDEEYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  170

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K+LDAE+HRKYI+GGHVA YM SL ++EPEK+QTHFS YIK+GI AD
Sbjct  171  HSDKRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISAD  230

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EA+YKKVHAAIRADP+  KS K PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  231  DMEAVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   251 bits (642),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  111  DLDEEYEGNVEATGEDFSVEPSDERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  170

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K+LDAE+HRKYI+GGHVA YM SL ++EPEK+QTHFS YIK+GI AD
Sbjct  171  HSDKRFAGFKKDEKSLDAEIHRKYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISAD  230

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EA+YKKVHAAIRADP+  KS K PPK HKR+N KKLTY++R+A L+ERLNALN +AG
Sbjct  231  DMEAVYKKVHAAIRADPTMAKSTKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            +PHS KRFAGF+K +  L+A+VHRKYI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE
Sbjct  172  VPHSVKRFAGFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             DNIE L KKVH+AIRA+P  K +EKQPPK HKR+N KKLTY++R+AKL+ERLNALN+AA
Sbjct  232  PDNIEELLKKVHSAIRAEPLAKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGN+EATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNLEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            +PHS KRFAGF+K +  L+A+VHRKYI+GGHVAAYM +L EDEPEKYQT FS YIKKGIE
Sbjct  172  VPHSVKRFAGFSKGNNELNADVHRKYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             DNIE L KKVH+AIRA+P  K +EKQPPK HKR+N KKLTY++R+AKL+ERLNALN+AA
Sbjct  232  PDNIEELLKKVHSAIRAEPLVKTTEKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAA  291

Query  217  G  215
            G
Sbjct  292  G  292



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP E+RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPAETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAG+ KD+K LD EVHRKYIYGGHVA+YMN+L EDEPEKYQ+HF  YIK+G+E
Sbjct  172  IPHSDKRFAGYNKDNKQLDPEVHRKYIYGGHVASYMNALMEDEPEKYQSHFKEYIKRGVE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            ADNIE +YKKVHAAIRADP+PKKS+KQ PKEHKR+N KKLTY+ER+AKLIER
Sbjct  232  ADNIEEMYKKVHAAIRADPTPKKSDKQQPKEHKRYNLKKLTYEERKAKLIER  283



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGN+EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  113  LDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  172

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD 
Sbjct  173  SDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADG  232

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  233  MEALYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  290



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGN+EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD 
Sbjct  176  SDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADG  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  236  MEALYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGN+EATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD 
Sbjct  176  SDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADG  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +EALYKKVHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  236  MEALYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +D+EYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDKEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA+ HR+YIYGGHVA YM +L E+EPEKYQ+HFS YIKKG+EA+ 
Sbjct  176  SEKRFAGFKKDDKQLDADTHRRYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEAEE  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            IEALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  236  IEALYKKVHAAIRADPSVVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EM+ EY+GNVEATGEDY+VEP ESRRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  115  EMEDEYQGNVEATGEDYAVEPTESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LD EVH KYIYGGHVA+YM +L EDEPEKYQ+HF  YIKKGIE D
Sbjct  175  HSDKRFAGFKKEDKQLDPEVHHKYIYGGHVASYMMTLMEDEPEKYQSHFGEYIKKGIEPD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIEALY+KVHAAIRAD    KSEKQPPKEHKR+N KKLTY+ER++KLIERLNALN+AAG
Sbjct  235  NIEALYRKVHAAIRAD-PTMKSEKQPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+SVEP E RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  116  DLDQEYEGNVEATGEDFSVEPAEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  175

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDA++HRKYIYG HVA YM +L ++EPEKYQ HFS YIKKGIEAD
Sbjct  176  HSDKRFAGFKKDDKQLDADIHRKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEAD  235

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ++EALYKKVHAAIRADPS  KS K PPKEHKR+N KKLTY++R+A L+ERLNALN++ 
Sbjct  236  DMEALYKKVHAAIRADPSMAKSTKTPPKEHKRYNPKKLTYEQRKASLVERLNALNSSG  293



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD 
Sbjct  176  SDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADG  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +E+LYKKVHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  236  MESLYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN EATGED+SVEP ++RRPFRALLDVGL+RTTTGNR+FGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNTEATGEDFSVEPTDTRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE HR YI+GGHV +YM  + EDEPEKYQ+HFS Y KKGIEAD
Sbjct  174  HSDKRFAGFNKETKQLDAETHRNYIFGGHVGSYMKLMMEDEPEKYQSHFSEYAKKGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+EALYKKVHAAIRADP+ KKS+K  P EHKR+N KKLTY+ER+A+LIERL ALN+ AG
Sbjct  234  NLEALYKKVHAAIRADPTLKKSDKPAPTEHKRYNLKKLTYEERKARLIERLKALNSGAG  292



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGEDY VEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF KD K LD+++HRKYIYGGHVA YM S+ E+EPEK+Q HFS Y+KKGI+AD 
Sbjct  176  SDKRFAGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADG  235

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +E+LYKKVHAAIRADP+  KS K+ P  HKR+N KKLTY++R+A L+ERLNALN++AG
Sbjct  236  MESLYKKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   249 bits (636),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 3/179 (2%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGN VFGALKGALD GLDIP
Sbjct  114  EMDDEYQGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHR YIYGGHVAAYM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFSKDGKQLDAEVHRNYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE+LYKKVHAAIRADPS KKSEK PPK+H R    KLTY+ER+AKLI+RL+ LNAAAG
Sbjct  234  NIESLYKKVHAAIRADPSAKKSEKAPPKQHMRL---KLTYEERKAKLIDRLHTLNAAAG  289



>dbj|BAH20263.1| AT3G25520 [Arabidopsis thaliana]
Length=202

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  15   EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  74

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGG V+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  75   HSDKRFAGFHKENKQLDAEIHRNYIYGGDVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAE  134

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  135  SIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  193



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  GIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDSEYEGNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+SK LDAE HR YI+GGHVA YM  LN+DEPEKYQTHFS Y+KKG++AD
Sbjct  174  HSDKRFAGFNKESKQLDAETHRNYIFGGHVANYMKLLNDDEPEKYQTHFSEYLKKGMDAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            N+EALYKKVH AIRADP+ KKSEK  P EHKR+N KKLTY+ER+ +LIERL ALN+
Sbjct  234  NLEALYKKVHTAIRADPTLKKSEKPAPTEHKRYNLKKLTYEERKERLIERLKALNS  289



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFG LKGALDGGLD+P
Sbjct  114  EMDEEYQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDA+ HR YI+GGHVA+YM +L EDEPEKYQTHFS YIK+ +  D
Sbjct  174  HSDKRFAGFKKDEKQLDADFHRNYIFGGHVASYMRTLMEDEPEKYQTHFSDYIKRNVGPD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            ++E LYKKVHAAIRADPS  KS K+PPKEHKR+N KKLTY+ER+AKLI+RLNALN+A  +
Sbjct  234  DMEDLYKKVHAAIRADPSTVKSTKEPPKEHKRYNLKKLTYEERKAKLIDRLNALNSATAD  293



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  SIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE +YKKVHAAIRADP+PKK+EK  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  SIEEMYKKVHAAIRADPNPKKTEKPAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEA GEDYSVEP + RRPF ALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  115  DLDQEYEGNVEAAGEDYSVEPSDERRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            H EKRFAGF KD K LDAE+HRKYIYGGHVA YM SL E+EPEK+Q HFS YIK+GIEAD
Sbjct  175  HGEKRFAGFKKDEKQLDAEIHRKYIYGGHVADYMRSLAEEEPEKFQAHFSDYIKRGIEAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            ++EALYKKVHAAIRA+P+  KS K+PPK HKR+N KKLTY+ R+A L++RLNALN++AG
Sbjct  235  DMEALYKKVHAAIRANPTMVKSTKEPPKTHKRYNLKKLTYEGRKASLVQRLNALNSSAG  293



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 158/179 (88%), Gaps = 4/179 (2%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATG+D++VEP ESRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIP
Sbjct  114  EMDTEYEGNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KDSK LD EVHRKYIYGGHVAAYM       PEKYQ+HFS YIK+GIE D
Sbjct  174  HSEKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMKM----SPEKYQSHFSEYIKRGIEPD  229

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE +YKKVHAAIRADP  KKS+K+PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  230  SIEGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  288



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  142  EMDEEYEGNVEATGEDFSVEPTESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  201

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LD EVHRKYI+GGHV++YM  L EDEPEKYQTHFS Y+K+GIE D
Sbjct  202  HSDKRFAGFSKDEKQLDPEVHRKYIFGGHVSSYMRMLMEDEPEKYQTHFSEYVKRGIEPD  261

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            +IE LYKKVHAAIRADP+  KS K+PPKEHKRFN KKLTY+ER+A+LIER
Sbjct  262  DIEELYKKVHAAIRADPNMVKSTKEPPKEHKRFNLKKLTYEERKARLIER  311



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   246 bits (628),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EA+GED+SVEP E+RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  115  EMDAEYEGNLEASGEDFSVEPTENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+K++K LD   H KYIYGGHVA YM +LNEDEPEK+QTHFS Y+KKGIEAD
Sbjct  175  HSDKRFAGFSKENKQLDFATHAKYIYGGHVADYMKTLNEDEPEKFQTHFSEYVKKGIEAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP  KK+ KQ  KEHKRFN KKLTY +R+A LI+R+  LN+AA
Sbjct  235  EMEALYKKVHAAIRADPLAKKAGKQSLKEHKRFNLKKLTYKQRKANLIDRITTLNSAA  292



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 6/180 (3%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAEVHRKY++GGH+      L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFDKEKKELDAEVHRKYVFGGHI------LAEDEPEKYQSHFSEYIKRGIEAD  227

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
             IEALYKKVHAAIRADPS KKSEKQPPKEHKR+N KKLTY+ER+AKLI R+ A+N+AA N
Sbjct  228  GIEALYKKVHAAIRADPSLKKSEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  287



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQEYEGNVEATGED+ VEP + RRPFRALLDVGLIRTTTGNRVF ALKGALDGGLDIP
Sbjct  114  DLDQEYEGNVEATGEDFCVEPADGRRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF KD K LDAEVH KYIYGGHVA YM +L E+E EKYQ+HFS YIKKGI+AD
Sbjct  174  HSDKRFAGFKKDEKQLDAEVHHKYIYGGHVADYMRTLAEEEFEKYQSHFSEYIKKGIKAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ++E LYKKVHAAIRADPS  KS K+PPKEHKR+N KKLT++ERR++L+ERLNALN+  
Sbjct  234  DVETLYKKVHAAIRADPSVAKSTKEPPKEHKRYNSKKLTHEERRSRLVERLNALNSCG  291



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE +YKKVHAAIRA+P+ KK+EK  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  SIEEMYKKVHAAIRAEPNHKKTEKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  174  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
             +E LYKKVHAAIRADP+PKK+ K  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  234  TMEELYKKVHAAIRADPNPKKTAKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  288



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE LYKKVHAAIRA P+ +K+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  SIEELYKKVHAAIRAXPNXRKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  144  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  203

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  204  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  263

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            ++E LYKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  264  SMEELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  318



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKILAEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  GIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  121  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  180

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  181  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  240

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
             +E LYKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  241  TMEELYKKVHAAIRADPNPKKTEKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  295



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  147  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  206

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  207  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  266

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            ++E LYKKVHAAIRADP+PKK++K  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  267  SMEELYKKVHAAIRADPNPKKTKKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  321



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  138  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  197

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  198  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  257

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            ++E LYKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  258  SMEELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  312



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFSGYIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSGYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVHAAIRA+P+ KK+ K  PKEHKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  GIEEMYKKVHAAIRAEPNHKKTVKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  122  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  181

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA++HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  182  HSDKRFAGFNKENKQLDADIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  241

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
             +E LYKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  242  TMEELYKKVHAAIRADPNPKKTEKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  296



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE +YKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  SIEEIYKKVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K L+AE HR YIYGGHV+ YM  L EDEPEK QTHFS Y+KKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLNAETHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            +IE +YKKVHAAIRADP+PKK+EK  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G+
Sbjct  234  SIEEMYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  293



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  GIEEIYKKVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN A G
Sbjct  234  GIEEIYKKVHAAIRADPNPKKTEKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY GN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYGGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  174  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            ++E LYKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  234  SMEELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  131  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  190

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LNEDEPEK+QTHFS Y+KKG++A+
Sbjct  191  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAE  250

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            ++E LYKKVHAAIRADP+PKK+EK  PK H R+N KKLTY+ER+ KLIER+ ALN
Sbjct  251  SMEELYKKVHAAIRADPNPKKTEKPAPKTHNRYNLKKLTYEERKNKLIERVKALN  305



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  135  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  194

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K L+AE HR YIYGGHV+ YM  L EDEPEK QTHFS Y+KKG+EA+
Sbjct  195  HSDKRFAGFNKENKQLNAETHRNYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAE  254

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            +IE +YKKVHAAIRADP+PKK+EK  PK+HKR+N KKLTY+ER+ KLIER+ ALN A G+
Sbjct  255  SIEEMYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  314



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgg---l  581
            EMD EYEGNV ATGED+S+EP ESRRPFRALLDVGLIRTTTGNRVFGALK         L
Sbjct  114  EMDDEYEGNVVATGEDFSIEPTESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGL  173

Query  580  DIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGI  401
            DIPHS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  L EDEPEK QTHFS YIKKG+
Sbjct  174  DIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGV  233

Query  400  EADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            EA++IE LYKKVHAAIRADP+PKK+EK  PK+HKR+N KKLTY+ER+ KLIER+ ALN A
Sbjct  234  EAESIEELYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGA  293

Query  220  AG  215
             G
Sbjct  294  GG  295



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEA+GEDYSVEP +SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAE+HRKYIYGGHV  YM  L EDEPEKYQTHFS ++KKG+E +
Sbjct  174  HSDKRFAGFNKEGKQLDAEIHRKYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            N+E +YKKVHAAIRADP  KKS+K+ PKEHKR+N KKLTY+ER+A LIER+ ALN+
Sbjct  234  NMEEMYKKVHAAIRADPLAKKSDKETPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   241 bits (616),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +
Sbjct  174  HSDKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YK VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A G
Sbjct  234  NMEEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  292



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EYEGN+EATGED+SVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYEGNLEATGEDFSVEPTESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDAE+HR YIYGGHV+ YM  LN DEPEK+QTHFS ++KKG++A+
Sbjct  174  HSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKMLNYDEPEKFQTHFSQHLKKGVDAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALN  227
            ++E LYKKVHAAIRADP+PKK+EK  PK HKR+N KKLTY+ER+ KLIER+ ALN
Sbjct  234  SMEELYKKVHAAIRADPNPKKTEKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN EATGEDYSVEP E+RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNAEATGEDYSVEPTETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +
Sbjct  174  HSDKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMRLLMEDEPEKYQSHFSDYLKKDLAPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            N+E +YKKVHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+ 
Sbjct  234  NMEEMYKKVHAAIRADPSVKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSV  290



>ref|XP_009384265.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 156/178 (88%), Gaps = 6/178 (3%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVEATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  44   EMDDEYQGNVEATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  103

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KR      D K LDAEVHR YI+GGHVA+Y+ +L EDEPEKYQ HFS YIK+GIE D
Sbjct  104  HSDKR------DEKQLDAEVHRNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPD  157

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            ++E +YKKVHAAI ADP+  KS KQPPKEH+RFN KKLTY+ER+AKLIERLNALNA+A
Sbjct  158  DMEEMYKKVHAAIHADPTTIKSTKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  215



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEA+GEDYSVEP +SRRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEASGEDYSVEPTDSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ K LDAE+HRKYIYGGHV  YM  L EDEPEKYQTHFS ++KKG+E +
Sbjct  174  HSDKRFAGFNKEGKQLDAEIHRKYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            N+E +YK VHAAIRADP  KKS+K+ PKEHKR+N KKLTY+ER+A LIER+ ALN+
Sbjct  234  NMEEMYKNVHAAIRADPLAKKSDKEAPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIP
Sbjct  124  EMDAEYEGNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIP  183

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +
Sbjct  184  HSDKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPE  243

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            N+E +YK VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A
Sbjct  244  NMEEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  300



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN EATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGGLDIP
Sbjct  206  EMDAEYEGNAEATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIP  265

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK +  +
Sbjct  266  HSDKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPE  325

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            N+E +YK VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+A
Sbjct  326  NMEEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  382



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGN+EATGED+SVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNLEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K L+AE+HR YI+GGHV+ YM  L EDEPEK QTHFS YIKKG+E +
Sbjct  174  HSDKRFAGFNKENKQLNAEIHRNYIFGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            +IE +YKKVH AIRADP+PKK EK  PKEHKR N KKLTY+ER+ KLIER+ ALN A+
Sbjct  234  SIEEMYKKVHLAIRADPNPKKCEKPAPKEHKRHNLKKLTYEERKNKLIERVKALNRAS  291



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 4/183 (2%)
 Frame = -1

Query  751  EMDQEYEGNVE----ATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgg  584
            EMD EYEGN E    ATGEDYSVEP ++RRPFRALLDVGL+ TTTGNRVFGALKGALDGG
Sbjct  114  EMDAEYEGNAEVRLIATGEDYSVEPTDTRRPFRALLDVGLVMTTTGNRVFGALKGALDGG  173

Query  583  lDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKG  404
            LDIPHS+KRFAGF K+ KNLDAE+HRKYIYGGHVA YM  L EDEPEKYQ+HFS Y+KK 
Sbjct  174  LDIPHSDKRFAGFNKEGKNLDAEIHRKYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKD  233

Query  403  IEADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            +  +N+E +YK VHAAIRADPS KKS+K+ PKEHKR+N KKLTYDER+A LI+R+ ALN+
Sbjct  234  LAPENMEEMYKNVHAAIRADPSIKKSDKEAPKEHKRYNPKKLTYDERKASLIQRVKALNS  293

Query  223  AAG  215
            A G
Sbjct  294  AIG  296



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD EYEGNVEATGEDYSVEP ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHSEKRFAGF+KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQTHFS YIKKGIE
Sbjct  172  IPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIE  231

Query  397  ADNIEALYKKVHAAIRAD  344
            ADNIEA+YKKV AAIRAD
Sbjct  232  ADNIEAVYKKVQAAIRAD  249



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY GN EA+GEDYSVEP ++RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDEEYVGNEEASGEDYSVEPNDARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAG+ K+SK+LDA++HRKYI GGHVAAYM +L EDEPEKYQ+ FS Y KKGIE +
Sbjct  174  HSDKRFAGYNKESKSLDADLHRKYILGGHVAAYMKTLREDEPEKYQSQFSEYHKKGIEPE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            NIE LYKKVHAAIRADP+ K SEK  PK  K +  +KLTY+ER+ KLI RLNALNA A
Sbjct  234  NIEELYKKVHAAIRADPTIKYSEKHVPKVQKHYLTRKLTYEERKNKLIARLNALNAGA  291



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+GNVEATGED+SVEP ++RRPFRALLDVGLIRTTTGNRVFGALKGALD GLDIP
Sbjct  114  EMDEEYQGNVEATGEDFSVEPTDTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD+K LDAEVH KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  174  HSDKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKR  296
            NIE+LYKKVHAAIRADP+ KK+EK+PPK+HKR
Sbjct  234  NIESLYKKVHAAIRADPTAKKTEKEPPKQHKR  265



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMDQEYEGNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KDSK LD +VHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+E
Sbjct  172  IPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLE  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFN  290
            AD++E LYKKVHAAIRADP  KKSEK+PPKEHKR+ 
Sbjct  232  ADDLEGLYKKVHAAIRADPILKKSEKEPPKEHKRWG  267



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEG+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM +L EDEPEKYQ+HF  YIK+GIEAD
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQ  287
            N+E LYKKVHAAIRADP+ KKSEK+PP EHKR+ Q
Sbjct  234  NLEELYKKVHAAIRADPNQKKSEKKPPAEHKRYGQ  268



>gb|KCW63927.1| hypothetical protein EUGRSUZ_G016041, partial [Eucalyptus grandis]
Length=150

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            MDQEYEGNVEATGED+SVEP E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPH
Sbjct  1    MDQEYEGNVEATGEDFSVEPAETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPH  60

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRFAGF+KDSK LD +VHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+G+EAD+
Sbjct  61   SDKRFAGFSKDSKQLDVDVHRKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADD  120

Query  388  IEALYKKVHAAIRAD  344
            +E LYKKVHAAIRAD
Sbjct  121  LEGLYKKVHAAIRAD  135



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD
Sbjct  174  HSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDAD  233

Query  391  NIEALYKKVHAAIRAD  344
             +EALYKKVHAAIRAD
Sbjct  234  GLEALYKKVHAAIRAD  249



>ref|XP_010648788.1| PREDICTED: 60S ribosomal protein L5-like, partial [Vitis vinifera]
Length=191

 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -1

Query  739  EYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEK  560
            EYEGNVEAT EDYSVEP +SR+PF   L+VGL+RTTTGNRVFGALKGALDGGLDIPHS+K
Sbjct  5    EYEGNVEATSEDYSVEPTDSRKPFCVFLNVGLLRTTTGNRVFGALKGALDGGLDIPHSDK  64

Query  559  RFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEA  380
            RF GF+ DSK LDAEVHRK IY GHV+AYM +  EDEPE YQ+HFS YIKK +E D IE 
Sbjct  65   RFFGFSNDSKQLDAEVHRKCIYVGHVSAYMGTFMEDEPETYQSHFSEYIKKIVEQDGIEE  124

Query  379  LYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +YKKVHA I A+P  KK EKQPPKEHKR+N KKLTY+ER+AKL+ERLNALN+   
Sbjct  125  MYKKVHATICANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSTTA  179



>ref|XP_009384264.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=173

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 6/169 (4%)
 Frame = -1

Query  724  VEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEKRFAGF  545
            ++ATGED+SVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KR    
Sbjct  2    LQATGEDFSVEPAESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR----  57

Query  544  TKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKV  365
              D K LDAEVHR YI+GGHVA+Y+ +L EDEPEKYQ HFS YIK+GIE D++E +YKKV
Sbjct  58   --DEKQLDAEVHRNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKV  115

Query  364  HAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            HAAI ADP+  KS KQPPKEH+RFN KKLTY+ER+AKLIERLNALNA+A
Sbjct  116  HAAIHADPTTIKSTKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  164



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            E+DQEY GN  ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+P
Sbjct  114  ELDQEYVGNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAG++K+ K+L+AE+HRKYI GGHVA YM  L EDEPEKYQ+HFSG+IK+GIEAD
Sbjct  174  HSEKRFAGYSKEDKSLNAEIHRKYILGGHVADYMRLLKEDEPEKYQSHFSGFIKEGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            ++  +Y KVHAAIRADP+ +K+ K+ P E +++  +KLTY+ER+A L++RLNA+N 
Sbjct  234  DLADMYSKVHAAIRADPTSQKTAKKAPAEKRKWKIQKLTYEERQAALVKRLNAING  289



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            E+DQEY GN +ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+P
Sbjct  114  ELDQEYVGNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAG++K+ K+L+AE HRKYI GGH+A YM  L EDEPEKYQ+HFSG+IK G+EAD
Sbjct  174  HSEKRFAGYSKEDKSLNAETHRKYILGGHIADYMRLLKEDEPEKYQSHFSGFIKAGVEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            N+  +Y  VHAAIRADP+ +K+EK+ P E +++  +KLTY+ER+A L++RLNA+N 
Sbjct  234  NLAEMYTSVHAAIRADPTQQKTEKKAPAEKRKWKIQKLTYEERQAALVKRLNAVNG  289



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++D EY GN +ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+P
Sbjct  114  DLDDEYVGNEQATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAG+ K+ K+L+AE+HRKYI GGHVA YM  L EDEPEKYQ+HFSG+IK G+EA+
Sbjct  174  HSEKRFAGYNKEDKSLNAEIHRKYILGGHVADYMKLLKEDEPEKYQSHFSGFIKAGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
            N+  +Y  VHAAIRADP+ +K+EK+ P E +++  +KLTYDER+A L++RLNA+N 
Sbjct  234  NLAEMYTSVHAAIRADPTQQKTEKKAPAEKRKWKIQKLTYDERQAALVKRLNAING  289



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            E+DQEY GN  ATGEDY+VE GE +RPFRALLDVGL+RTTTGNRVFGALKGALDGGLD+P
Sbjct  114  ELDQEYVGNETATGEDYNVEEGEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF+K+ K+L+AE HRKYI GGHVA YM  L EDEPEKYQ+HF+ +IK+GIEAD
Sbjct  174  HSEKRFAGFSKEDKSLNAETHRKYILGGHVADYMRLLKEDEPEKYQSHFNKFIKEGIEAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             +  +Y KVHAAIRADP  +K+EK+ P E +++  +KLT++ER+A L++RLNA+NA
Sbjct  234  ELAEMYTKVHAAIRADPDQQKTEKKAPAEKRKWKIQKLTFEERQAALVQRLNAINA  289



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   213 bits (543),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K ++DQEYEGNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALD G+D
Sbjct  88   KLDLDQEYEGNVEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGID  147

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF+KD K LDA+VHRKYIYGGHVAAYMN+L EDEPEKY+ HFS + K+ IE
Sbjct  148  IPHSDKRFAGFSKDGKQLDAKVHRKYIYGGHVAAYMNTLAEDEPEKYERHFSEFAKREIE  207

Query  397  ADNIEALYKKVHAAIRAD  344
            AD +E LY+KVHAAIRAD
Sbjct  208  ADGLEELYRKVHAAIRAD  225



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP +SRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDDEYEGNVEATGEDYSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF K++K LDA +HR YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+EA+
Sbjct  174  HSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAE  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKR  296
             IE LYKKVHAAIRADP+PKK+ K  PK+HKR
Sbjct  234  GIEELYKKVHAAIRADPNPKKTVKPAPKQHKR  265



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF KD K LDA++HRKYIYGGHVA YM +L E+EPEKYQ+HFS YIKKGIEA++
Sbjct  176  SEKRFAGFKKDDKQLDADIHRKYIYGGHVADYMKNLAEEEPEKYQSHFSDYIKKGIEAED  235

Query  388  IEALYKKVHAAIR  350
            +E LYKKVHAAIR
Sbjct  236  MEGLYKKVHAAIR  248



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K EMD+EYEGNVEATGEDYSVEP ++RRPFRALLDVGLI+TTTGNRVFGALKGALDGGLD
Sbjct  112  KLEMDEEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLD  171

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS++RFAG +KD K L  E HRKY++G  +  YM +L EDEP KYQT F  Y   G +
Sbjct  172  IPHSDQRFAGISKDKKELGPEFHRKYVFGDWLRPYMKTLIEDEPGKYQTPFMDYFSGGKK  231

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +++E ++KKVHAAIRA+P+ KK EKQPPKE KR+N KKLTY+ER+AKL+ RL ALN AA
Sbjct  232  PEDLEEVFKKVHAAIRANPTFKKVEKQPPKEPKRYNLKKLTYEERKAKLVARLQALNFAA  291



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 141/178 (79%), Gaps = 24/178 (13%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +DQEYEGNVEATGED+SVEP + RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH
Sbjct  116  LDQEYEGNVEATGEDFSVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPH  175

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            SEKRFAGF K+                        L E+EPEKYQ+HFS YIKKG+EAD 
Sbjct  176  SEKRFAGFKKN------------------------LAEEEPEKYQSHFSAYIKKGVEADE  211

Query  388  IEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            IEALYKKVHAAIRADPS  KS KQPPKEHKR+N KKLTY++R+A LIERLN LN++ G
Sbjct  212  IEALYKKVHAAIRADPSIVKSTKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  269



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            M   YEGN +  GEDY+VE   E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  115  MADIYEGNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAG++K+ K+L+AEVHRKYIYGGHVAAYM  L +++PEKYQ+HFS +IK+G+E +
Sbjct  175  HSEKRFAGYSKEDKSLNAEVHRKYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPE  234

Query  391  NIEALYKKVHAAIRADpspkksekqppk-EHKRFNQKKLTYDERRAKLIERLNALNAA  221
            ++E LY KVHAAIRADPSP++   +     HK+    KL+Y++R+A LI R+ ALNAA
Sbjct  235  SLEELYTKVHAAIRADPSPREPPPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            M   YEGN +  GEDY+VE   E+RRPFRALLDVGL+RTTTGNRVFGALKGALDGGLDIP
Sbjct  115  MADIYEGNTDVNGEDYNVETLDENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAG++K+ K+L+AEVHRKYIYGGHVAAYM  L +++PEKYQ+HFS +IK+G+E +
Sbjct  175  HSEKRFAGYSKEDKSLNAEVHRKYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPE  234

Query  391  NIEALYKKVHAAIRADpspkksekqppk-EHKRFNQKKLTYDERRAKLIERLNALNAA  221
            ++E LY KVHAAIR DPSP++   +     HK+    KL+Y++R+A LI R+ ALNAA
Sbjct  235  SLEELYTKVHAAIREDPSPREPPPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 127/179 (71%), Gaps = 39/179 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVE                    LD GL                     DIP
Sbjct  114  EMDDEYQGNVEGA------------------LDAGL---------------------DIP  134

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KDSK LDAEVHRKYIYGGHVA+YM  L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  135  HSDKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMRILMEDEPEKYQSHFSEYIKRGIEAD  194

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE+LYKKVHAAIRADPS KKSEK PPK+HKRFN KKLTY+ER+AKLI+RL+ LNAAAG
Sbjct  195  NIESLYKKVHAAIRADPSAKKSEKAPPKQHKRFNLKKLTYEERKAKLIDRLHTLNAAAG  253



>gb|EYU36673.1| hypothetical protein MIMGU_mgv1a0142632mg, partial [Erythranthe 
guttata]
Length=140

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAG+ KDSK+LDAEVHRKYIYGGHVAAYMN+L EDEP+KYQTHFS Y+K G+E
Sbjct  9    IPHSDKRFAGYAKDSKSLDAEVHRKYIYGGHVAAYMNTLMEDEPDKYQTHFSKYVKNGLE  68

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            AD +EALYKKVHAAIRADP+PKKS+KQP KEHKRFN KKLTY+ER+ KLIERLNALN+AA
Sbjct  69   ADELEALYKKVHAAIRADPTPKKSDKQPRKEHKRFNLKKLTYEERKNKLIERLNALNSAA  128



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 127/179 (71%), Gaps = 39/179 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EY+GNVE                    LD GL                     DIP
Sbjct  114  EMDDEYQGNVEGA------------------LDAGL---------------------DIP  134

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD+K LDAEVH KYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  135  HSDKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEAD  194

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            NIE+LYK VHAAIRADP+ KK+EK+PPK+HKRFN KKLTY+ER++KLIERL+ LNAAAG
Sbjct  195  NIESLYKNVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKSKLIERLHTLNAAAG  253



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 125/178 (70%), Gaps = 39/178 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVE                    LD GL                     DIP
Sbjct  114  EMDDEYEGNVEGA------------------LDGGL---------------------DIP  134

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDEPEKYQ+HF+ YIKKGI+AD
Sbjct  135  HSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDAD  194

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             +EALYKKVHAAIRADP+ KKSEK  PKEHKR+N KKLTY+ER+AKL+ERLNALN+A 
Sbjct  195  GLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  252



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 124/179 (69%), Gaps = 39/179 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVE                    LD G+                     DIP
Sbjct  114  EMDAEYEGNVEGA------------------LDGGI---------------------DIP  134

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KDSK LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  135  HSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEAD  194

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  195  NLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  253



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 124/179 (69%), Gaps = 39/179 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVE                    LD G+                     DIP
Sbjct  121  EMDAEYEGNVEGA------------------LDGGI---------------------DIP  141

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRFAGF KDSK LD EVHRKYIYGGHVA+YM +L EDEPEKYQ+HFS YIK+GIEAD
Sbjct  142  HSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEAD  201

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            N+E +YKKVHAAIRA+P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  202  NLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  260



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 125/179 (70%), Gaps = 38/179 (21%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD+EY+G                   F+  LD GL                     DIP
Sbjct  114  EMDEEYQGKC-----------------FQGALDGGL---------------------DIP  135

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRFAGF++D K LDA+VHRKYI+GGHVAAYM +L EDEPEKYQ+HFS YIK+GIE D
Sbjct  136  HSDKRFAGFSRDGKQLDADVHRKYIFGGHVAAYMTTLMEDEPEKYQSHFSEYIKRGIEPD  195

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVHA+IRADP+PKKSEK+PPK HKR N KKLTY+ER+AKLIERLNALN+AAG
Sbjct  196  GIEEMYKKVHASIRADPTPKKSEKEPPKVHKRHNLKKLTYEERKAKLIERLNALNSAAG  254



>gb|KHF99386.1| 60S ribosomal L5 [Gossypium arboreum]
Length=259

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 122/179 (68%), Gaps = 39/179 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVE                    LD G+                     DIP
Sbjct  110  EMDTEYEGNVEGA------------------LDGGV---------------------DIP  130

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
             SEKRFAGF K SK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+GI+ D
Sbjct  131  LSEKRFAGFNKGSKQLDPEVHRKYIYGGHVAAYMKNLMEDEPEKYQSHFSEYIKRGIQPD  190

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
            +IE +YKKVHAAIRADP  KKS+K+PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  191  SIEGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  249



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +D+ YEGN E  GEDY+VE   ++ RPF+ +LD GL RT+TG++VF ALKGALDGGLDIP
Sbjct  115  LDKHYEGNTEDVGEDYNVEAEDDAPRPFQCILDAGLKRTSTGSKVFAALKGALDGGLDIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            H+EKRF GF  DSK  DAEV RKYIYGGHV  YM  + E++PEKY  HF+ Y+K G+E+D
Sbjct  175  HNEKRFVGFDPDSKEFDAEVLRKYIYGGHVGEYMEEMQEEDPEKYTAHFAEYLKAGLESD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
            ++E +Y KVH AIRADP+P+   +  P E KR+ + KLTY++R+ KL  +L+ L A 
Sbjct  235  DLEDMYTKVHDAIRADPAPQLKARSKPAESKRWKEVKLTYEQRKDKLKAKLSELMAG  291



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 118/179 (66%), Gaps = 39/179 (22%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVE                    LD G+                     DIP
Sbjct  114  EMDAEYEGNVEGA------------------LDGGI---------------------DIP  134

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            H +KRFAGF KDSK LD EVHRKYIYGGHVAAYM +L EDEPEKYQ+HFS YIK+ IE D
Sbjct  135  HGDKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRSIEPD  194

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAG  215
             IE +YKKVH AIRA P  KKSEK PPKEHKR+N KKL+Y+ER+AKLI+RL ALN+AAG
Sbjct  195  TIEGMYKKVHTAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  253



>ref|XP_011399144.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
 gb|KFM26248.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
Length=293

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPG-ESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +D+ YEGN    GEDY+V+   E  RPF ALLD GL RT+TG++VF ALKGALDGGLD+P
Sbjct  115  LDKAYEGNTGDVGEDYNVDAADEGPRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS+KRF G+++++K LD+EV RKYI GGHVA YM SL E+EPEKY+ HFS Y+K G+EA+
Sbjct  175  HSDKRFVGYSRETKELDSEVLRKYILGGHVAEYMESLKEEEPEKYERHFSRYVKAGLEAE  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAA  221
             +E LY  VHAAIRADP  K+ E++ P + K + + KLTY+ R+ KL  +L  L AA
Sbjct  235  GLEELYTSVHAAIRADPVQKRKERKAPADKKAWKESKLTYEARKEKLKAKLAELTAA  291



>ref|XP_010451808.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=143

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -1

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPHS+KRFAGF K++K LDA +HR YIYGGHV+ YM +L EDEPEK QTHFS YIKKG+E
Sbjct  13   IPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVE  72

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
            A+ IE LYKKVHAAIRADP+PKK+ K  PK+HKR+N KKLTY+ER+ KLIER+ ALN A 
Sbjct  73   AEGIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAG  132

Query  217  G  215
            G
Sbjct  133  G  133



>sp|P93779.1|RL5_SOLME RecName: Full=60S ribosomal protein L5, partial [Solanum melongena]
 dbj|BAA19415.1| ribosomal protein L5 [Solanum melongena]
Length=121

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  544  TKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEALYKKV  365
            +KDSK LDAEVHRKYIYGGHVAAYMN L EDEPEKYQ+HFS YIK  +  DNIE +YKKV
Sbjct  2    SKDSKQLDAEVHRKYIYGGHVAAYMNILMEDEPEKYQSHFSSYIKADLAPDNIEEMYKKV  61

Query  364  HAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            HAAIR DPSPKKS+KQPPK HKR+N KKLTY+ER+AKLIERLNALNAA GN
Sbjct  62   HAAIRPDPSPKKSQKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  112



>gb|KJB10809.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=230

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATG+D++VEP ESRRPFRALLDVGL+RTTTGNRVF  LKGALDGG+DIP
Sbjct  114  EMDTEYEGNVEATGDDFTVEPAESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEP  446
            HSEKRFAGF KDSK LD EVHRKYIYGGHVAAYM +L EDEP
Sbjct  174  HSEKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMKNLMEDEP  215



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGES-RRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            + + Y GN E  GEDY+VE  E  +RPF ALLD GL RT+TG++VF ALKGALDGGLD+P
Sbjct  115  LAKAYAGNTEDVGEDYNVEEIEGEKRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSEKRF G++++SK+LD++V RKYI+GGHV  YM S+ E++ EK++ HFS YIK G+EAD
Sbjct  175  HSEKRFVGYSRESKSLDSDVLRKYIFGGHVGEYMESMAEEDEEKFKRHFSCYIKAGLEAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNA  224
             +EALY KVHAAIRA P   K  +  P +   +   K TY+ER+ +L  +L  L A
Sbjct  235  GLEALYTKVHAAIRASPEAAKKSRSKPAKAGSWKTPKSTYEERKERLKAKLAELMA  290



>gb|EPS64989.1| hypothetical protein M569_09790, partial [Genlisea aurea]
Length=207

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglD  578
            K ++DQEY+GNVEATGEDYSVEP ESRRPFRALLDVGL+RTTTGNRVFGALKGALD G+D
Sbjct  110  KLDLDQEYKGNVEATGEDYSVEPAESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGID  169

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMN  467
            IPHS+KRFAGF+KDSK LDAEVHRKYI+GGHVAAYMN
Sbjct  170  IPHSDKRFAGFSKDSKQLDAEVHRKYIFGGHVAAYMN  206



>ref|XP_006447904.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61144.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=268

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYM  470
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYM  207



>ref|XP_006447906.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61146.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=217

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYM  470
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYM  207



>ref|XP_009383145.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L5-2 [Musa 
acuminata subsp. malaccensis]
Length=140

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = -1

Query  577  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIE  398
            IPH++KRFAGF KD K LDAE+HRKYI+GGHVA+ M +L EDEPEK Q HF  YIK+  E
Sbjct  11   IPHNDKRFAGFKKDKKQLDAEIHRKYIFGGHVASSMRNLMEDEPEKXQAHFIEYIKRQAE  70

Query  397  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAA  218
             D +E +YKKVHAAIR+  S           H RFN KKLTY+ER+A+LIERLNALNA A
Sbjct  71   PDGMEEMYKKVHAAIRS--SKIDKVTTNGALHCRFNLKKLTYEERKARLIERLNALNACA  128

Query  217  G  215
            G
Sbjct  129  G  129



>gb|KDO51034.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=217

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEG+VEATGEDYSVEP E+RRPFRALLDVGL++TTTGNRVFGALKGALDGGLDIP
Sbjct  114  EMDAEYEGHVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYM  470
            HSEKRFAGF+KDSK LDAEVHRKYIY GHVAAYM
Sbjct  174  HSEKRFAGFSKDSKQLDAEVHRKYIYCGHVAAYM  207



>gb|KJB22672.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIP
Sbjct  114  EMDAEYEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYM  470
            HS+KRFAGF KD K LD EVHRKYIYGGHVAAYM
Sbjct  174  HSDKRFAGFNKDGKQLDPEVHRKYIYGGHVAAYM  207



>gb|KJB22671.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=221

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            EMD EYEGNVEATGED++VEP E+RRPFRALLDVGLIRTTTGNRVFG LKGALDGG+DIP
Sbjct  114  EMDAEYEGNVEATGEDFTVEPAETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYM  470
            HS+KRFAGF KD K LD EVHRKYIYGGHVAAYM
Sbjct  174  HSDKRFAGFNKDGKQLDPEVHRKYIYGGHVAAYM  207



>ref|XP_003856228.1| 60S ribosomal protein L5 [Zymoseptoria tritici IPO323]
 gb|EGP91204.1| hypothetical protein MYCGRDRAFT_102365 [Zymoseptoria tritici 
IPO323]
Length=300

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 129/189 (68%), Gaps = 11/189 (6%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEP----GESRRPFRALLDVGLIRTTTGNRVFgalkgald  590
            K ++D+ +EG  EA GE    EP    GE+RRPF+A LDVGL RT+TG RVFGA+KGA D
Sbjct  112  KLKLDETFEGVEEADGEFTITEPADVDGETRRPFKAFLDVGLARTSTGARVFGAMKGASD  171

Query  589  gglDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIK  410
            GGL IPHSEKRF GF  ++K LDAE  RKYI+GGHVA YM +L +D+ E+Y++ F+GYI 
Sbjct  172  GGLYIPHSEKRFPGFDIETKELDAETLRKYIFGGHVAEYMETLADDDEERYKSQFNGYID  231

Query  409  KGIEADNIEALYKKVHAAIRAD-------pspkksekqppkEHKRFNQKKLTYDERRAKL  251
              IEAD +E LY+  H  IR D          KK+++Q   E  ++ QKKLT+ +R+ ++
Sbjct  232  DEIEADGLEELYQDAHKQIREDPFKKAEGEGEKKTKEQWKAESLKYKQKKLTHAQRQERV  291

Query  250  IERLNALNA  224
             E++ AL +
Sbjct  292  QEKIKALTS  300



>ref|XP_005781727.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
 gb|EOD29298.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
Length=304

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPH  569
            +D++YEGN +  GE + VE  +  RPF  +LDVGLIRTTTG +VFGALKGA+DGGL+IPH
Sbjct  115  LDEQYEGNDDPDGEHFLVEHEDGPRPFTCVLDVGLIRTTTGAKVFGALKGAVDGGLNIPH  174

Query  568  SEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADN  389
            S+KRF G+  D+K LD E H+KYI+GGHVA YM  L E++P++YQT F+ YI+K IEAD+
Sbjct  175  SDKRFPGYDPDAKELDGETHKKYIFGGHVAEYMELLEEEDPDRYQTQFANYIEKDIEADS  234

Query  388  IEALYKKVHAAIRAD  344
            +E +Y+K H AIR D
Sbjct  235  LEEMYQKAHEAIRED  249



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 121/177 (68%), Gaps = 2/177 (1%)
 Frame = -1

Query  736  YEGNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIPHSEK  560
            Y G  EATGEDY+VE  E   RPF ALLD GL RT+TG++VF ALKGALDGGLDIPHS+K
Sbjct  119  YVGQEEATGEDYNVEAAEEGPRPFTALLDTGLKRTSTGSKVFAALKGALDGGLDIPHSDK  178

Query  559  RFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEADNIEA  380
            RF G++ + K LD EV RK+IYGGHVA YM  + E+ PEKYQ+HF+ +I+  ++ ++IE 
Sbjct  179  RFVGYSGEDKKLDPEVLRKHIYGGHVAEYMEEMQEEAPEKYQSHFAKWIEAEVDPEDIEE  238

Query  379  LYKKVHAAIRAD-pspkksekqppkEHKRFNQKKLTYDERRAKLIERLNALNAAAGN  212
            LYK VH  IR +    KK   +P    K++   KLTY+ER+A L  +L  L     +
Sbjct  239  LYKGVHEKIRENPIGEKKERSKPETAQKKWKPSKLTYEERKAALKTKLAQLKEGGAD  295



>ref|XP_011197235.1| PREDICTED: 60S ribosomal protein L5 [Bactrocera dorsalis]
Length=298

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 123/172 (72%), Gaps = 1/172 (1%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggl  581
            K  +D  Y G  E TGE+Y+VEP  +    FR  LDVGL RTTTG RVFGA+KGA+DGGL
Sbjct  112  KLGLDTLYGGCTEVTGEEYNVEPVDDGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGL  171

Query  580  DIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGI  401
            +IPHS KRF G+  ++KN +A+VHR +I+G HVA YM +L E++ E ++  FS YIK GI
Sbjct  172  NIPHSVKRFPGYNAEAKNFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGI  231

Query  400  EADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIE  245
             AD++E +YKK H AIR+DP+ KK +++     KR+N KKLT ++R+ K+ E
Sbjct  232  RADDLETIYKKAHQAIRSDPTHKKKDQKSGVVKKRWNAKKLTNEQRKVKVAE  283



>ref|XP_004533872.1| PREDICTED: 60S ribosomal protein L5-like [Ceratitis capitata]
Length=298

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 123/169 (73%), Gaps = 1/169 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +D  Y G  E TGE+Y+VEP  E    FR  LDVGL RTTTG RVFGA+KGA+DGGL+IP
Sbjct  115  LDTLYGGCTEVTGEEYNVEPVDEGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS KRF G++ ++K+ +A+VHR +I+G HVA YM +L E++ E ++  FS YIK GI AD
Sbjct  175  HSVKRFPGYSAEAKSFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRAD  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIE  245
            ++E +YKK H +IRADP+ KK E++     KR+N KKLT ++R+ K+ E
Sbjct  235  DLETIYKKAHQSIRADPTHKKKEQKSGGVKKRWNAKKLTNEQRKVKVAE  283



>ref|XP_011191002.1| PREDICTED: 60S ribosomal protein L5 [Bactrocera cucurbitae]
Length=298

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 123/172 (72%), Gaps = 1/172 (1%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldggl  581
            K  +D  Y G  E TGE+Y+VEP  +    FR  LDVGL RTTTG RVFGA+KGA+DGGL
Sbjct  112  KLGLDTLYGGCTEVTGEEYNVEPVDDGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGL  171

Query  580  DIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGI  401
            +IPHS KRF G+  ++KN +A+VHR +I+G HVA YM +L E++ E ++  FS YIK GI
Sbjct  172  NIPHSVKRFPGYNAEAKNFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGI  231

Query  400  EADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIE  245
             AD++E +YKK H +IR+DP+ KK +++     KR+N KKLT ++R+ K+ E
Sbjct  232  RADDLETIYKKAHQSIRSDPTHKKKDQKSGGVKKRWNAKKLTNEQRKVKVAE  283



>gb|ADQ73874.1| 60S ribosomal protein L5 [Laodelphax striatella]
Length=299

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEP-GESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +DQ Y G  E TGE+Y+VE   E    F+  LDVGL++T+TG RVFGA+KGA+DGGL+IP
Sbjct  115  LDQLYAGTTEVTGEEYNVEALDEGPGAFKCFLDVGLMKTSTGARVFGAMKGAVDGGLNIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS KRF GF  +SKN +A+VHRK+I+G HV+ YM  L E++ E Y+  FS +IK G++ +
Sbjct  175  HSVKRFPGFDGESKNFNADVHRKHIFGLHVSEYMQQLAENDDEAYKKQFSQFIKLGVQPE  234

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNAL  230
             IE +YKK H AIRADP  K  ++  P   +R+N+KKLT  ERR  + ++  A 
Sbjct  235  AIEGIYKKAHEAIRADPVLKAKQRAKPPVKRRWNRKKLTLSERRNTIAQKKAAF  288



>gb|EME50014.1| hypothetical protein DOTSEDRAFT_31141 [Dothistroma septosporum 
NZE10]
Length=302

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 123/191 (64%), Gaps = 11/191 (6%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEP----GESRRPFRALLDVGLIRTTTGNRVFgalkgald  590
            K ++   +EG  E  GE    EP    GE RRPF+  LDVGL+RT+TG RVFGALKGA D
Sbjct  112  KLDLADTFEGVEEPDGEFGLTEPAEVDGEERRPFKCFLDVGLVRTSTGARVFGALKGASD  171

Query  589  gglDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIK  410
            GG+ IPHSEKRF G+  +SK LDAE  RKYI+GGHVA YM +L +D+ E+Y++ F GYI 
Sbjct  172  GGVYIPHSEKRFPGYDMESKELDAETLRKYIFGGHVAEYMETLADDDEERYKSQFQGYID  231

Query  409  KGIEADNIEALYKKVHAAIRAD-------pspkksekqppkEHKRFNQKKLTYDERRAKL  251
              IEAD +E LY   H  IR D          KKS+ +   E K+F Q KLT+ ER+ ++
Sbjct  232  DEIEADGLEELYADAHKQIREDPFKKDEEEGEKKSKDEWKAESKKFRQVKLTHAERKQRV  291

Query  250  IERLNALNAAA  218
             E++ AL + A
Sbjct  292  QEKIKALASEA  302



>gb|EMF17397.1| 60S ribosomal protein L5 [Sphaerulina musiva SO2202]
Length=302

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 126/187 (67%), Gaps = 11/187 (6%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVEP----GESRRPFRALLDVGLIRTTTGNRVFgalkgald  590
            K E++  + G  EA GE    +P    GE+RRPF+  LDVGL RT+TG RVFGA+KGA D
Sbjct  112  KLELEDTFTGVEEADGEFTETQPEEVDGETRRPFKVFLDVGLTRTSTGARVFGAMKGASD  171

Query  589  gglDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIK  410
            GGL +PHSEKRF G+  ++K LDAE  RKYI+ GHVA YM +L +D+ E+Y++ FSGYI 
Sbjct  172  GGLYVPHSEKRFPGYDIETKELDAETLRKYIFAGHVAEYMETLADDDEERYKSQFSGYID  231

Query  409  KGIEADNIEALYKKVHAAIR-------ADpspkksekqppkEHKRFNQKKLTYDERRAKL  251
              IEAD +E LY++ H AIR        D   KK++++   E +++  KKLT++ERR ++
Sbjct  232  DEIEADGLEELYQEAHKAIREDPWKKDEDAGEKKTKEEWKAESQKYKLKKLTHEERRQRV  291

Query  250  IERLNAL  230
             E++  L
Sbjct  292  QEKIKTL  298



>gb|AGM32490.1| 60S ribosomal protein L5-like protein, partial [Coptotermes formosanus]
Length=280

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGE-SRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            +DQ Y G  E TGE+Y+VE  E     FR  LDVGL+RTTTG RVFGA+KGA+DGGL+IP
Sbjct  115  LDQLYIGCTEVTGEEYNVEAVEDGPGAFRCYLDVGLMRTTTGARVFGAMKGAVDGGLNIP  174

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HS KRF G+  ++K  +AEVHRK+I+G HVA YM  L ED+ E Y+  FS YIK GIE D
Sbjct  175  HSTKRFPGYDAETKEFNAEVHRKHIFGQHVADYMRQLAEDDDEAYKRQFSNYIKLGIEPD  234

Query  391  NIEALYKKVHAAIRAD-pspkksekqppkEHKRFNQKKLTYDERR  260
            +IE++YKK H AIRAD    KK +       KR+N+ KL+  ER+
Sbjct  235  SIESIYKKAHEAIRADPARIKKQKDTTDIVKKRWNRAKLSLSERK  279



>ref|XP_008198550.1| PREDICTED: 60S ribosomal protein L5 [Tribolium castaneum]
 gb|EEZ97412.1| hypothetical protein TcasGA2_TC011241 [Tribolium castaneum]
Length=300

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 122/175 (70%), Gaps = 10/175 (6%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgg  584
            +D+ Y G  E TG++Y+VE     PG     FR  LDVGL RTTTG RVF A+KGA+DGG
Sbjct  115  LDKLYAGTTEVTGDEYNVEGVENGPG----AFRCYLDVGLQRTTTGARVFAAMKGAVDGG  170

Query  583  lDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKG  404
            L+IPHS KRF G+  +SK+ +A+VHR +I+G HVA YM SL E++PE ++  FS YIK G
Sbjct  171  LNIPHSTKRFPGYDAESKSFNADVHRSHIFGQHVADYMRSLEEEDPEAFKRQFSQYIKLG  230

Query  403  IEADNIEALYKKVHAAIRAD-pspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            I AD IE +YK  HAAIRA+  + KK EK P    KR+N+KKLT  ER+ ++ ++
Sbjct  231  INADQIEGIYKNAHAAIRANPTAEKKPEKAPSATKKRWNRKKLTLAERKNRVAQK  285



>dbj|BAN20290.1| ribosomal protein L5 [Riptortus pedestris]
Length=299

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 120/181 (66%), Gaps = 9/181 (5%)
 Frame = -1

Query  757  KPEMDQEYEGNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgal  593
            K ++D  YEG  E TG++Y+VE     PG     FR  LDVGL++T+ G RVFGALKGA+
Sbjct  112  KLKLDSLYEGTTEVTGDEYNVENLDEGPG----AFRCYLDVGLMKTSAGARVFGALKGAV  167

Query  592  dgglDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYI  413
            DGGL+IPHS KRF G+  +SK  +AEVHRK+I+G HVA YM  L E + + Y+  FS YI
Sbjct  168  DGGLNIPHSMKRFPGYDSESKEFNAEVHRKHIFGVHVADYMRQLAESDDDAYKKQFSQYI  227

Query  412  KKGIEADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIERLNA  233
            K GI AD +E +YKK HAAIRADPS K   K      KR+N+ KLT  ER+  + ++  A
Sbjct  228  KNGITADQVEEIYKKAHAAIRADPSKKAPAKTKTPVKKRWNRAKLTLAERKNSIAQKKAA  287

Query  232  L  230
             
Sbjct  288  F  288



>gb|ETN75275.1| ribosomal L18p/L5e family protein [Necator americanus]
Length=305

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 117/170 (69%), Gaps = 0/170 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++D+ ++G  E  GE Y+VE  + R PF+A+LDVGL RTTTG +VF  +KG  DGG+D+P
Sbjct  122  QLDKTFKGQEEVNGEFYTVEEEDGRAPFKAVLDVGLARTTTGCKVFAVMKGVADGGIDVP  181

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSE RF G+  +SK  DAE HR  I+G HVA YM SL E++ + Y+  FS +I +G+ AD
Sbjct  182  HSENRFFGYDSESKKYDAEAHRDRIFGKHVAEYMRSLKEEDEDAYKRQFSHFIAEGVTAD  241

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            N+E +YKK H AIRA+P  +    +   E KR+N KK+T ++RR ++ E+
Sbjct  242  NLEEMYKKGHEAIRANPDRRTKPSKKQGEKKRWNAKKITLEQRRERVEEK  291



>gb|EYB99479.1| hypothetical protein Y032_0122g1070 [Ancylostoma ceylanicum]
Length=297

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 116/170 (68%), Gaps = 0/170 (0%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVEPGESRRPFRALLDVGLIRTTTGNRVFgalkgaldgglDIP  572
            ++DQ ++G  +  GE Y+VE  + R PF+A+LDVGL RTTTG +VF  +KG  DGG+++P
Sbjct  114  KLDQTFKGQEDVNGEFYTVEEEDGRSPFKAVLDVGLARTTTGCKVFAVMKGVADGGIEVP  173

Query  571  HSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEAD  392
            HSE RF G+  +SK  DAE HR  I+G HVA YM SL +++ + Y+  FS +I  GI AD
Sbjct  174  HSENRFFGYDSESKKYDAEAHRDRIFGKHVAEYMRSLKDEDEDAYKRQFSHFIANGISAD  233

Query  391  NIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            N+E +YKK H AIRA+P  +    +   E KR+N KK+T ++RR ++ E+
Sbjct  234  NLEEMYKKGHEAIRANPDRRTKPSKKQGEKKRWNAKKITLEKRRERVEEK  283



>sp|Q56FG6.1|RL5_LYSTE RecName: Full=60S ribosomal protein L5 [Lysiphlebus testaceipes]
 gb|AAX62436.1| ribosomal protein L5 [Lysiphlebus testaceipes]
Length=297

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 116/172 (67%), Gaps = 9/172 (5%)
 Frame = -1

Query  751  EMDQEYEGNVEATGEDYSVE-----PGESRRPFRALLDVGLIRTTTGNRVFgalkgaldg  587
            ++D  Y G  E  G++Y+VE     PG     FR  LD GL+RTTTG R+FGA+KGA+DG
Sbjct  114  KLDTLYTGTTEVDGDEYNVEEHDDGPG----AFRCYLDTGLMRTTTGARIFGAMKGAVDG  169

Query  586  glDIPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKK  407
            GL+IPHS KRF G+  +SK+ +A+VHR++I+  H+A YM +L E+EPE +Q  FS YIK 
Sbjct  170  GLNIPHSTKRFPGYDNESKSFNADVHRQHIFAHHIANYMKTLEENEPENFQRQFSQYIKN  229

Query  406  GIEADNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKL  251
            GI AD IE +YKK H AIRADP   +  K      KR+N+ KLT  ER+ ++
Sbjct  230  GITADGIEEMYKKAHEAIRADPDRAEIVKTKEPVKKRWNRAKLTLSERKDRV  281



>ref|XP_006611949.1| PREDICTED: 60S ribosomal protein L5-like [Apis dorsata]
Length=298

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = -1

Query  748  MDQEYEGNVEATGEDYSVEPGESRRP--FRALLDVGLIRTTTGNRVFgalkgaldgglDI  575
            +D  Y G  E TG++Y+VE  +   P  FR  LD GL+RTTTG RVFGA+KGA+DGGL+I
Sbjct  115  LDTLYTGTTEVTGDEYNVEELDDEGPGAFRCYLDTGLMRTTTGARVFGAMKGAVDGGLNI  174

Query  574  PHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEPEKYQTHFSGYIKKGIEA  395
            PHS KRF G+  +SK+ +A+VHR++I+G HVA YM +L ED+ E ++  FS YIK GI A
Sbjct  175  PHSTKRFPGYDSESKSFNADVHRQHIFGQHVANYMKTLEEDDDEAFKRQFSQYIKNGITA  234

Query  394  DNIEALYKKVHAAIRADpspkksekqppkEHKRFNQKKLTYDERRAKLIER  242
            D+IE++YK  H AIRA+P   K  K+     KR+N+ KL+  ER+ ++ ++
Sbjct  235  DSIESIYKNAHEAIRANPEHTKVTKEKIPVKKRWNRAKLSLSERKNRVAQK  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260