BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF025A08

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    344   1e-111   
ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    338   7e-111   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    340   7e-110   Solanum lycopersicum
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    333   3e-107   
ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    331   1e-106   Nicotiana sylvestris
emb|CDP13254.1|  unnamed protein product                                326   8e-105   Coffea canephora [robusta coffee]
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         316   1e-100   Jatropha curcas
gb|KHG05074.1|  Endoglucanase                                           306   5e-97    Gossypium arboreum [tree cotton]
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    306   1e-96    Populus euphratica
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    305   2e-96    Nelumbo nucifera [Indian lotus]
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    305   3e-96    Sesamum indicum [beniseed]
gb|KJB15656.1|  hypothetical protein B456_002G188600                    304   3e-96    Gossypium raimondii
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    304   4e-96    Ricinus communis
ref|XP_007044872.1|  Cellulase protein                                  303   2e-95    
gb|KDO82153.1|  hypothetical protein CISIN_1g008330mg                   291   6e-94    Citrus sinensis [apfelsine]
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             298   1e-93    Populus trichocarpa [western balsam poplar]
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                   291   8e-93    Citrus sinensis [apfelsine]
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    295   1e-92    Populus euphratica
gb|KHN06535.1|  Endoglucanase                                           291   3e-92    Glycine soja [wild soybean]
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             293   1e-91    Citrus clementina [clementine]
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   293   1e-91    Citrus sinensis [apfelsine]
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    293   2e-91    Citrus sinensis [apfelsine]
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    291   3e-91    Cicer arietinum [garbanzo]
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    291   5e-91    Vitis vinifera
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    287   9e-90    Populus euphratica
ref|XP_010100346.1|  hypothetical protein L484_027655                   285   2e-88    
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    284   2e-88    
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             283   6e-88    Phaseolus vulgaris [French bean]
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    282   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    278   4e-86    Eucalyptus grandis [rose gum]
gb|KHN29014.1|  Endoglucanase                                           278   4e-86    Glycine soja [wild soybean]
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    277   1e-85    Glycine max [soybeans]
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       283   1e-85    Glycine soja [wild soybean]
ref|XP_004309996.1|  PREDICTED: uncharacterized protein LOC101307271    276   1e-85    Fragaria vesca subsp. vesca
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 276   2e-85    Medicago truncatula
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            269   4e-84    
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    272   7e-84    Cucumis melo [Oriental melon]
gb|KHN19917.1|  hypothetical protein glysoja_032397                     269   1e-83    Glycine soja [wild soybean]
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    270   5e-83    
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       270   5e-83    Cucumis sativus [cucumbers]
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    270   5e-83    Glycine max [soybeans]
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    269   2e-82    Glycine max [soybeans]
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             266   8e-82    Phaseolus vulgaris [French bean]
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    267   1e-81    
gb|KHN06534.1|  Endoglucanase                                           266   2e-81    Glycine soja [wild soybean]
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             265   5e-81    Phaseolus vulgaris [French bean]
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             264   1e-80    Prunus persica
gb|EPS61076.1|  hypothetical protein M569_13724                         258   3e-80    Genlisea aurea
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    260   2e-79    Prunus mume [ume]
gb|KHG22500.1|  Endoglucanase E1                                        259   3e-79    Gossypium arboreum [tree cotton]
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    260   3e-79    Elaeis guineensis
gb|KJB78033.1|  hypothetical protein B456_012G173600                    259   2e-78    Gossypium raimondii
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    253   2e-76    Nelumbo nucifera [Indian lotus]
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    247   2e-74    Cicer arietinum [garbanzo]
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    246   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    245   2e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    244   2e-73    
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 246   3e-73    Medicago truncatula
gb|KHN43979.1|  Endoglucanase E1                                        242   5e-73    Glycine soja [wild soybean]
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    242   3e-72    
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    241   3e-72    Glycine max [soybeans]
ref|XP_003601885.1|  Endoglucanase                                      242   2e-71    
emb|CAN62580.1|  hypothetical protein VITISV_036569                     229   5e-71    Vitis vinifera
emb|CAN72915.1|  hypothetical protein VITISV_020826                     227   3e-70    Vitis vinifera
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    236   4e-70    
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    235   5e-70    
emb|CAN73208.1|  hypothetical protein VITISV_009079                     226   5e-70    Vitis vinifera
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    233   5e-69    
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    233   5e-69    
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    232   7e-69    Vitis vinifera
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    231   4e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    231   4e-68    
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    230   7e-68    Nelumbo nucifera [Indian lotus]
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    230   9e-68    Elaeis guineensis
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                229   1e-67    Erythranthe guttata [common monkey flower]
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    230   1e-67    Tarenaya hassleriana [spider flower]
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    228   2e-67    Vitis vinifera
gb|AAS00040.1|  unknown                                                 219   2e-67    Vitis riparia [frost grape]
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    228   4e-67    
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    226   4e-66    Setaria italica
emb|CAN60394.1|  hypothetical protein VITISV_015741                     215   9e-66    Vitis vinifera
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    224   1e-65    Arabis alpina [alpine rockcress]
emb|CBI20318.3|  unnamed protein product                                219   1e-65    Vitis vinifera
gb|ACN33507.1|  unknown                                                 219   3e-65    Zea mays [maize]
gb|EMT27118.1|  hypothetical protein F775_19072                         224   4e-65    
gb|EAY94563.1|  hypothetical protein OsI_16341                          223   6e-65    Oryza sativa Indica Group [Indian rice]
emb|CAD41089.2|  OSJNBb0011N17.6                                        222   1e-64    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67676.1|  H0510A06.1                                             222   1e-64    Oryza sativa [red rice]
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    224   1e-64    Eucalyptus grandis [rose gum]
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    220   2e-64    Vitis vinifera
emb|CBI20316.3|  unnamed protein product                                209   3e-64    Vitis vinifera
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          221   3e-64    Sorghum bicolor [broomcorn]
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    221   3e-64    Tarenaya hassleriana [spider flower]
dbj|BAK00694.1|  predicted protein                                      221   3e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132121.1|  hypothetical protein precursor                     219   2e-63    Zea mays [maize]
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    218   2e-63    Nelumbo nucifera [Indian lotus]
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    219   2e-63    Camelina sativa [gold-of-pleasure]
emb|CDX83590.1|  BnaC07g23300D                                          218   3e-63    
gb|AIZ06017.1|  hypothetical protein                                    218   5e-63    Zea nicaraguensis
emb|CDY13613.1|  BnaA06g33100D                                          217   8e-63    Brassica napus [oilseed rape]
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    217   9e-63    Brassica rapa
emb|CBI20314.3|  unnamed protein product                                205   1e-62    Vitis vinifera
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    216   2e-62    Tarenaya hassleriana [spider flower]
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    216   3e-62    Camelina sativa [gold-of-pleasure]
ref|XP_002876947.1|  predicted protein                                  215   6e-62    
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    214   7e-62    Eucalyptus grandis [rose gum]
dbj|BAB02432.1|  unnamed protein product                                215   7e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    214   7e-62    Nelumbo nucifera [Indian lotus]
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    213   3e-61    Oryza brachyantha
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             213   3e-61    
emb|CAH67677.1|  H0510A06.2                                             212   5e-61    Oryza sativa [red rice]
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    212   6e-61    Brachypodium distachyon [annual false brome]
emb|CAD41090.2|  OSJNBb0011N17.7                                        212   8e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EEE61202.1|  hypothetical protein OsJ_15212                          212   8e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77495.1|  hypothetical protein OsI_16343                          212   8e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                210   4e-60    Arabidopsis lyrata subsp. lyrata
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     208   1e-59    Eucalyptus grandis [rose gum]
gb|AAD31066.1|AC007357_15  F3F19.15                                     207   2e-59    Arabidopsis thaliana [mouse-ear cress]
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     207   3e-59    Eucalyptus grandis [rose gum]
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       207   3e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501449.1|  PREDICTED: uncharacterized protein LOC104778702    197   4e-58    
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       204   4e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             202   2e-57    
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    202   3e-57    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             202   5e-57    Eutrema salsugineum [saltwater cress]
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040    196   2e-56    
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    200   2e-56    Setaria italica
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             197   2e-55    Capsella rubella
gb|EEC77494.1|  hypothetical protein OsI_16340                          197   4e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    197   4e-55    Brachypodium distachyon [annual false brome]
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    196   5e-55    
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    196   5e-55    Camelina sativa [gold-of-pleasure]
emb|CAH66880.1|  OSIGBa0158F13.11                                       196   6e-55    Oryza sativa [red rice]
ref|NP_001053105.1|  Os04g0480900                                       196   6e-55    
dbj|BAK05121.1|  predicted protein                                      196   7e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    196   8e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    195   1e-54    Camelina sativa [gold-of-pleasure]
gb|KCW59701.1|  hypothetical protein EUGRSUZ_H02460                     187   2e-54    Eucalyptus grandis [rose gum]
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             194   3e-54    Eutrema salsugineum [saltwater cress]
emb|CDY16066.1|  BnaC08g40570D                                          194   3e-54    Brassica napus [oilseed rape]
ref|XP_010662248.1|  PREDICTED: thylakoid lumenal protein At1g122...    186   3e-53    Vitis vinifera
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                191   4e-53    
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    191   1e-52    Brassica rapa
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             189   2e-52    Capsella rubella
emb|CDY19395.1|  BnaC05g09040D                                          189   2e-52    Brassica napus [oilseed rape]
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                188   4e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    187   4e-52    
emb|CDY38435.1|  BnaA10g17230D                                          188   5e-52    Brassica napus [oilseed rape]
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    188   5e-52    Brassica rapa
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    187   9e-52    Camelina sativa [gold-of-pleasure]
emb|CDY16914.1|  BnaC09g40410D                                          187   1e-51    Brassica napus [oilseed rape]
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          187   1e-51    Sorghum bicolor [broomcorn]
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    187   1e-51    Camelina sativa [gold-of-pleasure]
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    187   2e-51    Setaria italica
gb|EMT10461.1|  Endoglucanase E1                                        186   2e-51    
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       185   4e-51    Arabidopsis thaliana [mouse-ear cress]
gb|ACF85134.1|  unknown                                                 184   6e-51    Zea mays [maize]
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    184   1e-50    Tarenaya hassleriana [spider flower]
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    185   1e-50    Setaria italica
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             184   1e-50    
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    182   2e-50    Arabis alpina [alpine rockcress]
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    184   2e-50    Zea mays [maize]
emb|CDX98009.1|  BnaA06g07600D                                          184   2e-50    
gb|ACF79301.1|  unknown                                                 184   3e-50    Zea mays [maize]
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                182   3e-50    
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    182   1e-49    Camelina sativa [gold-of-pleasure]
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    180   5e-49    
ref|XP_010266913.1|  PREDICTED: plastocyanin, chloroplastic-like        174   7e-49    Nelumbo nucifera [Indian lotus]
gb|EAY86525.1|  hypothetical protein OsI_07905                          180   9e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          178   3e-48    
emb|CDY13614.1|  BnaA06g33090D                                          174   2e-47    Brassica napus [oilseed rape]
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    176   2e-47    Brassica rapa
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    176   2e-47    Zea mays [maize]
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    176   3e-47    Zea mays [maize]
ref|XP_006378255.1|  hypothetical protein POPTR_0010s05970g             164   5e-47    
emb|CDX83591.1|  BnaC07g23310D                                          171   4e-46    
gb|KEH20758.1|  cellulase (glycosyl hydrolase family 5), putative       156   1e-43    Medicago truncatula
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    163   5e-43    Arabis alpina [alpine rockcress]
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    163   1e-42    Arabis alpina [alpine rockcress]
emb|CDY26627.1|  BnaA09g46500D                                          159   1e-42    Brassica napus [oilseed rape]
emb|CDY38093.1|  BnaC02g06800D                                          150   8e-39    Brassica napus [oilseed rape]
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             151   1e-38    Eutrema salsugineum [saltwater cress]
emb|CDX89335.1|  BnaA01g15580D                                          151   2e-38    
ref|XP_009387704.1|  PREDICTED: uncharacterized protein LOC103974573    144   3e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    150   4e-38    Vitis vinifera
ref|XP_010932263.1|  PREDICTED: uncharacterized protein LOC105052971    143   4e-38    Elaeis guineensis
emb|CDY38091.1|  BnaC02g06820D                                          149   5e-38    Brassica napus [oilseed rape]
ref|XP_008807477.1|  PREDICTED: uncharacterized protein LOC103719832    142   7e-38    Phoenix dactylifera
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    148   1e-37    Camelina sativa [gold-of-pleasure]
emb|CBI34407.3|  unnamed protein product                                147   3e-37    Vitis vinifera
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    147   4e-37    Brassica rapa
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    147   5e-37    Vitis vinifera
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    146   7e-37    Camelina sativa [gold-of-pleasure]
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    146   7e-37    Vitis vinifera
emb|CDX69429.1|  BnaA10g17780D                                          146   9e-37    
emb|CBI34404.3|  unnamed protein product                                146   9e-37    Vitis vinifera
emb|CDY21995.1|  BnaC09g01010D                                          138   2e-36    Brassica napus [oilseed rape]
emb|CBI16819.3|  unnamed protein product                                140   8e-36    Vitis vinifera
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    141   4e-35    
emb|CDX69431.1|  BnaA10g17800D                                          140   6e-35    
gb|KGN50360.1|  hypothetical protein Csa_5G168960                       139   6e-35    Cucumis sativus [cucumbers]
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    139   2e-34    Cucumis melo [Oriental melon]
emb|CDY16991.1|  BnaC09g41180D                                          139   3e-34    Brassica napus [oilseed rape]
ref|XP_009403630.1|  PREDICTED: uncharacterized protein LOC103987145    132   3e-34    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    138   5e-34    Cucumis sativus [cucumbers]
ref|XP_003608279.1|  Endoglucanase                                      137   1e-33    Medicago truncatula
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    136   3e-33    Eucalyptus grandis [rose gum]
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    134   9e-33    Cucumis melo [Oriental melon]
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             133   2e-32    
ref|XP_004151386.1|  PREDICTED: uncharacterized protein LOC101207450    130   6e-32    
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       130   4e-31    Cucumis sativus [cucumbers]
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    129   9e-31    Sesamum indicum [beniseed]
ref|XP_006584934.1|  PREDICTED: uncharacterized protein LOC100811735    125   3e-30    
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   127   3e-30    
gb|ABR17494.1|  unknown                                                 127   5e-30    Picea sitchensis
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    127   7e-30    
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             126   9e-30    Phaseolus vulgaris [French bean]
gb|KHN45741.1|  Endoglucanase                                           126   1e-29    Glycine soja [wild soybean]
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             123   6e-29    
emb|CDX94332.1|  BnaC01g18520D                                          118   7e-29    
ref|XP_004151560.1|  PREDICTED: uncharacterized protein LOC101211788    122   9e-29    
ref|XP_006378254.1|  hypothetical protein POPTR_0010s059501g            115   1e-28    
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    123   1e-28    
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    122   2e-28    Vitis vinifera
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              122   3e-28    Medicago truncatula
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    122   4e-28    
gb|KGN57440.1|  hypothetical protein Csa_3G186670                       120   5e-28    Cucumis sativus [cucumbers]
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    120   1e-27    
emb|CBI34405.3|  unnamed protein product                                122   1e-27    Vitis vinifera
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       120   2e-27    Cucumis sativus [cucumbers]
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    119   4e-27    Cucumis melo [Oriental melon]
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    118   5e-27    
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                118   7e-27    Erythranthe guttata [common monkey flower]
emb|CDP12092.1|  unnamed protein product                                119   1e-26    Coffea canephora [robusta coffee]
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       117   1e-26    Cucumis sativus [cucumbers]
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    115   6e-26    Populus euphratica
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         114   8e-26    Jatropha curcas
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                115   1e-25    Erythranthe guttata [common monkey flower]
ref|XP_003621369.1|  Endoglucanase E1                                   114   1e-25    
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             114   2e-25    
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              113   3e-25    Medicago truncatula
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                113   5e-25    Erythranthe guttata [common monkey flower]
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          113   6e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    112   8e-25    Nicotiana tomentosiformis
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    112   2e-24    Cucumis melo [Oriental melon]
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       110   2e-24    Cucumis sativus [cucumbers]
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    110   4e-24    
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    110   4e-24    Nicotiana sylvestris
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    110   7e-24    
ref|XP_004170742.1|  PREDICTED: uncharacterized protein LOC101225189    108   7e-24    
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             108   1e-23    Eutrema salsugineum [saltwater cress]
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                   107   1e-23    Citrus sinensis [apfelsine]
ref|NP_197172.1|  glycosyl hydrolase family protein                     108   2e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    107   2e-23    Cucumis sativus [cucumbers]
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                107   2e-23    
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       107   4e-23    Cucumis sativus [cucumbers]
ref|XP_004140825.1|  PREDICTED: uncharacterized protein LOC101208873    105   4e-23    
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         107   4e-23    Jatropha curcas
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    107   4e-23    
ref|XP_003621392.1|  Endoglucanase E1                                   107   5e-23    
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              107   5e-23    Medicago truncatula
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                106   1e-22    Erythranthe guttata [common monkey flower]
gb|AFK37776.1|  unknown                                               99.8    1e-22    Lotus japonicus
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    105   1e-22    Cucumis melo [Oriental melon]
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    103   7e-22    Solanum tuberosum [potatoes]
emb|CDY34588.1|  BnaC03g56880D                                          102   8e-22    Brassica napus [oilseed rape]
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    103   8e-22    Cucumis melo [Oriental melon]
emb|CDX85491.1|  BnaA02g03220D                                          100   3e-21    
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            100   4e-21    
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    100   7e-21    Brassica rapa
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    100   8e-21    Brassica rapa
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    100   9e-21    Brassica rapa
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     100   9e-21    Eucalyptus grandis [rose gum]
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                 99.8    1e-20    Citrus sinensis [apfelsine]
gb|AFG68326.1|  hypothetical protein 0_4489_01                        93.2    1e-20    Pinus taeda
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...  99.8    2e-20    Camelina sativa [gold-of-pleasure]
gb|AFG68334.1|  hypothetical protein 0_4489_01                        92.8    2e-20    Pinus taeda
gb|EPS62091.1|  hypothetical protein M569_12701                       99.4    3e-20    Genlisea aurea
gb|AFG68327.1|  hypothetical protein 0_4489_01                        91.3    8e-20    Pinus taeda
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g           95.5    2e-19    
ref|XP_006289055.1|  hypothetical protein CARUB_v10002452mg           94.4    3e-19    
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  96.7    3e-19    
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308  96.3    4e-19    
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704  95.9    4e-19    
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971  94.7    5e-19    
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279  92.0    2e-18    
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...  93.2    4e-18    
emb|CDP16213.1|  unnamed protein product                              92.4    6e-18    
gb|KDP25365.1|  hypothetical protein JCGZ_20521                       91.7    3e-17    
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase            90.1    5e-17    
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285  89.4    6e-17    
ref|XP_003617143.1|  Oligoribonuclease                                90.1    1e-16    
gb|EAY94564.1|  hypothetical protein OsI_16342                        87.0    1e-16    
gb|KCW77463.1|  hypothetical protein EUGRSUZ_D01801                   84.7    1e-15    
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962  85.5    1e-15    
ref|XP_003621368.1|  Endoglucanase                                    80.1    8e-14    
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885  80.1    1e-13    
emb|CDY40992.1|  BnaA02g27820D                                        78.6    2e-13    
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g           78.2    4e-13    
gb|AGT16660.1|  hypothetical protein SHCRBa_026_H12_R_120             75.5    6e-13    
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                  76.3    1e-12    
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                  76.3    1e-12    
gb|EPS64690.1|  hypothetical protein M569_10090                       76.3    1e-12    
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  74.7    6e-12    
ref|XP_010536239.1|  PREDICTED: uncharacterized protein LOC104811274  70.1    3e-11    
gb|KHN26287.1|  hypothetical protein glysoja_050239                   68.9    4e-11    
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255  70.9    1e-10    
gb|KHN41605.1|  hypothetical protein glysoja_038343                   68.9    1e-10    
ref|NP_001173990.1|  Os04g0481050                                     62.0    3e-10    
emb|CDY16990.1|  BnaC09g41170D                                        64.7    3e-10    
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173  67.0    2e-09    
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044  65.9    5e-09    
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113          64.3    1e-08    
gb|KHN04647.1|  Endoglucanase                                         64.3    2e-08    
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...  61.2    2e-07    
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759  57.8    2e-06    
gb|KFH44162.1|  Endoglucanase-like protein                            57.8    2e-06    
dbj|BAD09277.1|  hypothetical protein                                 56.2    2e-06    
emb|CDY40991.1|  BnaA02g27810D                                        53.5    3e-06    
ref|NP_001047320.1|  Os02g0596200                                     56.2    9e-06    
ref|XP_002893942.1|  predicted protein                                55.8    1e-05    
gb|EKG14335.1|  Glycoside hydrolase family 5                          55.1    2e-05    
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                     54.7    2e-05    
ref|XP_002145195.1|  cellulase family protein                         53.9    5e-05    
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase    52.0    2e-04    
ref|XP_007792420.1|  putative cellulase family protein                52.0    2e-04    
ref|XP_007585086.1|  putative cellulase family protein                51.2    3e-04    
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase    50.4    7e-04    
gb|KIY63779.1|  glycoside hydrolase family 5 protein                  50.1    0.001    
ref|XP_001908470.1|  hypothetical protein                             50.1    0.001    
emb|CEJ81391.1|  hypothetical protein VHEMI01518                      50.1    0.001    



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 183/223 (82%), Gaps = 3/223 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYYLREG VGL E YGV+ WNWC+ RN SFL+RIS +QSPF+GPG
Sbjct  339  AAELDFDWALWTLVGSYYLREGVVGLNEVYGVMDWNWCDIRNSSFLKRISTVQSPFQGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
            Y ESR HKLIFHPMTGLCVRR+S FQPLELGPCSESD W YT  K LT+ GTYFCLQA+K
Sbjct  399  YNESRSHKLIFHPMTGLCVRRISFFQPLELGPCSESDAWDYTPTKTLTLTGTYFCLQADK  458

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G+PAKLG+ CT+ +SKW+ ISDS+MHLSSKL+DG+N+CLDVDS NV+ TNTCKCL+ D 
Sbjct  459  SGQPAKLGIMCTNSNSKWQAISDSKMHLSSKLQDGTNLCLDVDSKNVVFTNTCKCLSKDK  518

Query  214  SCDPASQWFKIIDSTRG-TTTKSDFQSTSFLYFLAKKLFASYI  89
            +CDPASQWFKIIDSTR   TTKS FQS     FL      SYI
Sbjct  519  TCDPASQWFKIIDSTRKQNTTKSFFQSKQIAQFLGNTF--SYI  559



>ref|XP_006341815.1| PREDICTED: uncharacterized protein LOC102587665, partial [Solanum 
tuberosum]
Length=425

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 188/225 (84%), Gaps = 3/225 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYYLR+G VGL E+YG+L WNW + RN SFLQRIS++++PF+GPG
Sbjct  201  AAELDFDWALWTLVGSYYLRDGIVGLNEYYGILDWNWFDIRNSSFLQRISVIRTPFQGPG  260

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE-  398
            Y E+R HK+IFHPMTGLCV+R SL QPLELGPCSE++ W Y   KAL V GTYFCLQA+ 
Sbjct  261  YAETRSHKVIFHPMTGLCVQRTSLLQPLELGPCSEAEAWSYAPAKALIVLGTYFCLQADN  320

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN-N  221
            KLG+PAKL + C+DDSSKW+IISDS+MHLSSKL+D ++VCLDVD NNVI+T TCKCL+ N
Sbjct  321  KLGQPAKLSMICSDDSSKWDIISDSKMHLSSKLQDATSVCLDVDPNNVIVTQTCKCLSTN  380

Query  220  DSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLFASYI  89
            D++CDP SQWFKIIDSTR T TTKS  Q    ++FLA+  F SYI
Sbjct  381  DTTCDPGSQWFKIIDSTRATKTTKSFLQIKPIIHFLARNFFGSYI  425



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 187/225 (83%), Gaps = 3/225 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYYLR+G VGL E+YG+L WNW + RN SFLQRIS++++PF+GPG
Sbjct  348  AAELDFDWALWTLVGSYYLRDGIVGLNEYYGILDWNWFDIRNSSFLQRISVIRTPFQGPG  407

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA-E  398
            Y E+R HK+IFHPMTGLCV+R SL QPLELGPCSE++ W Y   KAL V GTYFCLQA +
Sbjct  408  YAETRPHKVIFHPMTGLCVQRTSLLQPLELGPCSEAEAWSYAPAKALIVLGTYFCLQADD  467

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN-N  221
            KLG+PAKLG+ C+DDSSKW+IISDS+MHLSSKL+D ++VCLDVD NNVI+T TCKCLN N
Sbjct  468  KLGQPAKLGMICSDDSSKWDIISDSKMHLSSKLQDATSVCLDVDPNNVIVTQTCKCLNTN  527

Query  220  DSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLFASYI  89
            D++CDP SQWFKIIDSTR T  TKS  Q    + FLA+  F SYI
Sbjct  528  DTTCDPGSQWFKIIDSTRTTKITKSFLQIKPIIQFLARNFFGSYI  572



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 180/223 (81%), Gaps = 3/223 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYYLREG VGL E YGV+ WNWC+ RN SFL RIS +QSPF+GPG
Sbjct  340  AAELDFDWALWTLVGSYYLREGVVGLNEVYGVMDWNWCDIRNSSFLNRISAVQSPFQGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
            Y ESR HKLIFHPMTGLCVRR+S  QPLELGPCSESD W YT  K+LT+ GTYFCLQA+K
Sbjct  400  YNESRSHKLIFHPMTGLCVRRISFLQPLELGPCSESDAWDYTTTKSLTLTGTYFCLQADK  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G+PAKLG+ CT+ +SKW+ ISDS+MHLSSKL+DG+++CLDVDS N I TN CKCL+ D 
Sbjct  460  SGQPAKLGIMCTNSNSKWQAISDSKMHLSSKLQDGTSLCLDVDSKNAIFTNPCKCLSKDK  519

Query  214  SCDPASQWFKIIDSTR-GTTTKSDFQSTSFLYFLAKKLFASYI  89
            +C+P SQWFKIIDSTR   +TKS FQS   + FL      SYI
Sbjct  520  TCEPESQWFKIIDSTRQQNSTKSFFQSEHIVQFLGNTF--SYI  560



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 184/224 (82%), Gaps = 2/224 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWALWTL GSYYLR+G VGL E+YGVL  NW + RN SFL+RIS ++SPF+GPG
Sbjct  339  AAQLDFDWALWTLVGSYYLRDGVVGLNEYYGVLDCNWRDIRNSSFLERISAIRSPFQGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
            YTE+RLHK+IFHP TGLCVRR S  QPLELG CSE+  W Y   K LTV GTYFCLQA+K
Sbjct  399  YTETRLHKVIFHPKTGLCVRRTSFLQPLELGSCSEAAAWRYAPQKTLTVIGTYFCLQADK  458

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN-ND  218
            LG+PAKLG+ C+DDSSKWE ISDS+MHLSSKL+D ++VCLDVDSNNVI+T TCKCL+ ND
Sbjct  459  LGEPAKLGITCSDDSSKWETISDSKMHLSSKLQDATSVCLDVDSNNVIVTQTCKCLSTND  518

Query  217  SSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLFASYI  89
            ++CDP SQWFKIIDSTR T TTKS  Q    + FLA+  F SYI
Sbjct  519  TTCDPGSQWFKIIDSTRVTKTTKSFLQIKPIIRFLARSFFGSYI  562



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   326 bits (835),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 180/223 (81%), Gaps = 3/223 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLREG  G +E YG+  WNWCE RN SF+QRIS +QSPFRGPG
Sbjct  311  AAELDLDWALWTLVGSYYLREGVAGKDESYGIYNWNWCETRNSSFIQRISALQSPFRGPG  370

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +ESR HK+IFHP TGLCV+R SL +PLELGPCSE++ WGY+  K LT++GTY+CLQA+ 
Sbjct  371  VSESRPHKIIFHPATGLCVQRKSLLKPLELGPCSEAEAWGYSPQKTLTIKGTYYCLQADA  430

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LG+PAKLG+ CTD SSKWE ISDS+MHLSSKL DGS VCLDVDSNNV++TN CKCL+ DS
Sbjct  431  LGQPAKLGIICTDKSSKWEAISDSKMHLSSKLCDGSEVCLDVDSNNVVVTNNCKCLSRDS  490

Query  214  SCDPASQWFKIIDSTR-GTTTKSDFQST--SFLYFLAKKLFAS  95
            SCDP SQWFK++DS+R GT++   F     S L+ LAK L  S
Sbjct  491  SCDPGSQWFKLVDSSRHGTSSTKSFSQMDDSILFNLAKTLAES  533



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 179/218 (82%), Gaps = 1/218 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLREG +GL E+YGVL WNWC+ RN SFLQ+IS +QSPF+GPG
Sbjct  339  AAELDLDWALWTLVGSYYLREGVLGLNEYYGVLNWNWCDIRNSSFLQQISALQSPFQGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +ES LHK+IFHP+TGLCV+R S+ +PL+LGPC++S+ W YT  K L+++GTYFCLQA++
Sbjct  399  VSESNLHKVIFHPLTGLCVQRKSMLEPLKLGPCTDSEAWRYTPQKILSLKGTYFCLQADE  458

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKLG+ CTD  SKW++ISDS MHLSSK+ +G+ +CLDVDSNN I+ NTCKCL+ D+
Sbjct  459  LGKPAKLGVICTDSDSKWDVISDSNMHLSSKISNGTTICLDVDSNNTIVINTCKCLSRDN  518

Query  214  SCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFLAKKL  104
            +CDP SQWFK+++STR +T  K  F   S L +  +KL
Sbjct  519  TCDPGSQWFKLVNSTRSSTMAKPSFGINSILDYTKQKL  556



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   306 bits (785),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 176/220 (80%), Gaps = 0/220 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLREG +GL E+YGVL +NWCE RN SF++RIS +QSPFRGPG
Sbjct  337  AAELDLDWALWTLVGSYYLREGVIGLNEYYGVLNYNWCETRNSSFIKRISALQSPFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E++LHK+IFHP TGLCV R S   PL LGPC+ S+ W Y++ K L V+GTYFCLQA++
Sbjct  397  LSETKLHKVIFHPSTGLCVIRKSFLDPLLLGPCANSESWSYSSDKTLVVKGTYFCLQADE  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G  AKLG+FC+D +SKWE+I+DS+MHLSSKL++G ++CLDVDS+N I+TN+CKC++ D+
Sbjct  457  SGTLAKLGIFCSDSNSKWEMIADSKMHLSSKLRNGKSICLDVDSSNAIVTNSCKCISKDN  516

Query  214  SCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFAS  95
            +CDPASQWFK++DSTR  + +  F     ++ L  K F S
Sbjct  517  TCDPASQWFKLVDSTRSRSEEQSFLHFDSIFDLPGKGFPS  556



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLR+G VG+ E+YGVL WNWCE RN +FLQ+IS +QSPFRGPG
Sbjct  340  AAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLNWNWCEARNSTFLQQISALQSPFRGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E+  HK+IFHP TGLCV R S+F+PL LG C+ES+ W YT+ K L+V+GTYFCLQ + 
Sbjct  400  LSEANPHKVIFHPSTGLCVLRKSMFEPLRLGRCTESEAWTYTSQKILSVKGTYFCLQTDD  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPAKLG+ CTD +SKW+ ISDS+MH SS   +G+ VCLDVDS+N I+TNTCKCL+ D+
Sbjct  460  LAKPAKLGIICTDSNSKWQTISDSKMHFSSTASNGTTVCLDVDSDNTIVTNTCKCLSKDN  519

Query  214  SCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFLAKKLFAS  95
            +CDP SQWFK+++STR +T TK   +  S L F AK    S
Sbjct  520  ACDPESQWFKLVNSTRSSTMTKPLSRMNSILNFPAKGFHGS  560



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTLAGSYYLREG +G++E YGVL+WNWC+ RN SF++RIS++QSPF+GPG
Sbjct  339  AAELDFDWALWTLAGSYYLREGKIGMDETYGVLSWNWCKTRNSSFMERISVLQSPFQGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++ R +K+IFHP TGLCV R SLF+PL+LGPC+ES+ W YT  K L ++GTYFC+QA++
Sbjct  399  LSDVRPYKVIFHPSTGLCVLRKSLFEPLKLGPCTESEAWSYTPPKNLLLKGTYFCIQADE  458

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKP KLG+FC+D SSKW++ISDS+MHLSS L DGS VCLDVDS N IIT  CKC++ D 
Sbjct  459  LGKPVKLGIFCSDPSSKWDMISDSKMHLSSTLSDGSTVCLDVDSTNTIITTPCKCVSRDD  518

Query  214  SCDPASQWFKIIDSTR  167
             CDPASQWFKI+ STR
Sbjct  519  KCDPASQWFKIVTSTR  534



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 173/223 (78%), Gaps = 2/223 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L GSYY+REG VG +E YGV  WNWC+ RN + L +IS +Q PFRGPG
Sbjct  350  AAELDVDWALWALTGSYYIREGVVGHDETYGVYNWNWCDVRNQTTLHKISALQYPFRGPG  409

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
            Y+E R HK++FHPMTGLCV+R+S  +PL LGPCSE++ W YT    LT++GTYFCLQA+ 
Sbjct  410  YSERRPHKILFHPMTGLCVKRMSFVEPLVLGPCSEAEAWSYTPQHTLTIKGTYFCLQADA  469

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN-D  218
            LG PAKLG+ CTD +SKWE +SDS+MHLSSKL+DG+NVCLDVDS+N ++ N CKCL+N +
Sbjct  470  LGHPAKLGIICTDSTSKWEAVSDSKMHLSSKLEDGTNVCLDVDSDNNVVMNNCKCLDNKN  529

Query  217  SSCDPASQWFKIIDSTRGTTTKSDF-QSTSFLYFLAKKLFASY  92
            + CDPASQWFK+IDSTR    KS F +  S L  +A    +S+
Sbjct  530  NKCDPASQWFKLIDSTRCGADKSFFLEINSVLKLVANNFLSSF  572



>gb|KJB15656.1| hypothetical protein B456_002G188600 [Gossypium raimondii]
Length=563

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 176/220 (80%), Gaps = 0/220 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLREG +GL E+YGVL +NWCE RN SF++RIS +QSPFRGPG
Sbjct  337  AAELDLDWALWTLVGSYYLREGVIGLNEYYGVLNYNWCETRNSSFIERISALQSPFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E++LHK+IFHP TGLCV R S   PL LGPC++S+ W Y++ K L V+GTYFCLQA++
Sbjct  397  LSETKLHKVIFHPSTGLCVIRKSFLDPLCLGPCADSESWSYSSDKTLVVKGTYFCLQADE  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G   KLG+FC+D +SKWE+I+DS+MHLSSKL++G ++CLDVDS+N I+TN+CKC++ D+
Sbjct  457  SGTLVKLGIFCSDSNSKWEMIADSKMHLSSKLRNGKSICLDVDSSNAIVTNSCKCISKDN  516

Query  214  SCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFAS  95
            +CDPASQWFK++DSTR  + +  F     ++ L  K F S
Sbjct  517  TCDPASQWFKLVDSTRSRSEERSFLHFDSIFDLPGKGFLS  556



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD+DWALWTL GSYYLR+G +GL E+YGVL WNWC+ RN SFLQ+IS +QSPF+GPG
Sbjct  340  AAELDWDWALWTLVGSYYLRQGVIGLNEYYGVLNWNWCDVRNSSFLQQISALQSPFQGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E+  HK+IFHP TGLCV+R S+ +PL LG C++S+ W YT+   LT+ GTYFCLQA++
Sbjct  400  LSETNPHKVIFHPSTGLCVQRKSMLEPLRLGSCTDSEAWRYTSENTLTLRGTYFCLQADE  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKLG+ CTD +SKW++ISDS+MHLSSK+ +G+ VCLDVDSNN I+ +TCKCL+ D+
Sbjct  460  LGKPAKLGIICTDSTSKWDVISDSKMHLSSKITNGTAVCLDVDSNNTIVISTCKCLSRDN  519

Query  214  SCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLF  101
            +CDP SQWFK+++STR + T K   +  S L  L  K F
Sbjct  520  TCDPESQWFKLVNSTRSSATAKPSLRINSILLDLPAKEF  558



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 174/212 (82%), Gaps = 5/212 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLREG VGL E+YG+L WNWCE RN SFL+RIS +QSPFRGPG
Sbjct  337  AAELDLDWALWTLVGSYYLREGVVGLNEYYGILNWNWCEIRNSSFLERISALQSPFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E++LHK+IFHP TGLCV R SL  PL LGPC++S+ W Y+    L V+GTYFCLQA++
Sbjct  397  LSETKLHKVIFHPSTGLCVLRKSLLDPLRLGPCTDSEAWSYSPQNTLVVKGTYFCLQADE  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G  A+LG+ C++ +SKWE+ISDS+MHLSSKL++G+++CLDVDS N I+TN+CKCL+ND+
Sbjct  457  SGTLARLGIICSESNSKWEMISDSKMHLSSKLRNGTSICLDVDSTNTIVTNSCKCLSNDN  516

Query  214  SCDPASQWFKIIDSTRGTTTKSDFQSTSFLYF  119
             CDP SQWFK++DSTR   ++S  +  SFL+F
Sbjct  517  MCDPESQWFKLVDSTR---SRSGVK--SFLHF  543



>gb|KDO82153.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
 gb|KDO82154.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=341

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGPG
Sbjct  116  AAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPG  175

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+ 
Sbjct  176  VFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKH  235

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D 
Sbjct  236  VGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDK  295

Query  214  SCDPASQWFKIID  176
            +CDPASQWFK++D
Sbjct  296  TCDPASQWFKLVD  308



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYY R+G +G+ E+YGVL  NW E RN +FLQ+IS +QSPFRGPG
Sbjct  340  AAELDFDWALWTLVGSYYFRQGVIGMNEYYGVLNSNWRETRNSTFLQQISALQSPFRGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E  LHK+IFHP TGLCV R S+F+PL LGPC++S+ W YT  K L+V+GTYFCLQ ++
Sbjct  400  VSEVHLHKVIFHPSTGLCVLRKSMFEPLRLGPCTQSEAWNYTPQKILSVKGTYFCLQTDE  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPAKLG+ CTD +SKWE ISDS+MHLSSK  +G+ VCLD+  NN I+T+TCKCL+ D+
Sbjct  460  LAKPAKLGIICTDSNSKWEAISDSKMHLSSKAPNGTAVCLDIGYNNTIVTSTCKCLSKDN  519

Query  214  SCDPASQWFKIIDSTR--GTTTKSDFQSTSFLYFLAKKLFASYI  89
            +CDP SQWFK+++STR   T TK     +S L F AK     ++
Sbjct  520  TCDPESQWFKLVNSTRRSSTMTKPSSLISSILNFPAKDFLWKFL  563



>gb|KDO82152.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=414

 Score =   291 bits (745),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGPG
Sbjct  189  AAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPG  248

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+ 
Sbjct  249  VFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKH  308

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D 
Sbjct  309  VGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDK  368

Query  214  SCDPASQWFKIID  176
            +CDPASQWFK++D
Sbjct  369  TCDPASQWFKLVD  381



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLR+G +G+ E+YGVL  NW E RN +FLQ+IS +QSPFRGPG
Sbjct  340  AAELDLDWALWTLVGSYYLRQGVIGMNEYYGVLNSNWRETRNSTFLQQISALQSPFRGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E  LHK+IFHP TGLCV R S+ +PL LGPC++S+ W YT  K L+V+GTYFCLQ ++
Sbjct  400  VSEVHLHKVIFHPSTGLCVLRKSMLEPLRLGPCTKSEAWNYTPQKILSVKGTYFCLQTDE  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPAKLG+ CTD +SKWE ISDS+MHLSSK  +G+ VCLD+ SNN I+TNTCKCL+ D+
Sbjct  460  LAKPAKLGIMCTDSNSKWETISDSKMHLSSKAPNGTPVCLDIGSNNTIVTNTCKCLSKDN  519

Query  214  SCDPASQWFKIIDSTRGTT--TKSDFQSTSFLYFLAKKLFASYI  89
            +CDP SQWFK+++ST  ++  TK     +S L F AK     ++
Sbjct  520  TCDPESQWFKLVNSTTRSSIMTKPSSLISSILNFPAKDFLWKFL  563



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 165/214 (77%), Gaps = 3/214 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYY R+G +G+EEFYG+L+W+W + RN +FL RIS +Q PFRGPG
Sbjct  258  AAELDLDWALWTLVGSYYFRQGVIGMEEFYGILSWDWTQVRNTTFLNRISALQLPFRGPG  317

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             T    +KLIFHP+TGLCV R SL  PL LGPC  SD W YT  K L+++GTYFC+QAE 
Sbjct  318  ITRGNPYKLIFHPLTGLCVIRKSLLDPLTLGPCYLSDGWKYTPQKILSIKGTYFCIQAEN  377

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G PAKLG+ C+D +S+WE+ISDS++HLSSKL D SNVCLDVD NN I+TN CKCL+ D 
Sbjct  378  EGMPAKLGIICSDPNSRWEMISDSKLHLSSKLSDDSNVCLDVDDNNNIVTNACKCLSRDR  437

Query  214  SCDPASQWFKIIDSTRG---TTTKSDFQSTSFLY  122
            +CDP+SQWFK+IDS R    TT+ S   ++S LY
Sbjct  438  TCDPSSQWFKLIDSGRRSMLTTSTSSMLNSSDLY  471



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGPG
Sbjct  345  AAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPG  404

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+ 
Sbjct  405  VFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKH  464

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D 
Sbjct  465  VGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDK  524

Query  214  SCDPASQWFKIID  176
            +CDPASQWFK++D
Sbjct  525  TCDPASQWFKLVD  537



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGPG
Sbjct  345  AAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPG  404

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+ 
Sbjct  405  VFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKH  464

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D 
Sbjct  465  VGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDK  524

Query  214  SCDPASQWFKIID  176
            +CDPASQWFK++D
Sbjct  525  TCDPASQWFKLVD  537



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGPG
Sbjct  363  AAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPG  422

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+ 
Sbjct  423  VFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKH  482

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D 
Sbjct  483  VGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDK  542

Query  214  SCDPASQWFKIID  176
            +CDPASQWFK++D
Sbjct  543  TCDPASQWFKLVD  555



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 167/218 (77%), Gaps = 1/218 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTL GSYY R+G +G+EEFYG+L W+W + RN+SF+QRI+ +Q PF+GPG
Sbjct  337  AADLDLDWALWTLVGSYYFRQGVIGMEEFYGILNWDWTQLRNISFIQRIASLQLPFQGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             TE   HKLIFHP+TGLCV R SL +PL LGPCS SD W Y+  K L+++GTYFC+QA+K
Sbjct  397  ITEGSPHKLIFHPLTGLCVIRKSLVEPLMLGPCSLSDGWNYSPQKTLSIKGTYFCIQAQK  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G PA L + C+D +S W++ISDS++HLSS + +G+ VCLDVD NNVI+TN CKCL+ND 
Sbjct  457  QGVPAILSIMCSDPNSIWDMISDSKLHLSSNINNGTKVCLDVDDNNVIVTNACKCLSNDH  516

Query  214  SCDPASQWFKIIDSTRG-TTTKSDFQSTSFLYFLAKKL  104
            +CDPASQWFK+IDS R   +T S     + L    K+L
Sbjct  517  TCDPASQWFKLIDSGRRLISTTSTLSELNLLELFMKRL  554



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYY REG +GLEEFYG+L WNWCE RN SFLQRIS +QSPF+GP 
Sbjct  335  AAELDFDWALWTLVGSYYTREGVIGLEEFYGLLNWNWCEVRNSSFLQRISALQSPFQGPD  394

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +++R HK+IFHP TGLC+   S+F+PL LGPC ESD W YT  K L ++ TYFCLQA+ 
Sbjct  395  LSDARPHKVIFHPATGLCIVWKSVFEPLTLGPCPESDAWSYTPQKTLIMKETYFCLQADG  454

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G P KLG+ CT+  SKWE ISDS+MHLS+KL DG+ VCLD+DS+N I+TN CKCL+ D+
Sbjct  455  PGNPGKLGIICTEPGSKWESISDSKMHLSTKLGDGTTVCLDIDSSNNIVTNACKCLSGDN  514

Query  214  SCDPASQWFKIIDSTRGTT  158
             CDP SQWFKI+++T  +T
Sbjct  515  KCDPGSQWFKIVNATNIST  533



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYYLR+G VG+ E+YGVL  +W E RN +FLQ IS +QSPFRGPG
Sbjct  340  AAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLNLDWREVRNSTFLQLISAIQSPFRGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E+  HK+IFHP TGLCV R S+  PL LG C+ES+ W YT  K L+V+GTYFCLQ + 
Sbjct  400  LSEANPHKVIFHPSTGLCVLRKSMLAPLRLGRCAESEAWSYTPQKILSVKGTYFCLQTDD  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            + KPAKLG+ CTD +SKWE ISDS+MHLSS    G+ VCLD+DSNN I+TNTCKCL+ D+
Sbjct  460  VAKPAKLGIICTDSNSKWETISDSKMHLSSNASSGTTVCLDIDSNNTIVTNTCKCLSKDN  519

Query  214  SCDPASQWFKIIDSTRGTT  158
            +CDP SQWFK+++STR +T
Sbjct  520  ACDPESQWFKLVNSTRSST  538



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYY R+G VG+ E+YGVL W+W E RN S LQ+IS +Q PF+GPG
Sbjct  344  AAELDLDWALWTLVGSYYFRQGVVGMNEYYGVLNWDWNEIRNASVLQKISAIQYPFQGPG  403

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+R HK+IFHP TGLCV R S    L LGPCS+SD W YT  K L ++GTYFCLQ + 
Sbjct  404  LAETRKHKIIFHPSTGLCVVRKSFTDALTLGPCSKSDGWYYTPQKILEIKGTYFCLQVDD  463

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPA+LG+ C +  SKWEIISDS++HL++K   G+ VCLDVDSNNV++TN CKCL+ DS
Sbjct  464  VGKPARLGIICMESDSKWEIISDSKLHLAAKTSSGTTVCLDVDSNNVVVTNLCKCLSRDS  523

Query  214  SCDPASQWFKIIDSTR  167
            SCDP SQWF+++D+TR
Sbjct  524  SCDPGSQWFQLVDTTR  539



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D D+ALWTL GSYYLR+G VG+EE+YG+L W+W + RN S  QR+S++QSP +GPG
Sbjct  335  AAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILNWDWSDIRNSSLTQRLSVLQSPLQGPG  394

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              +SR+HK+IFHP TGLC+ +V    PL+LGPCS+S  W Y++ K LT++GTYFC+QA+K
Sbjct  395  LAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWAYSSRKVLTLKGTYFCIQADK  454

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPA +G+ CT  +S+W+IISDS++HL SK  DG+ VCLDVDS+N ++TN+C CL+ DS
Sbjct  455  LNKPAAVGIJCTTRNSQWDIISDSKLHLQSKTMDGTEVCLDVDSSNTVVTNSCNCLSRDS  514

Query  214  SCDPASQWFKIIDSTRGTTTKS  149
            SCDP +QWFK++DST  ++ KS
Sbjct  515  SCDPGNQWFKLVDSTINSSPKS  536



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALWTL GSYY R+G VG+EEFYG+L W+W + RN SFL RIS +Q PFRGPG
Sbjct  344  AAEHDLDWALWTLVGSYYFRQGVVGMEEFYGILNWDWNQVRNASFLNRISSLQLPFRGPG  403

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             T+   +KLI+HP+TGLCV R +L +PL LGPC+ SD W YT  K L+V+GTYFC+ AE 
Sbjct  404  ITKGNPYKLIYHPLTGLCVIRKTLLEPLTLGPCNLSDGWKYTPQKILSVKGTYFCIHAEN  463

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G  A LG+ C+D +S+WE++SDS++HLSSKL DGS+VCLDVD NN+I+TN CKCL+ D 
Sbjct  464  EGMAATLGIICSDSNSRWEMVSDSKLHLSSKLSDGSDVCLDVDDNNIIVTNACKCLSRDH  523

Query  214  SCDPASQWFKIIDSTR  167
            +CDP+SQWFK+IDS R
Sbjct  524  TCDPSSQWFKLIDSGR  539



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD D++LWTL GSYY REG VG EE+YG+L W+W + RN S  QR+S++QSP +GPG
Sbjct  335  AAELDVDFSLWTLVGSYYFREGVVGTEEYYGILNWDWSDIRNSSLTQRLSVLQSPLQGPG  394

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++SR+HK+IFHP TGLC+ +V    PL+LGPCS+S  W Y++ K LT++GTYFC+QA++
Sbjct  395  LSQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWTYSSRKVLTLKGTYFCIQADE  454

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPA +G+ CT  +S+W+IISDS++HL SK  DG+ VCLDVDS+N ++T++CKCL+ D+
Sbjct  455  LNKPAAVGILCTTTNSQWDIISDSKLHLQSKTTDGTEVCLDVDSSNTVVTSSCKCLSRDN  514

Query  214  SCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFL  116
            SCDPASQWFK++DST  TT T    + TS ++ +
Sbjct  515  SCDPASQWFKLVDSTINTTPTSPILEITSVVHMI  548



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 165/222 (74%), Gaps = 0/222 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWALWTL GSYYLREG VG+ E+YG L  NW E RN S  QR   +Q P +GPG
Sbjct  337  AADLDFDWALWTLVGSYYLREGVVGMIEYYGALDENWAELRNSSLFQRFRALQPPLKGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E+  HK+IFHP TGLCV R SL +P++LGPC+ES+ W YT  K L+++ TYFC+QA +
Sbjct  397  LSETTPHKVIFHPATGLCVLRKSLLEPMKLGPCTESEAWNYTPQKVLSLKATYFCIQAVE  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +GKPAKLG+ CT  +SKW+IIS+S+MHLSS   +G++VCLDVDS+N I+T++CKCL+ DS
Sbjct  457  VGKPAKLGIICTGSNSKWDIISESKMHLSSNTSNGASVCLDVDSDNTIVTSSCKCLSRDS  516

Query  214  SCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  89
             CDP+SQWFK+++STR       F   + +  L +K    ++
Sbjct  517  KCDPSSQWFKLVESTRSLCATRTFDLLNSILDLPRKGLVGFL  558



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AELD DWA WTL GSYY REG +G+EEFYG+LTW+W + R+ SFL RIS +Q PFRGPG
Sbjct  313  VAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQVRSTSFLNRISALQIPFRGPG  372

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E   +KLIFHP+TGLCV   S    L LGPCS SD W YT  K L +  T FC+ AE+
Sbjct  373  IIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCSSSDAWTYTPQKTLLINNTNFCIHAEQ  432

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             GKPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+T  CKCLN D 
Sbjct  433  EGKPATLSITCSDANSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTTACKCLNQDK  492

Query  214  SCDPASQWFKIIDSTR  167
            +CDPASQWFK+IDS R
Sbjct  493  TCDPASQWFKLIDSGR  508



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AELD DWA WTL GSYY REG +G+EEFYG+LTW+W + R+ SFL RIS +Q PFRGPG
Sbjct  354  VAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQVRSTSFLNRISALQIPFRGPG  413

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E   +KLIFHP+TGLCV   S    L LGPCS SD W YT  K L +  T FC+ AE+
Sbjct  414  IIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCSSSDAWTYTPQKTLLINNTNFCIHAEQ  473

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             GKPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+T  CKCLN D 
Sbjct  474  EGKPATLSITCSDANSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTTACKCLNQDK  533

Query  214  SCDPASQWFKIIDSTR  167
            +CDPASQWFK+IDS R
Sbjct  534  TCDPASQWFKLIDSGR  549



>gb|KHN29015.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=826

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYY R+G +G+EEFYG+L+W+W + RN +FL RIS +Q PFRGPG
Sbjct  608  AAELDLDWALWTLVGSYYFRQGVIGMEEFYGILSWDWIQVRNTTFLNRISALQLPFRGPG  667

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             T    +KLIFHP+TGLCV R SL   L LGPC  SD W YT  K L+++GTYFC+QAE 
Sbjct  668  ITRGNPYKLIFHPLTGLCVIRKSLLDRLTLGPCYLSDGWKYTPQKILSIKGTYFCMQAES  727

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G PA LG+ C+D +S+WE+ISDS++HLSSKL D SNVCLDVD NN I+TN CKCL+ D 
Sbjct  728  EGMPATLGIMCSDPNSRWEMISDSKLHLSSKLSDDSNVCLDVDDNNNIVTNACKCLSKDR  787

Query  214  SCDPASQWFKIIDSTRGTTTKSDFQSTSFLY  122
            +CDP+SQWFK+IDS  G+ +     ++S LY
Sbjct  788  TCDPSSQWFKLIDS--GSRSMLTTSTSSMLY  816



>ref|XP_004309996.1| PREDICTED: uncharacterized protein LOC101307271 [Fragaria vesca 
subsp. vesca]
Length=550

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 164/219 (75%), Gaps = 1/219 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD ++ALWTL GSYYLR G +G+ E+YG+L WNW E RN S LQR+S++QSPF+GPG
Sbjct  332  AAQLDVEYALWTLVGSYYLRSGVLGMNEYYGLLNWNWGEIRNSSLLQRLSVLQSPFQGPG  391

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E R HK+I HP TGLC+ +V    PL+LGPCS+S  W Y++ K L ++GTYFC+QA++
Sbjct  392  LSEVRKHKIILHPSTGLCLLKVGFMGPLKLGPCSQSGAWSYSSRKVLALKGTYFCIQADQ  451

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPA +G+ CTD +S+W+ ISDS++HL SK  DG+ VCLDVDS+N I+TN+CKCL+ D 
Sbjct  452  LGKPAAVGIICTDTNSQWDTISDSKLHLQSKTPDGTEVCLDVDSSNTIVTNSCKCLSKDK  511

Query  214  SCDPASQWFKIIDSTRGTTTKSD-FQSTSFLYFLAKKLF  101
            SCDP SQWF ++DST  + + S   Q  S L  L   + 
Sbjct  512  SCDPGSQWFSLVDSTLTSKSTSPILQVNSVLDMLGMNVL  550



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 1/194 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTL GSYY R+G +G+EEFYG+  W+W + RN SFLQRI+ +Q PF+GPG
Sbjct  336  AAELDLDWALWTLVGSYYFRQGVIGMEEFYGIFNWDWTQVRNASFLQRIASLQLPFQGPG  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             T    HKL+FHP TGLCV R SL +PL+L PCS SD W YT  K L+V+GTYFC+QA K
Sbjct  396  ITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCSLSDGWNYTPQKILSVKGTYFCIQAVK  455

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGS-NVCLDVDSNNVIITNTCKCLNND  218
             G PA L + C++ +SKW++ISDS++HLSSK+  GS NVCLDV+ NN+I+TN CKCL+ND
Sbjct  456  EGMPATLSILCSNPNSKWDMISDSKLHLSSKINSGSTNVCLDVNDNNIIVTNACKCLSND  515

Query  217  SSCDPASQWFKIID  176
             SCDP SQWFK+ID
Sbjct  516  HSCDPGSQWFKLID  529



>ref|XP_004170960.1| PREDICTED: uncharacterized LOC101217177, partial [Cucumis sativus]
Length=421

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWA+WTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS +QSPF+GPG
Sbjct  199  AAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQSPFQGPG  258

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E R + +IFHP++GLCV R SL  PL LGPC ++D W YT  K LT++GTYFC+QA++
Sbjct  259  LAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQKFLTLKGTYFCIQADE  318

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNND  218
            +GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVDS+ N I+TN+CKCL+ D
Sbjct  319  IGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDSSTNEIVTNSCKCLSRD  378

Query  217  SSCDPASQWFKIIDSTR  167
            SSCDP+SQWFK+++STR
Sbjct  379  SSCDPSSQWFKLVNSTR  395



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   272 bits (696),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALWTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS++Q+P +GPG
Sbjct  330  AAEFDLDWALWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISVLQTPLQGPG  389

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E R + LIFHP++GLCV R SL  PL LGPC +SD W YT  K LT++GTYFC+QA++
Sbjct  390  LAERREYNLIFHPLSGLCVVRKSLLDPLRLGPCVDSDAWYYTPQKFLTLKGTYFCIQADE  449

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNND  218
            +GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVD+N N I+TN+CKCL+ D
Sbjct  450  IGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDANTNEIVTNSCKCLSRD  509

Query  217  SSCDPASQWFKIIDSTR  167
            SSCDP+SQWFK+++STR
Sbjct  510  SSCDPSSQWFKLVNSTR  526



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A+LD DWALWTL G+YY+R+G VG+EE++G+L  +W + RN SFLQRIS +Q PF+GPG
Sbjct  258  VAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILNSDWIQVRNTSFLQRISAIQLPFKGPG  317

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPL-ELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
             +E++ +K+IFHP+TGLC+ R S  +PL  LGPCS SD W YT  K L+++GTYFCLQAE
Sbjct  318  LSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPCSNSDAWEYTDQKILSIKGTYFCLQAE  377

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
            + GK AKLG  C+  +S+WE+ISDS+MHLS++  + S VCLDVD+NN+I+TN C+CL+ D
Sbjct  378  EEGKQAKLGNACSGSNSRWEMISDSKMHLSTQTNNASGVCLDVDTNNIIVTNICQCLSKD  437

Query  217  SSCDPASQWFKIIDSTR  167
            ++CDPA+QWFK++DSTR
Sbjct  438  NTCDPATQWFKLVDSTR  454



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWA+WTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS +QSPF+GPG
Sbjct  327  AAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQSPFQGPG  386

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E R + +IFHP++GLCV R SL  PL LGPC ++D W YT  K LT++GTYFC+QA++
Sbjct  387  LAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQKFLTLKGTYFCIQADE  446

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNND  218
            +GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVDS+ N I+TN+CKCL+ D
Sbjct  447  IGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDSSTNEIVTNSCKCLSRD  506

Query  217  SSCDPASQWFKIIDSTR  167
            SSCDP+SQWFK+++STR
Sbjct  507  SSCDPSSQWFKLVNSTR  523



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWA+WTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS +QSPF+GPG
Sbjct  328  AAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQSPFQGPG  387

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E R + +IFHP++GLCV R SL  PL LGPC ++D W YT  K LT++GTYFC+QA++
Sbjct  388  LAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQKFLTLKGTYFCIQADE  447

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNND  218
            +GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVDS+ N I+TN+CKCL+ D
Sbjct  448  IGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDSSTNEIVTNSCKCLSRD  507

Query  217  SSCDPASQWFKIIDSTR  167
            SSCDP+SQWFK+++STR
Sbjct  508  SSCDPSSQWFKLVNSTR  524



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A+LD DWALWTL G+YY+R+G VG+EE++G+L  +W + RN SFLQRIS +Q PF+GPG
Sbjct  338  VAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILNSDWIQVRNTSFLQRISAIQLPFKGPG  397

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPL-ELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
             +E++ +K+IFHP+TGLC+ R S  +PL  LGPCS SD W YT  K L+++GTYFCLQAE
Sbjct  398  LSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPCSNSDAWEYTDQKILSIKGTYFCLQAE  457

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
            + GK AKLG  C+  +S+WE+ISDS+MHLS++  + S VCLDVD+NN+I+TN C+CL+ D
Sbjct  458  EEGKQAKLGNACSGSNSRWEMISDSKMHLSTQTNNASGVCLDVDTNNIIVTNICQCLSKD  517

Query  217  SSCDPASQWFKIIDSTR  167
            ++CDPA+QWFK++DSTR
Sbjct  518  NTCDPATQWFKLVDSTR  534



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 151/215 (70%), Gaps = 4/215 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AELD DWA WTL GSYY REG +G+EEFYG+LTW+W + R+ SFL RIS +Q PFRGPG
Sbjct  351  VAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWNQVRSTSFLNRISALQIPFRGPG  410

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E   HKLIFHP+TGLCV   S    L L  CS SD W YT  K L V  T FC+ AE+
Sbjct  411  IIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACSSSDAWTYTPQKTLLVNNTDFCIHAEE  470

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
              KPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+TN CKCL+ D 
Sbjct  471  ERKPATLSMTCSDPNSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTNACKCLSKDK  530

Query  214  SCDPASQWFKIIDSTR----GTTTKSDFQSTSFLY  122
            +CDP SQWFK+IDS R     T+T S   S   L+
Sbjct  531  TCDPGSQWFKLIDSGRRSISTTSTLSMLNSPDLLW  565



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTL GSYY+R+G VG+ E YG+L  +W E  N SFLQRIS +Q PFRGPG
Sbjct  333  AAQLDLDWALWTLGGSYYIRKGVVGMNESYGILNSDWSEVSNPSFLQRISAIQIPFRGPG  392

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E++  K+IFHP+TG C+ R SL + L LGPCS SD W YT    L+++GT FCLQAE 
Sbjct  393  LSEAKPFKVIFHPLTGFCIIRKSLVEALRLGPCSNSDGWEYTEQNILSIKGTNFCLQAEG  452

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             GK AK+G  C   +S+WE+ISDS+MHLS+++ + S +CLDVD+NN+I+TNTCKCL+ D+
Sbjct  453  EGKQAKIGNICLAPNSRWEMISDSKMHLSTQINNSSGLCLDVDNNNIIVTNTCKCLSKDN  512

Query  214  SCDPASQWFKIIDSTR  167
            +C+PASQWFK++DSTR
Sbjct  513  TCEPASQWFKVVDSTR  528



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD D+ALWTL GSYYL++G +G+ E+YGVL W+W + RN S  QR+S++QSPF+GPG
Sbjct  380  AAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLNWDWSDVRNSSLSQRLSVLQSPFQGPG  439

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++SRLHK+IFHP TGLC+ +V    PL+LG CS+S  W Y++ K LT++GTYFC+Q ++
Sbjct  440  LSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCSQSGAWSYSSKKILTLKGTYFCIQVDE  499

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPA++G+ CT  +S+W+ ISDS +HLSSK  DG++VCLDVDS+N I+T++CKCL  DS
Sbjct  500  LEKPAQVGIICTTPNSQWDTISDSGLHLSSKTLDGTDVCLDVDSSNTIVTSSCKCLGRDS  559

Query  214  SCDPASQWFKIID  176
            SCDP SQWFK++D
Sbjct  560  SCDPESQWFKLVD  572



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 151/215 (70%), Gaps = 4/215 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AELD DWA WTL GS+Y REG +G+EEFYG+L+W+W + R+ SFL RIS +Q PFRGPG
Sbjct  346  VAELDLDWAYWTLVGSHYFREGVIGMEEFYGLLSWDWNQVRSTSFLNRISALQIPFRGPG  405

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E   HKLIFHP+TGLCV   S    L L  CS SD W YT  K L V  T FC+ AE+
Sbjct  406  IIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACSSSDAWTYTPQKTLLVNNTDFCIHAEE  465

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
              KPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+TN CKCL+ D 
Sbjct  466  ERKPATLSMTCSDPNSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTNACKCLSKDK  525

Query  214  SCDPASQWFKIIDSTR----GTTTKSDFQSTSFLY  122
            +CDP SQWFK+IDS R     T+T S   S   L+
Sbjct  526  TCDPGSQWFKLIDSGRRSISTTSTLSMLNSPDLLW  560



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 153/208 (74%), Gaps = 4/208 (2%)
 Frame = -2

Query  733  WALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLH  554
            WA WTL GSYY+REG VG+EE YGVLTW+W + R++SFL RIS +Q PFRGPG  E   +
Sbjct  360  WAYWTLVGSYYIREGVVGMEEVYGVLTWDWNQVRSISFLNRISALQHPFRGPGIIEGNSY  419

Query  553  KLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKL  374
            KL+FHP+TGLCV R S    L LGPCS SD W YT+ K+L V  T  C+  E+  KPA L
Sbjct  420  KLMFHPVTGLCVIRKSQVNTLTLGPCSSSDGWKYTSQKSLLVNDTNLCIHGERERKPATL  479

Query  373  GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQ  194
               C+D SSKWE+ISDS MHLSSKL DGSNVCLDVD++N+I+TNTCKCL+ D+ CDP +Q
Sbjct  480  STACSDSSSKWEVISDSNMHLSSKLSDGSNVCLDVDADNIIVTNTCKCLSKDNKCDPGTQ  539

Query  193  WFKIIDSTR----GTTTKSDFQSTSFLY  122
            WFK+IDS R     T+T S   S++ L+
Sbjct  540  WFKLIDSGRRSISTTSTMSILDSSNLLW  567



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD D+ALWTL GSYYL++G +G+ E+YGVL W+W + RN S  QR+S++QSPF+GPG
Sbjct  343  AAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLNWDWSDIRNSSLSQRLSVLQSPFQGPG  402

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++SRLHK+IFHP TGLC+ +V    PL+LG CS+S  W Y++ K L+++GTYFC+QA++
Sbjct  403  LSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCSQSGAWSYSSKKILSLKGTYFCIQADE  462

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPA++G+ CT  +S+W+ ISDS +HLSSK  +G++VCLDVDS+N I+ ++CKCL  DS
Sbjct  463  LEKPAQVGIICTTPNSQWDTISDSGLHLSSKTLNGTDVCLDVDSSNTIVASSCKCLGRDS  522

Query  214  SCDPASQWFKIID  176
            SCDP SQWFK++D
Sbjct  523  SCDPESQWFKLVD  535



>gb|EPS61076.1| hypothetical protein M569_13724, partial [Genlisea aurea]
Length=411

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALWTLAGSYYLREG VG  E YGV +++W + RN + L +I+ +Q PFRGPG
Sbjct  201  AAEQDLDWALWTLAGSYYLREGVVGYNETYGVYSFDWNQIRNGTILSKIASLQYPFRGPG  260

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
            Y E  +HK++FHP TGLCV+R SL   L LGPC E++ W  T  K LTV+GT FCL+A++
Sbjct  261  YEEVPVHKVLFHPSTGLCVKRASLLDALALGPCVEAEAWSNTTEKTLTVDGTPFCLEADE  320

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN-D  218
             GKPAKL + C   ++KWE ISDS+MHLS+ L+DGS VCL +DS+N IIT++CKCL++ +
Sbjct  321  SGKPAKLSVICDGQNTKWETISDSKMHLSATLEDGSKVCLSIDSDNNIITDSCKCLDDTN  380

Query  217  SSCDPASQWFKIIDSTR  167
            S+CDP +QWFKIIDSTR
Sbjct  381  STCDPGNQWFKIIDSTR  397



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD D+ALWTL GSYYLR+G +G+ E+YGVL  +W + RN S  QR+S++QSPF+GP 
Sbjct  341  AAELDLDFALWTLVGSYYLRDGVLGMNEYYGVLNSDWSDIRNSSLSQRLSVLQSPFQGPD  400

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQA  401
             ++S  HK+IFHP TGLC+ +V    PL+LGPCS+S PW Y++   K LT++G+Y CLQ 
Sbjct  401  ISQSSWHKIIFHPATGLCLVQVGQLAPLKLGPCSQSGPWIYSSQTQKFLTLQGSYLCLQV  460

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
            ++L KPAKLG+ C   +S+W+ ISDS +HLSSK  +G+NVCLDVDS+N I+TN+CKCL+ 
Sbjct  461  DELEKPAKLGVICRPPNSQWDTISDSGLHLSSKTLNGTNVCLDVDSSNTIVTNSCKCLSR  520

Query  220  DSSCDPASQWFKIIDSTR  167
            DSSC+P SQWFK++DSTR
Sbjct  521  DSSCNPESQWFKLVDSTR  538



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 154/211 (73%), Gaps = 3/211 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AELD DWALWTL GSYYLREG +GL E+YG++ WNW + RN SF++RIS +QSPFRG G
Sbjct  277  VAELDLDWALWTLVGSYYLREGVIGLNEYYGIMDWNWIDMRNSSFVERISALQSPFRGLG  336

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +E+ LHK+IFHP+TGLCV R      L LGPC++S+ W Y+  K L ++GT  CLQA++
Sbjct  337  LSETELHKVIFHPLTGLCVLRKQSGSSLSLGPCTDSEAWNYSPQKTLELKGTQLCLQADE  396

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G   KLG  C   +S+WE ISDS+MHLS KL + ++VC+D+DSNN ++   CKCLN+DS
Sbjct  397  PGTMVKLGTICGGSNSRWETISDSKMHLSLKLGNVTSVCMDIDSNNNVVVADCKCLNDDS  456

Query  214  SCDPASQWFKIIDSTR---GTTTKSDFQSTS  131
             CDP SQWFK+++STR   G  +  DF S +
Sbjct  457  QCDPKSQWFKLVNSTRSGNGGNSFVDFDSIT  487



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 158/204 (77%), Gaps = 2/204 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L GSYY+REG  GL+E YGVL W+WC+ RN S LQRI  +Q+PF+GPG
Sbjct  336  AAELDLDWALWALQGSYYIREGIRGLDEVYGVLAWDWCKTRNSSMLQRIQAIQAPFQGPG  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++ + + +IFHP TGLCV + SLF+PLELGPC+ES+ W ++A + + ++ T  CL+A+ 
Sbjct  396  LSDIQPYTIIFHPSTGLCVLKKSLFEPLELGPCNESEAWTFSAEQTIALKDTLLCLKADG  455

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSN-NVIITNTCKCLNN  221
             GKPAKLG+ C+D  SKWE+ISDS+MH+S+ +  + S++CLDVDS+   I+TN CKCL+ 
Sbjct  456  AGKPAKLGIICSDTQSKWELISDSKMHVSTNISSNASSLCLDVDSDGKSIVTNPCKCLSK  515

Query  220  DSSCDPASQWFKIIDSTRGTTTKS  149
            D SCDP SQWFK++DSTR T  K+
Sbjct  516  DQSCDPESQWFKMVDSTRPTIYKN  539



>gb|KJB78033.1| hypothetical protein B456_012G173600 [Gossypium raimondii]
Length=579

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 153/218 (70%), Gaps = 0/218 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AELD DWALWTL GSYYLREG +G  E+YG+L WNW + RN SF++RIS +QSPFRG G
Sbjct  332  VAELDLDWALWTLVGSYYLREGVIGFNEYYGILDWNWIDMRNSSFVERISALQSPFRGLG  391

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E+ LHK+IFHP+TGLCV R      L LGPC++S+ W Y+  K L ++GT  CLQA++
Sbjct  392  LLETELHKVIFHPLTGLCVLRKPSGSSLSLGPCTDSEAWNYSPQKTLELKGTQLCLQADE  451

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             G   KLG  C   +S+WE ISDS+MHLS KL + ++VC+D+DSNN I+   CKCLN+DS
Sbjct  452  PGTMVKLGTICGGSNSRWETISDSKMHLSLKLGNVTSVCMDIDSNNDIVVAGCKCLNDDS  511

Query  214  SCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLF  101
             CDP SQWFK+++STR     + F     +    K++F
Sbjct  512  QCDPKSQWFKLVNSTRSGNGGNSFVDFDSITDFGKRVF  549



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD+DWALWTL G YYLR+G VG++E YGVL+W+W   RN +F+Q+IS +QSPF+GPG
Sbjct  332  AAQLDWDWALWTLVGRYYLRQGVVGMDETYGVLSWDWNNIRNSTFVQQISALQSPFQGPG  391

Query  574  YT-ESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
             + E   HK+IFHP TGLCV R SL  + L+LG C+ES+ W YT  K L+++ T  CLQA
Sbjct  392  LSSEVTPHKVIFHPSTGLCVVRKSLMMELLKLGSCTESEAWSYTPEKTLSLKDTNLCLQA  451

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLN  224
            ++LG+ AKLG+ C+D SS+W++ISDS+MH+SS L +GS VC+DVDSN N IIT+ CKCL 
Sbjct  452  DELGEAAKLGIICSDLSSRWDMISDSKMHISSNLTNGSTVCIDVDSNTNTIITSQCKCLT  511

Query  223  NDSSCDPASQWFKIIDSTRGTT  158
             D +CDP+ QWF I++STR TT
Sbjct  512  KDHTCDPSGQWFIIVNSTRSTT  533



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DWALWTLAGSYY+ +G  G+EE YG+L  +W +PRN +FLQR++ +Q PFRGPG
Sbjct  335  AADQDLDWALWTLAGSYYINQGVFGVEEVYGILNSDWTKPRNPTFLQRLASLQLPFRGPG  394

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             T+ + +KLI+HP+TGLCV R S  QPL+L  CS S+ W Y   K L++  +++C+QA  
Sbjct  395  ITQGKPYKLIYHPLTGLCVARKSKLQPLKLNACSYSNGWNYKPQKTLSIYRSHYCIQAMN  454

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
             GKPA +   C    S W++ISDS +HLS+ + +G+NVCLDVD NNVI+TN CKCL+NDS
Sbjct  455  QGKPAIISKSC----STWDMISDSTLHLSTNINNGTNVCLDVDHNNVIVTNACKCLSNDS  510

Query  214  SCDPASQWFKIIDSTR  167
            +CDPASQWFK+IDS +
Sbjct  511  TCDPASQWFKLIDSGK  526



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L GSYY+REG +GL+E YG L+W+WC+ RN SF+QR+S +QSPF+GPG
Sbjct  340  AAEKDIDWALWALQGSYYIREGQLGLDETYGALSWDWCKARNSSFIQRLSAIQSPFQGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++S  + +IFHP TGLC+   S  + L+LG C+ES  W YT  K L ++GT +CLQ E 
Sbjct  400  LSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCAESTAWRYTRQKKLMLKGTKYCLQPEG  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNND  218
            + KPAKLG  C   S+KW +IS S+MH+SS L  +G+NVCLD+D N  I+TN CKCL+ D
Sbjct  460  VSKPAKLGFGCKVSSAKWHLISSSKMHISSNLTNNGNNVCLDIDDNGTIMTNQCKCLSLD  519

Query  217  SSCDPASQWFKIIDSTR  167
             +C+P SQWFKII S+R
Sbjct  520  GTCNPGSQWFKIIRSSR  536



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L GSYY+REG +GL+E YG L+W+WC+ RN SF+QR+S +QSPF+GPG
Sbjct  340  AAEKDIDWALWALQGSYYIREGQLGLDETYGALSWDWCKARNSSFIQRLSAIQSPFQGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             ++S  + +IFHP TGLC+   S  + L+LG C+ES  W YT  K L ++GT +CLQ E 
Sbjct  400  LSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCAESTAWRYTRQKKLMLKGTKYCLQPEG  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNND  218
            + KPAKLG  C   S+KW +IS S+MH+SS L  +G+NVCLD+D N  I+TN CKCL+ D
Sbjct  460  VSKPAKLGFGCKVSSAKWHLISSSKMHISSNLTNNGNNVCLDIDDNGTIMTNQCKCLSLD  519

Query  217  SSCDPASQWFKIIDSTR  167
             +C+P SQWFKII S+R
Sbjct  520  GTCNPGSQWFKIIRSSR  536



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 154/211 (73%), Gaps = 2/211 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L G+YY+REG +GL+E YGVL W+WC+ RN S LQRI  +Q+PF+GPG
Sbjct  312  AAELDLDWALWALQGNYYVREGNLGLDEVYGVLAWDWCKIRNSSMLQRIQSIQAPFQGPG  371

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  + + +IFHP TGLCV + SLF+PL LGPC+ES+ W +TA + + ++ T  CL+A+ 
Sbjct  372  LSSMQPYTIIFHPSTGLCVLKKSLFEPLGLGPCNESEAWTFTADQTIALKDTLICLKADG  431

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHL-SSKLKDGSNVCLDVDSN-NVIITNTCKCLNN  221
              KPAKLG+ C+D  SKWE+ISDS+MH+ +    + S++CLDV S+   I+TN C+CL+ 
Sbjct  432  ESKPAKLGIICSDTRSKWELISDSKMHVSTKSSSNSSSLCLDVGSDGRSIVTNPCRCLSK  491

Query  220  DSSCDPASQWFKIIDSTRGTTTKSDFQSTSF  128
            D SCDP SQWFK+++STR T  K+      F
Sbjct  492  DQSCDPESQWFKMVNSTRPTINKNSLMELQF  522



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 151/206 (73%), Gaps = 6/206 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWA WTL+GSYY+R+G V ++E +G+L  NW + RN SFLQRIS +Q PF+GPG
Sbjct  338  AAELDLDWAYWTLSGSYYIRQGVVDVDETFGILNGNWSQVRNTSFLQRISAIQHPFQGPG  397

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              ES  +K+IFHP+ GLCV   SL +PL++GPCS SD W YT    L ++GT FCLQ E 
Sbjct  398  LLESEPYKVIFHPLRGLCVLSKSLHEPLKMGPCSNSDGWEYTPQNILLLKGTKFCLQGEG  457

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG---SNVCLDVDSNNVIITNTCKCLN  224
             GK  KLG  C+   S WE+ISDS+MHLS  + +    S+VCLDVD+NN+++TN+CKC++
Sbjct  458  EGKQVKLGTTCSGPESTWEMISDSKMHLSYNVNNNGSTSSVCLDVDANNIVVTNSCKCIS  517

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSD  146
              ++CDPASQWFK++D    +TT SD
Sbjct  518  KVNTCDPASQWFKLVDR---STTSSD  540



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 150/200 (75%), Gaps = 7/200 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWA WTLAGSYYLREGTVGL E YG+LT N   P     LQRIS +Q P+RGPG
Sbjct  278  AAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQNTTLPTTTFLLQRISAIQLPYRGPG  337

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEG-TYFCLQAE  398
             +E   HK+IFHP+TGLC+      +PL+LGPCS S+ W YTA K L+V+G    CLQAE
Sbjct  338  LSEVEAHKVIFHPLTGLCIS--GKLEPLKLGPCSNSEGWEYTAQKVLSVKGRNSTCLQAE  395

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
              GK AKLG  C    S WEI+SDS++HLSSK+ + S+VCLDVDSNN I+TN CKCL+ D
Sbjct  396  GEGKEAKLGNEC----SVWEIVSDSKLHLSSKINNASDVCLDVDSNNNIVTNACKCLSGD  451

Query  217  SSCDPASQWFKIIDSTRGTT  158
             +CDPASQWFK++DSTR +T
Sbjct  452  KTCDPASQWFKLVDSTRKST  471



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            A ELD D+A W+L GSYYLR+G  G++E+YG+L  +W   RN S  Q+IS++Q+  +G G
Sbjct  331  AVELDVDFAQWSLVGSYYLRQGVKGMKEYYGILNSDWSGIRNSSLTQKISVLQTSIKGAG  390

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
                RLHK+IFHP TGLC+ +V    PL+LGPCS++  W Y++ K L +    FC+QA++
Sbjct  391  LHTPRLHKIIFHPATGLCLLKVGTRGPLKLGPCSQTQGWTYSSTKVLLLNKNEFCIQADQ  450

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            L KPA LG+ CT  +S+WE ISDS+MHL SK  DG+ VCLDVDS+  I+TN CKCL+ DS
Sbjct  451  LNKPAVLGIPCTTPNSRWETISDSQMHLQSKTTDGTEVCLDVDSDKTIVTNACKCLSGDS  510

Query  214  SCDPASQWFKIIDS  173
            SCDPASQWFK++DS
Sbjct  511  SCDPASQWFKVVDS  524



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 150/200 (75%), Gaps = 7/200 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWA WTLAGSYYLREGTVGL E YG+LT N   P     LQRIS +Q P+RGPG
Sbjct  340  AAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQNTTLPTTTFLLQRISAIQLPYRGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEG-TYFCLQAE  398
             +E   HK+IFHP+TGLC+      +PL+LGPCS S+ W YTA K L+V+G    CLQAE
Sbjct  400  LSEVEAHKVIFHPLTGLCIS--GKLEPLKLGPCSNSEGWEYTAQKVLSVKGRNSTCLQAE  457

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
              GK AKLG  C    S WEI+SDS++HLSSK+ + S+VCLDVDSNN I+TN CKCL+ D
Sbjct  458  GEGKEAKLGNEC----SVWEIVSDSKLHLSSKINNASDVCLDVDSNNNIVTNACKCLSGD  513

Query  217  SSCDPASQWFKIIDSTRGTT  158
             +CDPASQWFK++DSTR +T
Sbjct  514  KTCDPASQWFKLVDSTRKST  533



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWA WTL+GSYY+R+G V ++E +G+L  NW + RN SFLQRIS +Q PF+GPG
Sbjct  328  AAELDLDWAYWTLSGSYYIRQGVVDVDETFGILNGNWSQVRNTSFLQRISAIQHPFQGPG  387

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              ES  +K+IFHP+ GLCV   SL +PL++GPCS SD W YT    L ++GT FCLQ E 
Sbjct  388  LLESEPYKVIFHPLRGLCVLSKSLHEPLKMGPCSNSDGWEYTPQNILLLKGTKFCLQGEG  447

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG---SNVCLDVDSNNVIITNTCKCLN  224
             GK  KLG  C+   S WE+ISDS+MHLS  + +    S+VCLDVD+NN+++TN+CKC++
Sbjct  448  EGKQVKLGTTCSGPESTWEMISDSKMHLSYNVNNNGSTSSVCLDVDANNIVVTNSCKCIS  507

Query  223  NDSSCDPASQWFKIIDSTR  167
              ++CDPASQWFK++ ++ 
Sbjct  508  KVNTCDPASQWFKLLGASE  526



>emb|CAN62580.1| hypothetical protein VITISV_036569 [Vitis vinifera]
Length=221

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 138/198 (70%), Gaps = 19/198 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL             EE  G++ WN       SF QRIS +QSP +GP 
Sbjct  35   AAELDFDWALWTL-------------EETNGLMNWN------SSFFQRISALQSPLQGPD  75

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+IFHP TGLC+ R S  +PL+LGPC++S+ WGYT  K LTV+GTYFCLQA  
Sbjct  76   VSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTKSEAWGYTPQKLLTVKGTYFCLQAVG  135

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL    
Sbjct  136  LGKPAKLSIICTKPGSNWEIISDSKMYLSTKLGDGTRVCLDVDSSSTIVTDACKCLGRGD  195

Query  214  SCDPASQWFKIIDSTRGT  161
             CDP SQWFK++DST  T
Sbjct  196  MCDPGSQWFKVVDSTNIT  213



>emb|CAN72915.1| hypothetical protein VITISV_020826 [Vitis vinifera]
Length=221

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 136/198 (69%), Gaps = 19/198 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL             EE  G++ WN       +F QRIS  QSP +GP 
Sbjct  35   AAELDFDWALWTL-------------EETNGLMNWN------SNFFQRISAXQSPLQGPD  75

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+ R SL +PL+LGPC+ES+ WGYT  K L V+GTYFCLQA  
Sbjct  76   VSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTESEAWGYTPQKILIVKGTYFCLQAVG  135

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL  D 
Sbjct  136  LGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDGTTVCLDVDSSSNIVTDACKCLGRDD  195

Query  214  SCDPASQWFKIIDSTRGT  161
             CDP SQWF ++DST  T
Sbjct  196  MCDPGSQWFNVVDSTNIT  213



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L GSYY+REG +G +E YGVL W+WC+ RN SF+ RI+ +Q+PF+GPG
Sbjct  337  AAELDLDWALWALQGSYYIREGQLGYDETYGVLGWDWCKARNSSFVNRIAALQAPFQGPG  396

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
             + +  + +IFHP+TGLC V++ S    LELG C+ S+ W YTA + + +EGT +C+ A+
Sbjct  397  LSNNSPYDIIFHPLTGLCVVKKSSSKNLLELGLCANSEAWNYTAEQNVMLEGTKYCMLAK  456

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
              G+ A+LG  C   +S WE+ISDSRMH+SSKL K+GS VCLD+  +  IITN CKCL+ 
Sbjct  457  GAGRRARLGTGCGGSNSIWELISDSRMHVSSKLPKNGSTVCLDISQDGTIITNLCKCLSQ  516

Query  220  DSSCDPASQWFKIIDSTR  167
            D +C+P SQWFKII STR
Sbjct  517  DGTCNPDSQWFKIIRSTR  534



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 145/196 (74%), Gaps = 0/196 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D+D+ALWTL G+YYLR+G VG EEFYG+  ++W   RN S+L+RIS++Q PF+GPG
Sbjct  318  AAEFDWDFALWTLQGNYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQLPFQGPG  377

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              ++  HK+IFHP+TGLC+ R      L LGPC  S+PW YT   AL V G    L+A  
Sbjct  378  GLQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSYTPQNALWVMGLPLYLRAIG  437

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LG+PA+LG   T+  +KWE+IS S MHLSSK +DGS VCLDV+++N ++   CKCL+++S
Sbjct  438  LGRPARLGTSPTEPGTKWEMISASEMHLSSKAEDGSTVCLDVNTHNTVMVEACKCLSSES  497

Query  214  SCDPASQWFKIIDSTR  167
            SCDPASQWF+++D TR
Sbjct  498  SCDPASQWFRLVDRTR  513



>emb|CAN73208.1| hypothetical protein VITISV_009079 [Vitis vinifera]
Length=221

 Score =   226 bits (577),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 135/195 (69%), Gaps = 19/195 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA LDFDWALWTL             EE  G++ WN       +F QRIS  QSP +GP 
Sbjct  35   AAXLDFDWALWTL-------------EETNGLMNWN------SNFFQRISAXQSPLQGPD  75

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+ R SL +PL+LGPC+ES+ WGYT  K L V+GTYFCLQA  
Sbjct  76   VSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTESEAWGYTPQKILIVKGTYFCLQAVG  135

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL  D 
Sbjct  136  LGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDGTTVCLDVDSSSNIVTDACKCLGRDD  195

Query  214  SCDPASQWFKIIDST  170
             CDP SQWFK++DST
Sbjct  196  XCDPGSQWFKVVDST  210



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 141/196 (72%), Gaps = 1/196 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYYLREG +GLEE YGV+ W+W  PRN +FL+R+S ++S FRGPG
Sbjct  335  AAELDFDWALWTLMGSYYLREGVLGLEEVYGVMNWDWSGPRNSTFLRRLSSIRSAFRGPG  394

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E   +++++HP+TGLCV+R S  + L+LG C E   W YT    + V+GT  CL  ++
Sbjct  395  LDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCDEPASWIYTPEMTIKVKGTGLCLHGDR  454

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LG+ A L   C    S W  I+DS+MHL+SKL  GS VCLD+DS N IIT+ C+CL  D 
Sbjct  455  LGERANLQ-DCNSPGSIWMPITDSKMHLASKLAGGSTVCLDIDSKNKIITSPCQCLLGDP  513

Query  214  SCDPASQWFKIIDSTR  167
            +CDP SQWFKII+STR
Sbjct  514  TCDPGSQWFKIINSTR  529



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 141/196 (72%), Gaps = 1/196 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYYLREG +GLEE YGV+ W+W  PRN +FL+R+S ++S FRGPG
Sbjct  337  AAELDFDWALWTLMGSYYLREGVLGLEEVYGVMNWDWSGPRNSTFLRRLSSIRSAFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
              E   +++++HP+TGLCV+R S  + L+LG C E   W YT    + V+GT  CL  ++
Sbjct  397  LDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCDEPASWIYTPEMTIKVKGTGLCLHGDR  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LG+ A L   C    S W  I+DS+MHL+SKL  GS VCLD+DS N IIT+ C+CL  D 
Sbjct  457  LGERANLQ-DCNSPGSIWMPITDSKMHLASKLAGGSTVCLDIDSKNKIITSPCQCLLGDP  515

Query  214  SCDPASQWFKIIDSTR  167
            +CDP SQWFKII+STR
Sbjct  516  TCDPGSQWFKIINSTR  531



>ref|XP_002284888.2| PREDICTED: uncharacterized protein LOC100258876 [Vitis vinifera]
Length=518

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 138/198 (70%), Gaps = 19/198 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL             EE  G++ WN       +F QRIS +QSP +GP 
Sbjct  332  AAELDFDWALWTL-------------EETNGLMNWNS------NFFQRISALQSPLQGPD  372

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+ R SL +PL+LGPC+ES+ WGYT  K L V+GTYFCLQA  
Sbjct  373  VSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTESEAWGYTPQKILIVKGTYFCLQAVG  432

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL  D 
Sbjct  433  LGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDGTTVCLDVDSSSNIVTDACKCLGRDD  492

Query  214  SCDPASQWFKIIDSTRGT  161
             CDP SQWFK++DST  T
Sbjct  493  MCDPGSQWFKVVDSTNIT  510



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 144/200 (72%), Gaps = 1/200 (1%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            AE D DWALWTLAG+YYLREG VG+ E+YG+L  +W + RN SFL+RIS++Q+P +GPG 
Sbjct  340  AEHDLDWALWTLAGNYYLREGVVGMVEYYGLLNSDWTQVRNTSFLERISVIQAPLQGPGM  399

Query  571  TESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
            ++   H +I+HP TGLCV +  +    ++LG C+ES+ W YT  + LT++G+Y CL A+ 
Sbjct  400  SQRTEHNIIYHPSTGLCVVKKPMTPMGVQLGNCAESNRWTYTPSQTLTIKGSYLCLHAQG  459

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +  PA+L L+C    ++W  ISDS++HLS+ L     VCLDVDS+N +IT TCKCL+ND+
Sbjct  460  MNLPARLSLYCPGVGTRWTPISDSKLHLSASLSRRVTVCLDVDSDNNLITTTCKCLSNDN  519

Query  214  SCDPASQWFKIIDSTRGTTT  155
             CDP SQWFKI++     TT
Sbjct  520  KCDPGSQWFKIVEVADTITT  539



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 144/198 (73%), Gaps = 2/198 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWALW   GSYYLREG   L E Y VL W+W +PRN +FL+R++ +QSPFRGPG
Sbjct  339  AADLDFDWALWAFMGSYYLREGYYALNEVYAVLDWDWAKPRNTTFLKRVAGIQSPFRGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSES-DPWGYTAGKALTV-EGTYFCLQA  401
            +++ R + +++HP+TGLCV++VS  +P++LG C+ + + W YT  K L +  G  +CLQA
Sbjct  399  FSDVRPYNILYHPLTGLCVQKVSPMEPVKLGSCAAAPEAWIYTPQKTLMLNNGMRYCLQA  458

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
            + +G    LG  C+   S W  IS S++HLSSKL +G++VCLD+D +  I+TNTC+CL  
Sbjct  459  DGVGNGVMLGNACSGPGSNWYQISASKLHLSSKLANGTSVCLDIDPSYNIVTNTCQCLTG  518

Query  220  DSSCDPASQWFKIIDSTR  167
            D +CDPA QWFKII STR
Sbjct  519  DKTCDPAGQWFKIITSTR  536



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 141/198 (71%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALW   GSYYLREG +GL+E Y V+ W W  PRN +FL+R+S +QSPFRG G
Sbjct  340  AAELDFDWALWAFMGSYYLREGVMGLDEVYAVMNWGWSGPRNSTFLRRLSALQSPFRGAG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLE--LGPCSESDPWGYTAGKALTVEG-TYFCLQ  404
              E   +++++HP+TGLCV+R S  +PL+  LG C+ES  W YT    L V G T  CLQ
Sbjct  400  LDEVAPYQILYHPLTGLCVQRGSFKKPLDLKLGSCAESAQWMYTPEMTLAVNGTTVLCLQ  459

Query  403  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
            A+ LG+ AKL   C+  ++KW+ ISDSRMHLS+ L   S  CLD+DS N II + C+CL 
Sbjct  460  ADGLGRRAKLRGDCSSPATKWKPISDSRMHLSTTLPTNSTACLDIDSKNNIIASRCQCLW  519

Query  223  NDSSCDPASQWFKIIDST  170
             D+SCDPASQWFKII ST
Sbjct  520  GDASCDPASQWFKIIYST  537



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   230 bits (587),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 151/206 (73%), Gaps = 2/206 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L GSYY+REG +G +E YG+L W+WC+ RN SF+ RIS +Q+PF+GPG
Sbjct  342  AAELDLDWALWALQGSYYIREGQLGYDETYGLLGWDWCKARNSSFVNRISALQAPFQGPG  401

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
             + +  + +IFHP+TGLC V++ S    LELG C++S+ W YTA + + +E T +C+ A+
Sbjct  402  LSNNSPYNIIFHPLTGLCVVKKFSSKNLLELGQCADSEAWNYTAEQHVMLEDTKYCMLAK  461

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK-DGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ A+LG  C   +S WE+ISDS+MH+S+KL  +GS VCLD+  +  +ITN CKCL+ 
Sbjct  462  GVGRRARLGTSCGGSNSIWELISDSKMHVSTKLPINGSTVCLDISQDGTVITNLCKCLSL  521

Query  220  DSSCDPASQWFKIIDSTRGTTTKSDF  143
            D +C+P SQWFKII STR   +++ +
Sbjct  522  DGTCNPDSQWFKIIRSTRERESQTAY  547



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 144/225 (64%), Gaps = 37/225 (16%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L GSYY+REG VGL+E YGV  WNW E RN + LQ+IS +Q PFRGP 
Sbjct  311  AAEQDVDWALWALTGSYYIREGVVGLDETYGVYNWNWGEIRNQTTLQKISALQYPFRGP-  369

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAE  398
                                            CSE++ W Y T  K LT+ GTYFCL+A+
Sbjct  370  --------------------------------CSEAEAWSYSTPQKTLTIVGTYFCLEAD  397

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
            +LG+PAKLG+FC+D ++KWE IS+S+ HLSSKL DG+ VCLD+DS+N I+TN CKCLN +
Sbjct  398  ELGQPAKLGIFCSDATTKWEAISESKNHLSSKLGDGTKVCLDIDSDNNIVTNNCKCLNRN  457

Query  217  SSCDPASQWFKIIDSTRGTTTKSDFQST---SFLYFLAKKLFASY  92
            S CDP SQWFKIIDSTR  TT ++       S +  +AK    S+
Sbjct  458  SKCDPGSQWFKIIDSTRSATTDNNLLHRVIGSIVKLIAKIFLGSF  502



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 149/205 (73%), Gaps = 3/205 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALWTLAGSYY RE  +G +E++GVL W+W   RN +F QRIS +Q PFRGPG
Sbjct  331  AAELDLDWALWTLAGSYYTREKAIGADEYFGVLDWSWIGIRNSTFFQRISAIQRPFRGPG  390

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
              E+  HK+IFHP TGLCV R S   P  L+LGPC+ESD W +T  + L+V+    C++ 
Sbjct  391  LMETYPHKVIFHPSTGLCVVRESWPNPFRLKLGPCNESDSWRHTPHRILSVKEQLLCIKV  450

Query  400  EKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
            ++ G+PAKL +F ++ S SKW++ S+S+M L+S    G++VCLDVDS++ I+T +CKCL+
Sbjct  451  DERGQPAKLRIFFSEASCSKWKVTSESKMQLASLTWSGASVCLDVDSDSNIVTTSCKCLH  510

Query  223  NDSSCDPASQWFKIIDSTRGTTTKS  149
             +  CDP SQWFK++ STR   TK+
Sbjct  511  GNEPCDPGSQWFKLVTSTRRRRTKA  535



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 137/198 (69%), Gaps = 19/198 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL             EE  G++ WN       SF QRIS +QSP +GP 
Sbjct  326  AAELDFDWALWTL-------------EETNGLMNWNS------SFFQRISALQSPLQGPD  366

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+IFHP TGLC+ R S  +PL+LGPC++S+ WGYT  K LTV+GTYFCLQA  
Sbjct  367  VSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTKSEAWGYTPQKLLTVKGTYFCLQAVG  426

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S WE ISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL    
Sbjct  427  LGKPAKLSIICTKPGSNWENISDSKMYLSTKLGDGTRVCLDVDSSSTIVTDACKCLGRGD  486

Query  214  SCDPASQWFKIIDSTRGT  161
             CDP SQWFK++DST  T
Sbjct  487  MCDPGSQWFKVVDSTNIT  504



>gb|AAS00040.1| unknown [Vitis riparia]
Length=221

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 19/195 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWT+             EE  G++ WN       S  QRIS +QSP +GP 
Sbjct  35   AAELDFDWALWTV-------------EETNGLMNWN------SSVFQRISALQSPLQGPD  75

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA +
Sbjct  76   VSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAVE  135

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D 
Sbjct  136  LGKPAKLSIICTKPGSNWDIISDSKMYLSTKLADSTTVCLDVDSSSTIVTDACKCLGRDD  195

Query  214  SCDPASQWFKIIDST  170
            +CDP SQWFK++DST
Sbjct  196  TCDPGSQWFKVVDST  210



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D+D+ALWTL GSYYLR+G VG EEFYG+  ++W   RN S+L+RIS++Q PF+GPG
Sbjct  318  AAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQLPFQGPG  377

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-TVEGTYFCLQAE  398
              ++  HK+IFHP+TGLC+ R      L LGPC  S+PW +T   AL  + G    L+A 
Sbjct  378  GRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSHTPQNALGLMAGKPLYLRAV  437

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
             LG+PA LG   T+  +KWE+IS S MHLSS  +DGS VCLDV +NN ++   CKCL+++
Sbjct  438  GLGRPATLGTSPTEPGTKWEMISASEMHLSSMAEDGSTVCLDVIANNTVMVEACKCLSSE  497

Query  217  SSCDPASQWFKIIDSTR  167
            SSCDPASQWF+++D TR
Sbjct  498  SSCDPASQWFRLVDRTR  514



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 146/206 (71%), Gaps = 3/206 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  337  AAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGPG  396

Query  574  YTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               SR  + LIFHP TGLCV   S  + LELGPC  S+ W YT+   L V+ T  CLQA+
Sbjct  397  LPNSREPYNLIFHPQTGLCVLATS-SKSLELGPCDRSNAWNYTSAYELVVKSTGQCLQAK  455

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ AKLG  C+  SSKW++IS+SRMH+S++L K+G+ VCLD   +  IITN CKCL  
Sbjct  456  SVGENAKLGTDCSKPSSKWQLISNSRMHVSAELTKNGTRVCLDAGPDGAIITNQCKCLII  515

Query  220  DSSCDPASQWFKIIDSTRGTTTKSDF  143
            D +C+P SQWFK+I S+R T   S  
Sbjct  516  DPACNPESQWFKVILSSRDTPGGSSI  541



>emb|CAN60394.1| hypothetical protein VITISV_015741 [Vitis vinifera]
Length=221

 Score =   215 bits (548),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 133/195 (68%), Gaps = 19/195 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWT              EE  G++ WN          QRIS +QSP +GP 
Sbjct  35   AAELDFDWALWTX-------------EETNGLMNWN------SXXFQRISALQSPLQGPX  75

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA +
Sbjct  76   VSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAVE  135

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D 
Sbjct  136  LGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKCLGRDD  195

Query  214  SCDPASQWFKIIDST  170
            +CDP SQWFK++DST
Sbjct  196  TCDPGSQWFKVVDST  210



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 155/229 (68%), Gaps = 17/229 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWT+ GSYY+RE T+  +E YGVL WNW   RN + LQ IS +QSPFRGPG
Sbjct  333  AADLDLDWALWTVVGSYYVREKTIEYDETYGVLDWNWSSIRNSTMLQMISSIQSPFRGPG  392

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E+   K++FHP TGLCV R SLFQ L+LG C + + W  T+ + L++ E   FCL+A 
Sbjct  393  LMETHPKKIMFHPSTGLCVVRKSLFQ-LKLGSCDKPESWRLTSHRVLSLREEEIFCLKAY  451

Query  397  KLGKPAKL-----GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTC  236
            + GK  KL     GL+C    SKW++ S+S+M +SS  + G++VCLDVDS NN I+TN+C
Sbjct  452  EKGKSVKLRVFFFGLYC----SKWKLKSESKMQISSVSRSGNSVCLDVDSENNNIVTNSC  507

Query  235  KCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  89
            KCL  +SSCDP SQWFK++ STR     S F+   FL F  KK F S I
Sbjct  508  KCLKGNSSCDPRSQWFKLVTSTR-----SRFKPKPFLQFSPKKTFLSLI  551



>emb|CBI20318.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 19/195 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWT+             EE  G++ WN       S  QRIS +QSP +GP 
Sbjct  178  AAELDFDWALWTV-------------EETNGLMNWN------SSVFQRISALQSPLQGPD  218

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA +
Sbjct  219  VSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAVE  278

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D 
Sbjct  279  LGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKCLGRDD  338

Query  214  SCDPASQWFKIIDST  170
            +CDP SQWFK++DST
Sbjct  339  TCDPGSQWFKVVDST  353



>gb|ACN33507.1| unknown [Zea mays]
Length=369

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+LTW+WC  RN SF++RI+ +QS F+GPG
Sbjct  149  AAEMDLDWAIWALQGSYYIREGILAYDESYGLLTWDWCTARNPSFIKRINSLQSAFQGPG  208

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               ++  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQA+
Sbjct  209  LPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPCDESNAWNYTSAYELVVKSTGQCLQAQ  267

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +GK AKLG  C+  SSKW +ISDS+MH+S++L K+G+ VCL+   +  I TN CKCL+ 
Sbjct  268  SVGKNAKLGTDCSKPSSKWHLISDSKMHVSAELAKNGTRVCLEASPDGAIRTNQCKCLSV  327

Query  220  DSSCDPASQWFKIIDSTR  167
            D +CDP SQWFK+I S+R
Sbjct  328  DPTCDPESQWFKVILSSR  345



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+LTW+W   RN SF++RI+ +QSPF+GPG
Sbjct  350  AAEMDLDWAVWALEGSYYIREGILAYDETYGLLTWDWYTARNPSFIERINSLQSPFQGPG  409

Query  574  YTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S + +K+IFHP+TGLCV  V     L+LGPC ESD W YT+   L ++ T  CL+A+
Sbjct  410  LPSSHQPYKVIFHPLTGLCV-LVESANVLKLGPCDESDAWNYTSAYELVLKHTGQCLEAK  468

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G  AKLG  C+   SKW++ISDSRMH+S++L K+G+ VCL+   + VI T+ CKCL  
Sbjct  469  SVGDTAKLGTGCSKSCSKWQLISDSRMHVSAELTKNGTRVCLEAGPDGVITTDQCKCLTE  528

Query  220  DSSCDPASQWFKIIDSTRG  164
            D +CDP SQWFK+I S+RG
Sbjct  529  DPTCDPESQWFKVISSSRG  547



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  335  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGPG  394

Query  574  YTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP++GLCV  V   + LELGPC ES+ W YT+   L ++ T  CLQA+
Sbjct  395  LPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPCDESNAWNYTSTHELVLQHTGQCLQAK  453

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ A+LG  C+  SSKW++IS+S MH+S++L K+G+ VCLD   + +I TN CKCL  
Sbjct  454  SVGENAQLGTDCSKSSSKWQLISNSGMHVSTELTKNGTGVCLDATPDGIITTNPCKCLTG  513

Query  220  DSSCDPASQWFKIIDSTRGTTT  155
            D  C+P SQWFKII S+R T T
Sbjct  514  DPICNPESQWFKIILSSRHTGT  535



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  333  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGPG  392

Query  574  YTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP++GLCV  V   + LELGPC ES+ W YT+   L ++ T  CLQ +
Sbjct  393  LPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPCDESNAWNYTSTHELVLQHTGQCLQVK  451

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ A+LG  C+  SSKW++IS+S MH+S++L K+G+ VCLD   + +I TN CKCL  
Sbjct  452  SVGENAQLGTDCSKSSSKWQLISNSGMHVSTELTKNGTRVCLDATPDGIITTNPCKCLTG  511

Query  220  DSSCDPASQWFKIIDSTRGTTT  155
            D +C+P SQWFKII S+R T T
Sbjct  512  DPNCNPESQWFKIILSSRHTGT  533



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  336  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGPG  395

Query  574  YTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP++GLCV  V   + LELGPC ES+ W YT+   L ++ T  CLQ +
Sbjct  396  LPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPCDESNAWNYTSTHELVLQHTGQCLQVK  454

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ A+LG  C+  SSKW++IS+S MH+S++L K+G+ VCLD   + +I TN CKCL  
Sbjct  455  SVGENAQLGTDCSKSSSKWQLISNSGMHVSTELTKNGTRVCLDATPDGIITTNPCKCLTG  514

Query  220  DSSCDPASQWFKIIDSTRGTTT  155
            D +C+P SQWFKII S+R T T
Sbjct  515  DPNCNPESQWFKIILSSRHTGT  536



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D+D+ALWTL GSYYLREG VG+EEFYG+   +W   RN S+L+R+S++Q PF+GPG
Sbjct  450  AAEFDWDFALWTLQGSYYLREGVVGVEEFYGLFNNDWSGIRNSSYLRRLSVLQLPFQGPG  509

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-TVEGTYFCLQAE  398
              ++   K+IFHP+TGLC+ R +    L LGPC  S+PW +T   AL  + G    L+A 
Sbjct  510  GRQTVAQKVIFHPLTGLCILRRTRPTRLVLGPCIYSEPWSHTPQNALGLMAGKPLYLRAV  569

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
             LG+PA LG   T+  +KWE+IS S MHLSS  +DGS VCLD+ +NN ++   CKCL+++
Sbjct  570  GLGRPATLGTSPTEPGTKWEMISASEMHLSSMAEDGSTVCLDMIANNTVMVEACKCLSSE  629

Query  217  SSCDPASQWFKIIDSTR  167
            SSCDPASQWF+++D TR
Sbjct  630  SSCDPASQWFRLVDRTR  646


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  325  SRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  167
            S +HLSSK KD S VCLD+ +NN ++   CKCL  ++SCD ASQWFK+ D+ R
Sbjct  3    SELHLSSKAKDRSAVCLDMGANNTVVVEACKCLGGNNSCDLASQWFKLADTNR  55



>ref|XP_002284881.1| PREDICTED: uncharacterized protein LOC100264047 [Vitis vinifera]
Length=509

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 19/195 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWT+             EE  G++ WN       S  QRIS +QSP +GP 
Sbjct  323  AAELDFDWALWTV-------------EETNGLMNWN------SSVFQRISALQSPLQGPD  363

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA +
Sbjct  364  VSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAVE  423

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D 
Sbjct  424  LGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKCLGRDD  483

Query  214  SCDPASQWFKIIDST  170
            +CDP SQWFK++DST
Sbjct  484  TCDPGSQWFKVVDST  498



>emb|CBI20316.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = -2

Query  649  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  470
            NW    N +F QRIS +QSP +GP  +  R HK+I HP TGLC+ R SL +PL+LGPC+E
Sbjct  2    NW----NSNFFQRISALQSPLQGPDVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTE  57

Query  469  SDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG  290
            S+ WGYT  K L V+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL DG
Sbjct  58   SEAWGYTPQKILIVKGTYFCLQAVGLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDG  117

Query  289  SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  161
            + VCLDVDS++ I+T+ CKCL  D  CDP SQWFK++DST  T
Sbjct  118  TTVCLDVDSSSNIVTDACKCLGRDDMCDPGSQWFKVVDSTNIT  160



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DW++W L GSYY+REG +  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  336  AAEMDLDWSIWALQGSYYIREGILAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGPG  395

Query  574  YTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQ +
Sbjct  396  LPNSQEPYNIIFHPQSGLCVLARS-SKLLELGPCDESNAWNYTSAYNLVVKNTGQCLQVK  454

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +GK AKLG  C+  SSKW +IS+S+MH+S++L K+G+ VCLD      IITN CKCL+ 
Sbjct  455  SVGKNAKLGTDCSKPSSKWNLISNSKMHVSAELTKNGTRVCLDASPAGAIITNQCKCLSV  514

Query  220  DSSCDPASQWFKIIDSTR  167
            D +CDP SQWFK+I S+R
Sbjct  515  DPTCDPESQWFKVIVSSR  532



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L+GSYY+REG  G+ EFYG L  +W + RN SFLQRIS++QSP +GPG
Sbjct  339  AAENDIDWALWVLSGSYYIREGVAGMVEFYGALDADWNDARNSSFLQRISLLQSPLQGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
              ++  + LIFHP+TGLC+ + S   P  L LGPC ES+PW YT+   L ++G  FCLQ 
Sbjct  399  -PQTGDYNLIFHPLTGLCMVQ-SQINPTKLALGPCYESEPWSYTSENNLKIQGLPFCLQN  456

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD-SNNVIITNTCKCLN  224
               GKP KLG+ C    SKW  IS S MHL+S   +  ++CLDVD SNNV+I N CKC+ 
Sbjct  457  TGTGKPVKLGISCWSPVSKWHTISASEMHLASTTSEQISLCLDVDGSNNVVIANDCKCMA  516

Query  223  NDSSCDPASQWFKIIDSTR  167
             DS C P SQWFKII +TR
Sbjct  517  EDSRCQPMSQWFKIIKATR  535



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+LTW+W   RN SF++RI+ +QSPF+GPG
Sbjct  340  AAEMDLDWAVWALEGSYYIREGILAYDETYGLLTWDWYTARNPSFIERINSLQSPFQGPG  399

Query  574  YTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
             + S + +K+IFHP+TGLCV  V     L+LGPC ES+ W YT+   L ++ T  CL+A+
Sbjct  400  LSSSHKSYKVIFHPLTGLCV-LVESANVLKLGPCDESNAWNYTSTYELVLKQTGQCLEAK  458

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G  AKLG  C+   SKW++ISDS MH+S++L K+G+ VCLD   + VI T+ CKCL  
Sbjct  459  SVGDTAKLGTGCSKSCSKWQLISDSGMHVSAELTKNGTRVCLDAGPDGVITTDQCKCLTE  518

Query  220  DSSCDPASQWFKIIDSTRG  164
            D +CDP SQWFK+I S+RG
Sbjct  519  DPTCDPESQWFKVISSSRG  537



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+LTW+WC  RN SF++RI+ +QS F+GPG
Sbjct  335  AAEMDLDWAIWALQGSYYIREGILAYDESYGLLTWDWCTARNPSFIKRINSLQSAFQGPG  394

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               ++  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQA+
Sbjct  395  LPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPCDESNAWNYTSAYELVVKSTGQCLQAQ  453

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +GK AKLG  C+  SSKW +ISDS+MH+S++L K+G+ VCL+   +  I TN CKCL+ 
Sbjct  454  SVGKNAKLGTDCSKPSSKWHLISDSKMHVSAELAKNGTRVCLEASPDGAIRTNQCKCLSV  513

Query  220  DSSCDPASQWFKIIDSTR  167
            D +CDP SQWFK+I S+R
Sbjct  514  DPTCDPESQWFKVILSSR  531



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 135/193 (70%), Gaps = 13/193 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWAL T            G++E YG+L   W    N S ++R+S++QSPF GP 
Sbjct  333  AAEKDLDWALGT------------GIDEAYGLLNSEWFGTGNASPMKRVSLLQSPFLGPD  380

Query  574  -YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
                 R H++IFHP TGLCV R S+ +PL+LG C ES+ W YT  K L V+GTYFCLQA+
Sbjct  381  DLLNVRPHEMIFHPSTGLCVLRKSVIEPLKLGSCVESESWAYTPQKTLVVKGTYFCLQAD  440

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
             +GKPAKLG+ C D  SKW++ISD++MHLSSKL DGS+VCLDVDS+N IITN CKC +  
Sbjct  441  GVGKPAKLGIICNDPGSKWDLISDTKMHLSSKLADGSSVCLDVDSSNSIITNPCKCSSGA  500

Query  217  SSCDPASQWFKII  179
             +CDP SQWFKI+
Sbjct  501  PNCDPTSQWFKIV  513



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 147/211 (70%), Gaps = 4/211 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+R  T+G +E YGVL WNW   RN + LQ +S +Q+PFRGPG
Sbjct  337  AADLDLDWALWTLAGSYYIRGRTIGSDETYGVLDWNWLSIRNSTILQMVSTIQTPFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K++FHP++GLCV R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A 
Sbjct  397  LMETQPKKIMFHPLSGLCVVRKSLFQ-LKLGSCNRSESWRLSSHRVLSLAEERILCLKAY  455

Query  397  KLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            + G   KL LF T+   SKW ++SDS+M LSS  K+G+ VCLDVDS +N I+T  CKCL 
Sbjct  456  EKGNSVKLRLFFTEFHCSKWRLLSDSKMQLSSVTKNGAFVCLDVDSRSNKIVTRRCKCLQ  515

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  131
             +SSCDP SQWFK++ STR  +    F   S
Sbjct  516  GNSSCDPRSQWFKLVTSTRRRSISKPFLQIS  546



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 152/218 (70%), Gaps = 9/218 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+RE T+G +E YGVL W+W   RN + LQ IS +QSPFRGPG
Sbjct  334  AADLDLDWALWTLAGSYYIREKTIGYDETYGVLDWSWSSIRNSTILQMISAIQSPFRGPG  393

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E+   K+IFHP TGLC+ R SLFQ L+LG C  S+ +  ++ + L++ E    CL+A 
Sbjct  394  LMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCDRSESFRLSSQRVLSLAEEKILCLKAY  452

Query  397  KLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLN  224
            + GK  KL L+ ++   S+W+++S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL 
Sbjct  453  EKGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDVDSDSNNIVTKSCKCLE  512

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDF-----QSTSFL  125
             D+SCDP SQWFK++ STR     + F     QS +FL
Sbjct  513  EDASCDPKSQWFKVVTSTRSRFRANPFLRVSPQSKTFL  550



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+L+W+WC  RN  F++RI+ +QS F+GPG
Sbjct  335  AAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWCTARNPGFIKRINSLQSVFQGPG  394

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               ++  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQA+
Sbjct  395  LPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPCGESNAWNYTSAYELVVKSTGQCLQAQ  453

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +GK AKLG  C++ SSKW +ISDS+MHLS++L K+G+ VCL+   +  I TN CKCL+ 
Sbjct  454  SVGKNAKLGTDCSEPSSKWHLISDSKMHLSAELAKNGTRVCLEASPDGAIRTNQCKCLSV  513

Query  220  DSSCDPASQWFKIIDSTR  167
            D +CDP SQWFK+I S+R
Sbjct  514  DPTCDPESQWFKVILSSR  531



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 152/213 (71%), Gaps = 9/213 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+RE T+G +E YGVL W+W   RN + LQ IS +QSPFRGPG
Sbjct  336  AADLDLDWALWTLAGSYYVREKTIGYDETYGVLDWSWSSIRNSTILQMISSIQSPFRGPG  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E+   K+IFHP TGLC+ R SLFQ L+LG C  S+ +  ++ + L++ E    CL+A 
Sbjct  396  LMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCDRSESFRLSSQRVLSLAEEKILCLKAY  454

Query  397  KLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLN  224
            + GK  KL L+ ++   S+W+++S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL 
Sbjct  455  ERGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDVDSDSNNIVTKSCKCLE  514

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  125
             D+SCDP SQWFK++     T+T+S F++  FL
Sbjct  515  GDASCDPKSQWFKVV-----TSTRSRFRANPFL  542



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 152/213 (71%), Gaps = 9/213 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+RE T+G +E YGVL W+W   RN + LQ IS +QSPFRGPG
Sbjct  336  AADLDLDWALWTLAGSYYVREKTIGYDETYGVLDWSWSSIRNSTILQMISSIQSPFRGPG  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E+   K+IFHP TGLC+ R SLFQ L+LG C  S+ +  ++ + L++ E    CL+A 
Sbjct  396  LMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCDRSESFRLSSQRVLSLAEEKILCLKAY  454

Query  397  KLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLN  224
            + GK  KL L+ ++   S+W+++S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL 
Sbjct  455  EKGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDVDSDSNNIVTKSCKCLE  514

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  125
             D+SCDP SQWFK++     T+T+S F++  FL
Sbjct  515  GDASCDPKSQWFKVV-----TSTRSRFRANPFL  542



>emb|CBI20314.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = -2

Query  649  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  470
            NW    N SF QRIS +QSP +GP  +  R HK+IFHP TGLC+ R S  +PL+LGPC++
Sbjct  2    NW----NSSFFQRISALQSPLQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTK  57

Query  469  SDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG  290
            S+ WGYT  K LTV+GTYFCLQA  LGKPAKL + CT   S WE ISDS+M+LS+KL DG
Sbjct  58   SEAWGYTPQKLLTVKGTYFCLQAVGLGKPAKLSIICTKPGSNWENISDSKMYLSTKLGDG  117

Query  289  SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  161
            + VCLDVDS++ I+T+ CKCL     CDP SQWFK++DST  T
Sbjct  118  TRVCLDVDSSSTIVTDACKCLGRGDMCDPGSQWFKVVDSTNIT  160



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALWTL GSYY+R+G VG+ E+YG L  +W + RN SFLQR+S++QS  +GPG
Sbjct  339  AAENDVDWALWTLTGSYYIRQGVVGMIEYYGALDSDWNDVRNSSFLQRLSLLQSQLQGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
               +  + LIFHP+TGLCV +  L  P  L LGPC ES+PW YT+   L ++G  FC+Q+
Sbjct  399  -PRTDFYDLIFHPLTGLCVVQSEL-DPTLLTLGPCKESEPWSYTSKNNLKIQGMPFCIQS  456

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG-SNVCLDVDSNNVIITNTCKCLN  224
                KP +LGL C   +SKW+ IS S+MHL+S   +  S++CLDVD+N+ ++ N CKCL+
Sbjct  457  TGTQKPVRLGLSCWSPNSKWQTISASKMHLASTTSNKTSSLCLDVDTNSNVVANPCKCLS  516

Query  223  NDSSCDPASQWFKIIDSTRG  164
             DSSC+P SQWFKI+ +T G
Sbjct  517  KDSSCEPMSQWFKIVRATTG  536



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 145/211 (69%), Gaps = 4/211 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+R  T+G +E YGVL WNW   RN + LQ +S +Q+PF GPG
Sbjct  336  AADLDLDWALWTLAGSYYIRGKTIGSDETYGVLDWNWLNVRNSTILQMVSAIQTPFTGPG  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K++FHP++GLC+ R  LF+ L+LG C  S+ W  ++ + L++ E    CL+A 
Sbjct  396  LMETQPKKIMFHPLSGLCIVRKPLFR-LKLGSCKRSESWRLSSHRVLSLAEERILCLKAY  454

Query  397  KLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            + G P KL LF T+   SKW ++SDS+M LSS  K+G+ VCLDVDS +N I+T  CKCL 
Sbjct  455  EKGNPVKLRLFFTEFQCSKWRLLSDSKMQLSSITKNGAFVCLDVDSRSNKIVTRRCKCLQ  514

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  131
             +SSCDP SQWFK++ STR  +    F   S
Sbjct  515  GNSSCDPRSQWFKLVTSTRRRSISKPFLQIS  545



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 149/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DW+LWTLAGSYY+RE T+G +E YGVL WNW   RN + LQ IS +QSPF+  G
Sbjct  331  AADLDLDWSLWTLAGSYYIREKTIGTDETYGVLDWNWSSIRNSTILQMISAIQSPFQ--G  388

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K++FHP TGLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A 
Sbjct  389  LMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCNRSESWKLSSHRVLSLTEEKILCLKAY  447

Query  397  KLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            + GK  KL LF +D   SKW+++SDS+M LSS  K+G ++CLDVDS NN I+TN+CKCL 
Sbjct  448  EDGKSVKLRLFFSDSYCSKWKLLSDSKMQLSSITKNGVSICLDVDSNNNNIVTNSCKCLL  507

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  131
             +SSCDP SQWFK++ STR  +    F   S
Sbjct  508  GNSSCDPRSQWFKLVTSTRRRSKPKPFLQIS  538



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 144/201 (72%), Gaps = 5/201 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWALWT+ GSYYLR+G VG+EE +GVL  ++  PRN SFLQRIS +Q+PF+G  
Sbjct  337  AAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLNKDFSGPRNASFLQRISALQAPFQG-A  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             + S   +++FHP+TGLC++R    + L+LG C+ES+ W +T    + + GT  C+QA++
Sbjct  396  TSSSPTRRILFHPLTGLCIQRKREQEQLQLGACNESEAWTHTRHHTIRMRGTDLCMQADR  455

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN--VCLDVD-SNNVIITNTCKCLN  224
            L KP KL   C D  S+W+ IS+S+MH SS +  GSN  VCLD+D S   +I + CKCL 
Sbjct  456  LEKPVKLSTDCADHGSRWKTISESKMHFSSNIV-GSNVTVCLDIDFSTKTVIASPCKCLR  514

Query  223  NDSSCDPASQWFKIIDSTRGT  161
             D++C+PASQWF++++ TR T
Sbjct  515  EDATCNPASQWFELVNMTRST  535



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 154/223 (69%), Gaps = 8/223 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DW+LWTLAGSYY+RE ++G +E YGVL +NW   RN + LQ IS +Q+PF GPG
Sbjct  339  AADRDLDWSLWTLAGSYYIREKSIGSDESYGVLDFNWSSIRNSTILQMISAIQTPFIGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K++FHP TGLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A 
Sbjct  399  LMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCNRSESWRLSSHRVLSLAEEQILCLKAY  457

Query  397  KLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            + GK  KL LF ++   SKW++ SDS+M LSS  K+G +VCLDVD+ NN I+TN+CKCL 
Sbjct  458  EKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSITKNGFSVCLDVDTENNNIVTNSCKCLR  517

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY---FLAKKL  104
             +SSCDP SQWFK++ STR  +    F   S LY   FL K L
Sbjct  518  GNSSCDPRSQWFKLVTSTRRRSRPKPFLQIS-LYSKTFLQKSL  559



>ref|XP_010248705.1| PREDICTED: uncharacterized protein LOC104591538 isoform X1 [Nelumbo 
nucifera]
Length=540

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 134/195 (69%), Gaps = 15/195 (8%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWAL T            G++E YG+L   W    N S ++R+S++QSPF   G
Sbjct  333  AAEKDLDWALGT------------GIDEAYGLLNSEWFGTGNASPMKRVSLLQSPFLDAG  380

Query  574  ---YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQ  404
                   R H++IFHP TGLCV R S+ +PL+LG C ES+ W YT  K L V+GTYFCLQ
Sbjct  381  PDDLLNVRPHEMIFHPSTGLCVLRKSVIEPLKLGSCVESESWAYTPQKTLVVKGTYFCLQ  440

Query  403  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
            A+ +GKPAKLG+ C D  SKW++ISD++MHLSSKL DGS+VCLDVDS+N IITN CKC +
Sbjct  441  ADGVGKPAKLGIICNDPGSKWDLISDTKMHLSSKLADGSSVCLDVDSSNSIITNPCKCSS  500

Query  223  NDSSCDPASQWFKII  179
               +CDP SQWFKI+
Sbjct  501  GAPNCDPTSQWFKIV  515



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+W   RN SF++RI+ +QSPF+GPG
Sbjct  310  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWSATRNPSFIKRINSLQSPFQGPG  369

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP+TGLC+  V   + LELGPC ES+ W YT+   L ++ T  CLQA+
Sbjct  370  LPNSKEPYNVIFHPLTGLCL-VVKSSEALELGPCDESNAWSYTSTNQLVLKHTGQCLQAK  428

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ AKLG  C+  S+KW++IS S MH+S++L K+G+ VCLD   +  I TN C+CL  
Sbjct  429  SVGENAKLGTDCSKSSAKWQLISYSGMHVSAELTKNGTRVCLDATPDGTIETNLCECLTL  488

Query  220  DSSCDPASQWFKIIDSTRG  164
            D +C+P SQWFKII S++G
Sbjct  489  DPNCNPESQWFKIILSSKG  507



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 3/210 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+R+ T+G +E YGVL W+W   RN + LQ IS +Q+PF GPG
Sbjct  333  AADLDVDWALWTLAGSYYIRDKTIGSDETYGVLDWDWSSIRNSTILQMISAIQTPFTGPG  392

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K++FHP +GLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A 
Sbjct  393  LMETQPKKIMFHPSSGLCIVRKSLFQ-LKLGSCNRSESWKLSSHQVLSLTEERILCLKAY  451

Query  397  KLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
            + GK  KL LF +D   SKW+++SDS+M L S  K+G+ VCLDVDS + I+  +CKCL  
Sbjct  452  EKGKAVKLRLFFSDFHCSKWKLLSDSKMQLLSVTKNGTIVCLDVDSYSKIVMRSCKCLQG  511

Query  220  DSSCDPASQWFKIIDSTRGTTTKSDFQSTS  131
            +SSCDP SQWFK++ S+R  +    F   S
Sbjct  512  NSSCDPRSQWFKLVTSSRRRSKSKPFIQIS  541



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 140/215 (65%), Gaps = 15/215 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGPG
Sbjct  321  AADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGPG  380

Query  574  YTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYFC  410
              E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    C
Sbjct  381  LAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLLC  440

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DSN  260
            L+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D  
Sbjct  441  LRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDDG  500

Query  259  NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  155
              ++TN C+CL+ D+SCDP SQWFK++ STR   +
Sbjct  501  RSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVAS  535



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REG +  +E YG+L+W+W   RN SF++RI+ +QSPF+GPG
Sbjct  339  AAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWYTARNPSFIKRINYLQSPFQGPG  398

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  +  IFHP+TGLCV  V     LELGPC ES+ W YT+   L ++ +  CL+A+
Sbjct  399  LPNSKKPYNAIFHPLTGLCV-LVKSPNSLELGPCDESNAWNYTSTCELVLKHSGQCLEAK  457

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G  AKLG   +   SKW++ISDSRMH+S++L K+G+ VCLD   + VI TN CKCL  
Sbjct  458  SVGDIAKLGTVSSKSCSKWQLISDSRMHVSTELTKNGTRVCLDASPDGVISTNQCKCLIE  517

Query  220  DSSCDPASQWFKIIDSTRG  164
            D +C+P SQWFK+I S++G
Sbjct  518  DPTCNPESQWFKVILSSKG  536



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 139/211 (66%), Gaps = 15/211 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGPG
Sbjct  321  AADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGPG  380

Query  574  YTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYFC  410
              E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    C
Sbjct  381  LAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLLC  440

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DSN  260
            L+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D  
Sbjct  441  LRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDDG  500

Query  259  NVIITNTCKCLNNDSSCDPASQWFKIIDSTR  167
              ++TN C+CL+ D+SCDP SQWFK++ STR
Sbjct  501  RSLVTNPCRCLSADNSCDPESQWFKLVTSTR  531



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 15/215 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGPG
Sbjct  337  AADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYFC  410
              E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    C
Sbjct  397  LAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLLC  456

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DSN  260
            L+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D  
Sbjct  457  LRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDDG  516

Query  259  NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  155
              ++TN C+CL+ D+SCDP SQWFK++ STR    
Sbjct  517  RSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVAA  551



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 15/215 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGPG
Sbjct  337  AADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYFC  410
              E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    C
Sbjct  397  LAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLLC  456

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DSN  260
            L+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D  
Sbjct  457  LRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDDG  516

Query  259  NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  155
              ++TN C+CL+ D+SCDP SQWFK++ STR    
Sbjct  517  RSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVAA  551



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS +QSP +GPG
Sbjct  342  AAENDVDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPG  401

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                  + L+FHP+TGLC+ R SL  P  L LGPC+ S+PW YT  KAL ++  + CLQ+
Sbjct  402  -PRIDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQHLCLQS  458

Query  400  EKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
                 P  +    C+   SKW+ IS SRMHLSS   + +++CLDVD+ N I+ N CKCL+
Sbjct  459  NGPKNPVTMTRTSCSTSGSKWQTISASRMHLSSTTSNKTSLCLDVDTANNIVANACKCLS  518

Query  223  NDSSCDPASQWFKIIDSTR  167
             DSSC+P SQWFKII +TR
Sbjct  519  KDSSCEPMSQWFKIIKATR  537



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 131/185 (71%), Gaps = 1/185 (1%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D+D+ALWTL GSYYLR+G VG EEFYG+  ++W   RN S+L+RIS++Q PF+GPG
Sbjct  332  AAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQLPFQGPG  391

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-TVEGTYFCLQAE  398
              ++  HK+IFHP+TGLC+ R      L LGPC  S+PW +T   AL  + G    L+A 
Sbjct  392  GRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSHTPQNALGLMAGKPLYLRAV  451

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
             LG+PA LG   T+  +KWE+IS S MHLSS  +DGS VCLDV +NN ++   CKCL+++
Sbjct  452  GLGRPATLGTSPTEPGTKWEMISASEMHLSSMAEDGSTVCLDVIANNTVMVEACKCLSSE  511

Query  217  SSCDP  203
            SSCDP
Sbjct  512  SSCDP  516



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 135/199 (68%), Gaps = 6/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS +QSP +GPG
Sbjct  312  AAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPG  371

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
               +  + L+FHP+TGLC+ R SL  P  L LGPC+ S+PW YT  KAL ++    CLQ+
Sbjct  372  -PRTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQQLCLQS  428

Query  400  EKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
                 P  +    C+   SKW+ IS SRMHL+S   + +++CLDVD+ N ++ N CKCL+
Sbjct  429  NGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTANNVVANACKCLS  488

Query  223  NDSSCDPASQWFKIIDSTR  167
             D SC+P SQWFKII +TR
Sbjct  489  KDKSCEPMSQWFKIIKATR  507



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 139/194 (72%), Gaps = 5/194 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWALWT+ GSYYLR+G VG+EE +GVL  ++  PRN SFLQRIS +Q+PF+G  
Sbjct  337  AAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLNKDFSGPRNASFLQRISALQAPFQG-A  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             + S   +++FHP+TGLC++R    + L+LG C+ES+ W +T    + + GT  C+QA++
Sbjct  396  TSSSPTRRILFHPLTGLCIQRKREQEQLQLGACNESEAWTHTRHHTIRMRGTDLCMQADR  455

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN--VCLDVD-SNNVIITNTCKCLN  224
            L KP KL   C D  S+W+ IS+S+MH SS +  GSN  VCLD+D S   +I + CKCL 
Sbjct  456  LEKPVKLSTDCADHGSRWKTISESKMHFSSNIV-GSNVTVCLDIDFSTKTVIASPCKCLR  514

Query  223  NDSSCDPASQWFKI  182
             D++C+PASQWF++
Sbjct  515  EDATCNPASQWFEL  528



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 135/199 (68%), Gaps = 6/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS +QSP +GPG
Sbjct  342  AAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPG  401

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
               +  + L+FHP+TGLC+ R SL  P  L LGPC+ S+PW YT  KAL ++    CLQ+
Sbjct  402  -PRTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQQLCLQS  458

Query  400  EKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
                 P  +    C+   SKW+ IS SRMHL+S   + +++CLDVD+ N ++ N CKCL+
Sbjct  459  NGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTANNVVANACKCLS  518

Query  223  NDSSCDPASQWFKIIDSTR  167
             D SC+P SQWFKII +TR
Sbjct  519  KDKSCEPMSQWFKIIKATR  537



>ref|XP_010501449.1| PREDICTED: uncharacterized protein LOC104778702 [Camelina sativa]
Length=259

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  51   AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  110

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP+TGLC+ +  + +  L LGPC+ S+PW YT  KAL ++    CLQ+ 
Sbjct  111  -PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTK-KALRIKDRPLCLQSN  168

Query  397  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
                P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  169  GPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATNNNVVANACKCLS  228

Query  223  NDSSCDPASQWFKIIDSTR  167
             DSSC+P SQWFKII +TR
Sbjct  229  KDSSCEPMSQWFKIIKATR  247



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 152/223 (68%), Gaps = 10/223 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DW+LWTLAGSYY+RE ++G +E YGVL +NW   RN + LQ IS +Q+PF   G
Sbjct  331  AADRDLDWSLWTLAGSYYIREKSIGSDESYGVLDFNWSSIRNSTILQMISAIQTPF--IG  388

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K++FHP TGLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A 
Sbjct  389  LMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCNRSESWRLSSHRVLSLAEEQILCLKAY  447

Query  397  KLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            + GK  KL LF ++   SKW++ SDS+M LSS  K+G +VCLDVD+ NN I+TN+CKCL 
Sbjct  448  EKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSITKNGFSVCLDVDTENNNIVTNSCKCLR  507

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY---FLAKKL  104
             +SSCDP SQWFK++ STR  +    F   S LY   FL K L
Sbjct  508  GNSSCDPRSQWFKLVTSTRRRSRPKPFLQIS-LYSKTFLQKSL  549



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 146/211 (69%), Gaps = 6/211 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LD DWALWTLAGSYY+RE T+G +E +GVL  NW   RN   LQ IS +QSPFR  G
Sbjct  337  AADLDLDWALWTLAGSYYVREKTIGSDESFGVLDLNWSSIRNSIILQMISAIQSPFR--G  394

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQAE  398
              E++  K+IFHP +GLC+ R SLFQ L+LG C+ S+ +  ++ + L++ E   FCL+A 
Sbjct  395  LMETQPKKIIFHPSSGLCIVRKSLFQ-LKLGSCNRSESFKLSSHRVLSLTEEQIFCLKAY  453

Query  397  KLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLN  224
            ++G P KL LF ++   SKW+ +S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL 
Sbjct  454  EIGDPVKLRLFFSESYCSKWKFLSESKMQLSSFTKNGESVCLDVDSDSNNIVTKSCKCLE  513

Query  223  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  131
             ++SC+P SQWFK++ STR       F   S
Sbjct  514  GNASCNPKSQWFKLVTSTRSRCKTKPFLRIS  544



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 128/195 (66%), Gaps = 7/195 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
             E D DWALW L GSYYLREG V  +E +G+L   W   RN  FLQRIS++Q P +GP  
Sbjct  333  VEHDLDWALWALTGSYYLREGQVNAKEQFGILDPKWTHIRNERFLQRISVIQYPRQGPEA  392

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQP---LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
            +    HK+IFHP+TGLC+    L +P   ++LG CS+S+ W +T    L ++G+Y CL+A
Sbjct  393  SFRNKHKMIFHPLTGLCI----LSKPGMEVQLGNCSKSNHWNHTPENTLEIKGSYLCLKA  448

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
            + L  PAKL   C  + + W  ISDS++HL++ L + S  CLDVDS N +IT +CKCL+ 
Sbjct  449  QGLNLPAKLSTSCRGEGTSWAPISDSKLHLATTLSNNSTACLDVDSQNNLITTSCKCLSE  508

Query  220  DSSCDPASQWFKIID  176
             + CDP SQWFKI D
Sbjct  509  KNKCDPGSQWFKIAD  523



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 142/220 (65%), Gaps = 8/220 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YG L  +W   RN SFLQ+IS++QSP +GPG
Sbjct  342  AAENDVDWSLWALTGSYYLRQGVVGMIEYYGALDSDWISVRNSSFLQKISLLQSPLQGPG  401

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP+TGLCV R +     L LGPC+ S PW YT  K L ++    CLQ+ 
Sbjct  402  -PRTDAYNLVFHPLTGLCVVRSLKDTTMLTLGPCNSSQPWSYTK-KTLRIKDQLLCLQSN  459

Query  397  KLGKPAKLGLF---CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
              G   ++ +    C+   S W+ IS SRMHL++   + +++CLDVD+ N ++ N CKCL
Sbjct  460  --GPKNRVTMTRTSCSKPGSIWQTISASRMHLAATTSNKTSICLDVDATNNVVANACKCL  517

Query  226  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKK  107
            +NDSSC+P SQWFKII +TR   +   ++  S L  L+ K
Sbjct  518  SNDSSCEPMSQWFKIIKATRPLKSLGLYKQISSLDNLSPK  557



>ref|XP_010494994.1| PREDICTED: uncharacterized protein LOC104772040 [Camelina sativa]
Length=363

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  155  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  214

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP+TGLC+ +  + +  L LGPC+ S+PW YT  KAL ++    CLQ+ 
Sbjct  215  -PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTK-KALRIKDRPLCLQSN  272

Query  397  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
                P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  273  GPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATNNNVVANACKCLS  332

Query  223  NDSSCDPASQWFKIIDSTR  167
             DSSC+P SQWFKII +TR
Sbjct  333  KDSSCEPMSQWFKIIKATR  351



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 137/209 (66%), Gaps = 12/209 (6%)
 Frame = -2

Query  748  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYT  569
            +LD DWALW L GSYYLREG   L+E YGVL   W  PRN S L R+  +Q P RGPG  
Sbjct  341  DLDMDWALWALQGSYYLREGVRDLDEVYGVLDRAWSGPRNASALSRVQALQRPLRGPGLD  400

Query  568  ESRLHKLIFHPMTGLCV-RRVSLFQPLELGPCSESDPWGYTAG-KALTV---EGTYFCLQ  404
            +   + ++FHP+TG CV RR S   PLELGPCSE++ W Y+A  + L V   +G+  CL+
Sbjct  401  QVPPYTVLFHPVTGTCVLRRRS--PPLELGPCSETEAWAYSAQEQRLAVAPRDGSSLCLR  458

Query  403  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHL---SSKLKDGSN-VCLDVDSN-NVIITNT  239
            AE  GKPA LG  C D  ++W ++SDS++H+   SS   DG   +CLDV ++   ++TN 
Sbjct  459  AEGAGKPASLGASCGDAMARWRLVSDSKLHVATSSSAAVDGDGALCLDVGADGRSVVTNP  518

Query  238  CKCLNNDSSCDPASQWFKIIDSTRGTTTK  152
            C+CL+ D+SCDP SQWFK++ STR    +
Sbjct  519  CRCLSADNSCDPQSQWFKLVTSTRSVAAE  547



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 134/198 (68%), Gaps = 4/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VGL E+YGVL  +W   RN SFLQ++S++QSP +GP 
Sbjct  342  AAEHDLDWSLWALTGSYYLRQGVVGLNEYYGVLDKDWISVRNSSFLQKLSLLQSPLQGP-  400

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
            + ++  + L+FHP+TGLC VR +     L LGPC+ S+PW YT  KA+ ++    CLQ+ 
Sbjct  401  HPQTDAYNLVFHPLTGLCIVRSLKDTTMLTLGPCNSSEPWSYTK-KAIRIKDQPLCLQSN  459

Query  397  KLGKPAKLGLFCTDDSSK-WEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
                P  L       SS  W+ +S SRMHLSS   + +++CLDVD+ N ++ N CKCL+ 
Sbjct  460  GPKNPVTLTRTSCSTSSSIWQTVSASRMHLSSTTSNKTSLCLDVDATNNVVANACKCLSK  519

Query  220  DSSCDPASQWFKIIDSTR  167
            DS+C+P SQWFKII +TR
Sbjct  520  DSTCEPMSQWFKIIKATR  537



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  335  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQSPFQGPG  394

Query  574  YTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S + + +IFHP++GLCV  V   + LELGPC +S+ W YT G  L ++ T  CLQA+
Sbjct  395  LPNSHQPYNVIFHPLSGLCV-LVKSSEALELGPCDKSNAWNYTKGYELILKQTGQCLQAK  453

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ AKLG  C+  SSKW+++S+S MH+S++L  +G+ VCLD   +  I TN CKCL  
Sbjct  454  SVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLDASPDGNITTNQCKCLTV  513

Query  220  DSSCDPASQWFKIIDSTR  167
            D  C+P SQWFKII S++
Sbjct  514  DPDCNPESQWFKIILSSK  531



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 134/201 (67%), Gaps = 6/201 (3%)
 Frame = -2

Query  733  WALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLH  554
            WALWTL GSYYLREG   L+E YGVL  +W  PRN + L+R+  +Q  FRGPG+ E+  +
Sbjct  345  WALWTLQGSYYLREGVRDLDEVYGVLDRSWRNPRNATALRRVRALQRAFRGPGFAEAAPY  404

Query  553  KLIFHPMTGLCV-RRVSLFQPLELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKP  383
              +FHP TGLCV RR S   PLELG C  ++ W Y A +      +    CL+AE  G+P
Sbjct  405  VALFHPSTGLCVARRSSPVSPLELGSCEGAEAWAYDAQRQRLALRDSPLMCLRAEGAGRP  464

Query  382  AKLGLFC-TDDSSKWEIISDSRMHLSSKLKDGSNV-CLDVDSN-NVIITNTCKCLNNDSS  212
             ++G+ C TD+ ++W ++SDS++H+++    G+ + CLDV ++   ++TNTC+CL+ D+S
Sbjct  465  VRVGMACATDEMARWRLVSDSKLHVAANASSGAGMLCLDVGADGRSVVTNTCRCLSADNS  524

Query  211  CDPASQWFKIIDSTRGTTTKS  149
            CDP SQWFK++ STR    +S
Sbjct  525  CDPESQWFKLVSSTRRVGARS  545



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 138/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  308  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  367

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
              ++  + L+FHP+TGLC V+ ++    L LGPC+ S+PW YT  +AL ++    CLQ+ 
Sbjct  368  -PQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPCNSSEPWSYTK-QALRIKDQPLCLQSN  425

Query  397  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
                P       C+  SSKW+ +S SR+HLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  426  GPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTASNNTSLCLDVDATNNNVVANACKCLS  485

Query  223  NDSSCDPASQWFKIIDSTR  167
             DSSC+P SQWFKII +TR
Sbjct  486  KDSSCEPMSQWFKIIKATR  504



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  342  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  401

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP+TGLC+ +  + +  L LGPC+ S+PW YT  KAL ++    CLQ+ 
Sbjct  402  -PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTK-KALRIKDRPLCLQSN  459

Query  397  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
                P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  460  GPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATNNNVVANACKCLS  519

Query  223  NDSSCDPASQWFKIIDSTR  167
             DSSC+P SQWFKII +TR
Sbjct  520  KDSSCEPMSQWFKIIKATR  538



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  335  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQSPFQGPG  394

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP++GLCV  V   + LELGPC +S+ W YT G  L ++ T  CLQA+
Sbjct  395  LPNSQQPYNVIFHPLSGLCV-LVKSSEALELGPCDKSNAWNYTKGYELILKQTGQCLQAK  453

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ AKLG  C+  SSKW+++S+S MH+S++L  +G+ VCL+   +  I TN CKCL  
Sbjct  454  SVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLEASPDGNITTNQCKCLTV  513

Query  220  DSSCDPASQWFKIIDSTR  167
            D +C+P SQWFKII S++
Sbjct  514  DPNCNPESQWFKIILSSK  531



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GPG
Sbjct  335  AAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQSPFQGPG  394

Query  574  YTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               S+  + +IFHP++GLCV  V   + LELGPC +S+ W YT G  L ++ T  CLQA+
Sbjct  395  LPNSQQPYNVIFHPLSGLCV-LVKSSEALELGPCDKSNAWNYTKGYELILKQTGQCLQAK  453

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  221
             +G+ AKLG  C+  SSKW+++S+S MH+S++L  +G+ VCL+   +  I TN CKCL  
Sbjct  454  SVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLEASPDGNITTNQCKCLTV  513

Query  220  DSSCDPASQWFKIIDSTR  167
            D +C+P SQWFKII S++
Sbjct  514  DPNCNPESQWFKIILSSK  531



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 129/204 (63%), Gaps = 9/204 (4%)
 Frame = -2

Query  733  WALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLH  554
            WALWTL GSYYLR+G + L+E YGVL   W  PRN + L+R+  +Q P RGPGY E+  +
Sbjct  350  WALWTLQGSYYLRQGVLDLDEVYGVLDRAWSSPRNHTALRRVQPLQRPLRGPGYAEAAPY  409

Query  553  KLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYT--AGKALTVEGTYFCLQAEKLGKPA  380
             ++FHP TGLCV R S  QPLELG C+ ++ W Y    G+    +    CL A+  G P 
Sbjct  410  TVLFHPATGLCVLRRSPTQPLELGACANTEAWEYAPQQGRLALRDSPLMCLHAQGAGLPV  469

Query  379  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNN  221
            + G+ C DD S+W ++SDS++H++       +      +CLDVD++   ++TN C+CL+ 
Sbjct  470  RFGMPCDDDMSRWRLVSDSKLHVAVNASSSGSGSGGGMLCLDVDADGQSVVTNPCRCLSA  529

Query  220  DSSCDPASQWFKIIDSTRGTTTKS  149
            D+SCDP +QWFK++ STR     S
Sbjct  530  DNSCDPENQWFKLVTSTRSVAASS  553



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 137/201 (68%), Gaps = 8/201 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  354  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQQISLLQSPLQGPG  413

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP---LELGPCSESDPWGYTAGKALTVEGTYFCLQ  404
               +  + L+FHP+TGLC+ R SL      L LGPC+ S+PW YT  +AL ++    CLQ
Sbjct  414  -PRTDAYNLVFHPLTGLCMVR-SLNDKTMMLTLGPCNSSEPWSYTK-QALRIKDQSLCLQ  470

Query  403  AEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKC  230
            +     P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKC
Sbjct  471  SNGPNNPVTMTRTSCSTSSSKWQTVSASRMHLSSTASNNTSLCLDVDATNNNVVANACKC  530

Query  229  LNNDSSCDPASQWFKIIDSTR  167
            L+ DSSC+P SQWFKII +TR
Sbjct  531  LSKDSSCEPMSQWFKIIKATR  551



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 138/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  342  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  401

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
              ++  + L+FHP+TGLC V+ ++    L LGPC+ S+PW YT  +AL ++    CLQ+ 
Sbjct  402  -PQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPCNSSEPWSYTK-QALRIKDQPLCLQSN  459

Query  397  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
                P       C+  SSKW+ +S SR+HLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  460  GPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTASNNTSLCLDVDATNNNVVANACKCLS  519

Query  223  NDSSCDPASQWFKIIDSTR  167
             DSSC+P SQWFKII +TR
Sbjct  520  KDSSCEPMSQWFKIIKATR  538



>gb|KCW59701.1| hypothetical protein EUGRSUZ_H02460 [Eucalyptus grandis]
Length=262

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 128/184 (70%), Gaps = 5/184 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+LDFDWALWT+ GSYYLR+G VG++E +GVL  ++  PRN SFLQRIS +Q+PF+G  
Sbjct  81   AAKLDFDWALWTIVGSYYLRKGIVGMDETFGVLNKDFSGPRNASFLQRISALQAPFQG-A  139

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
             + +   +++FHP+TGLC++R    + L+LG C+ES+ W +T    + + GT  C+QA++
Sbjct  140  TSSNPTRRILFHPLTGLCIQRKPEQEQLQLGACNESEAWTHTHHHTVRMRGTDLCMQADR  199

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN--VCLDVD-SNNVIITNTCKCLN  224
            L KP KL   C D  S+W+ IS+S MH SS +  GSN  VCLD+D S   +I + CKCL 
Sbjct  200  LEKPVKLSTNCADHGSRWKTISESNMHFSSNIV-GSNVTVCLDIDFSTKTVIASPCKCLR  258

Query  223  NDSS  212
             DS+
Sbjct  259  EDST  262



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 128/197 (65%), Gaps = 10/197 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  337  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHNVHNYTYLQRLSVIQPPHKGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEG--TYFCL  407
               +  HK +FHP+TGLC+ R S      L LGPC++ +PW Y+ G  L ++G     CL
Sbjct  397  IKHNH-HKKLFHPLTGLCLVRKSPCHESELTLGPCTKDEPWSYSHGGTLEIKGGTQRSCL  455

Query  406  QAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKC  230
            + E + GK  KLG  CT    K + IS ++MHLS K KDGS VCLDVDS+N +  N CKC
Sbjct  456  EGETMVGKSVKLGTRCT----KVKRISATKMHLSFKSKDGSLVCLDVDSDNNVFANRCKC  511

Query  229  LNNDSSCDPASQWFKII  179
            L  DSSC+PASQWFKI 
Sbjct  512  LTGDSSCEPASQWFKIF  528



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L G+YYLR+G VGL E+YGVL  +W   RN SFLQ+IS++QS  +GPG
Sbjct  341  AAENDVDWSLWALTGTYYLRQGVVGLNEYYGVLDSDWISVRNSSFLQKISLLQSTLQGPG  400

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP+TGLC VR +     L LGPC+ S+PW YT  K L +E    CLQ+ 
Sbjct  401  -PRTDAYNLVFHPLTGLCLVRSLKDTTMLTLGPCNSSEPWSYTK-KTLRIEDQPLCLQSN  458

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
                P           S+W+ IS SRMHL+      +++CLDVD+ N I+ N CKCL+ D
Sbjct  459  ---GPENRVTMSRTGCSRWQTISASRMHLALTTSKNNSLCLDVDATNNILANPCKCLSKD  515

Query  217  SSCDPASQWFKIIDSTR  167
            SSC P SQWFKII++TR
Sbjct  516  SSCQPMSQWFKIINATR  532



>ref|XP_010662248.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=307

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -2

Query  631  NLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY  452
            N  +L++    ++   GP    +R +K++ HP TGLCV R SL +PL+LGPC+ES+ WGY
Sbjct  130  NGEYLEKAVAYKASLTGPDAPHARPYKMVLHPSTGLCVLRGSLSEPLKLGPCTESEAWGY  189

Query  451  TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD  272
            T  K L ++GTY CLQA  LGKPAKL + C++  S WE ISDS+M+LS+KL +G+ VCLD
Sbjct  190  TPQKILIIKGTYLCLQAVGLGKPAKLSVICSNPGSNWESISDSKMYLSTKLGNGTTVCLD  249

Query  271  VDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  158
            VDS++ I+TN+CKCL+ D  CDP SQWFKI +ST  T+
Sbjct  250  VDSSDDIVTNSCKCLSRDDMCDPGSQWFKIANSTDITS  287



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 131/196 (67%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDIDWAVWALTGVYYFREGKRGVLEAYGMLDANWHNVHNYTYLRRLSVIQPPHKGPG  396

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  404
               +  HK IFHP+TGLC VR+ S ++  L LGPC++ +PW Y+ G  L ++G +  CL+
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSSCYESELMLGPCTKGEPWSYSHGGILEIKGGHKSCLE  455

Query  403  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E  +G+  KLG  CT    K   IS ++MHLS K  DGS VCLDVDS+N ++ N+CKCL
Sbjct  456  GETAVGRSVKLGKKCT----KIMQISATKMHLSLKTNDGSLVCLDVDSDNNVVANSCKCL  511

Query  226  NNDSSCDPASQWFKII  179
              D +C+PASQWFKI 
Sbjct  512  TGDITCEPASQWFKIF  527



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA  D DW+LW L GSYYLREG VGL E+YGVL  +W   RN SFLQ+I+++QS  +GPG
Sbjct  358  AAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLLQSQLQGPG  417

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP TGLC VR ++    L LGPC+ S+PW YT  + L  +    CLQ+ 
Sbjct  418  -PSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPCNSSEPWSYTK-QTLRSKDQSLCLQSN  475

Query  397  KLGKPAKL-GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
              G    +  + C+   S W+ IS S+MHL+S   + ++VCLDVD+++ ++ N CKCL+ 
Sbjct  476  GPGNRVTMTKMDCSSPGSIWQTISASKMHLASTTSNNTSVCLDVDADDNVLANACKCLSK  535

Query  220  DSSCDPASQWFKIIDSTR  167
            DSSC+P SQWF II +TR
Sbjct  536  DSSCEPMSQWFTIIKATR  553



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDMDWAVWALTGVYYFREGKRGVVEAYGMLDANWHNVHNSTYLRRLSVIQPPHKGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  404
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+ G  L ++G +  CL+
Sbjct  397  IRRNH-HKKIFHPLTGLCLVRKSPCHDSELTLGPCTKDEPWSYSHGGTLEIKGGHKSCLE  455

Query  403  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E  +GK  KLG  CT    K + IS ++MHLS +  +GS VCLDVDS+N +I N+CKCL
Sbjct  456  GETAVGKSVKLGKRCT----KVKQISATKMHLSFETDEGSLVCLDVDSDNNVIANSCKCL  511

Query  226  NNDSSCDPASQWFKII  179
              D SC+PASQWFKI 
Sbjct  512  TGDVSCEPASQWFKIF  527



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA  D DW+LW L GSYYLREG VGL E+YGVL  +W   RN SFLQ+I+++QS  +GPG
Sbjct  311  AAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLLQSQLQGPG  370

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP TGLC VR ++    L LGPC+ S+PW YT  + L ++    CLQ+ 
Sbjct  371  -PSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPCNSSEPWSYTK-QTLRIKDQSLCLQSN  428

Query  397  KLGKPAKL-GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
              G    +    C+   S W+ IS S+MHL+S   + ++VCLDV +++ ++ N CKCL+ 
Sbjct  429  GPGNRVTMTKTDCSSPGSIWQTISASKMHLASTTSNNTSVCLDVAADDKVLANACKCLSK  488

Query  220  DSSCDPASQWFKIIDSTR  167
            DSSC+P SQWF II++TR
Sbjct  489  DSSCEPMSQWFTIINATR  506



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 125/196 (64%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W + G YY REG  G+ E YG+L  NW    N ++L+R+S++Q P  GPG
Sbjct  336  AAEKDLDWAVWAVTGVYYFREGKRGVVEAYGMLDANWHNVHNYTYLRRLSVIQPPHTGPG  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVE-GTYFCLQ  404
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+ G  L +  G   CL+
Sbjct  396  VKHNH-HKKIFHPLTGLCLVRKSHCHESELTLGPCTKDEPWSYSHGGILEIRRGHKSCLE  454

Query  403  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E  +GK  KLG  CT    K E IS ++MHLS    DGS VCLDVDS+N ++ N+C CL
Sbjct  455  GETAVGKSVKLGRICT----KIEQISATKMHLSFNTSDGSLVCLDVDSDNNVVANSCNCL  510

Query  226  NNDSSCDPASQWFKII  179
              D++C+PASQWFKI 
Sbjct  511  TGDTTCEPASQWFKIF  526



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 130/198 (66%), Gaps = 5/198 (3%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALWTL GSYYLREG V   E YG+LT++W   RN + LQ++  +Q PF+GPG 
Sbjct  279  ADKDVDWALWTLQGSYYLREGVVDKGESYGMLTYDWAGVRNQTVLQKVRAVQQPFQGPGV  338

Query  571  TESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSES-DPWGYTAGKALTVEGTYFCLQAE  398
            +++  + +I HP TGLCVR+ SL    L+ GPC  +   + YT  + LT   +  C+ A 
Sbjct  339  SKTPPYIIILHPSTGLCVRQGSLTSHTLDFGPCDGNMQAFHYTQQQTLTSVDSSLCVSAT  398

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK-DGSNVCLDVDSNNVIITNTCKCLNN  221
              GKP K    C+D  S W+++SDS MH+S+ L  DGS +CLDV  N V +TN CKCL +
Sbjct  399  GSGKPVKFD-SCSDSGSSWDLVSDSGMHVSTTLPGDGSTLCLDVGQNGV-VTNPCKCLRD  456

Query  220  DSSCDPASQWFKIIDSTR  167
            D++CDP SQWFK++ S +
Sbjct  457  DANCDPGSQWFKLVTSAK  474



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  334  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVIQPPHKGPG  393

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  404
               +  HK IFHP+TGLC VR+   ++  L LGPC++ +PW Y+ G  L ++G +  C++
Sbjct  394  IKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGPCTKDEPWSYSHGDRLEIKGGHKSCVE  452

Query  403  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E  +G+  KLG  CT    K + IS ++MHL+ K  DG  VCLDVDS+N I+ N CKCL
Sbjct  453  GETSVGRSVKLGKKCT----KIKRISATKMHLAFKNNDGLLVCLDVDSDNNIVANHCKCL  508

Query  226  NNDSSCDPASQWFKII  179
              D SC+PASQWFKI 
Sbjct  509  TGDISCEPASQWFKIF  524



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  337  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVIQPPHKGPG  396

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  404
               +  HK IFHP+TGLC VR+   ++  L LGPC++ +PW Y+ G  L ++G +  C++
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGPCTKDEPWSYSHGDRLEIKGGHKSCVE  455

Query  403  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E  +G+  KLG  CT    K + IS ++MHL+ K  DG  VCLDVDS+N I+ N CKCL
Sbjct  456  GETSVGRSVKLGKKCT----KIKRISATKMHLAFKNNDGLLVCLDVDSDNNIVANHCKCL  511

Query  226  NNDSSCDPASQWFKII  179
              D SC+PASQWFKI 
Sbjct  512  TGDISCEPASQWFKIF  527



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 131/197 (66%), Gaps = 10/197 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY+REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDMDWAVWALTGVYYIREGKRGVVESYGMLDANWHNVHNSTYLRRLSVIQQPHKGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTA-GKALTVEGTY-FCL  407
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+  G  L ++G +  CL
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSPCHESELTLGPCTKDEPWSYSHHGGVLEIKGGHKSCL  455

Query  406  QAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKC  230
            ++E  +GK  KLG  CT    K + IS ++MHLS K  +GS VCLDVDS+N ++ N+CKC
Sbjct  456  ESETAVGKSVKLGKKCT----KIKQISATKMHLSFKTNEGSLVCLDVDSDNNVVANSCKC  511

Query  229  LNNDSSCDPASQWFKII  179
            L  D SC+PASQWFKI 
Sbjct  512  LTGDVSCEPASQWFKIF  528



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 128/196 (65%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  334  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVIQPPHKGPG  393

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  404
               +  HK IFHP+TGLC VR+   ++  L LGPC++ +PW Y+ G  L ++G +  C++
Sbjct  394  IKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGPCTKDEPWSYSHGDRLEIKGGHKSCVE  452

Query  403  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E  +G   KLG  CT    K + IS ++MHLS K  DG  VCLDVDS+N ++ N CKCL
Sbjct  453  GETSVGSSVKLGKKCT----KIKRISATKMHLSFKNNDGLLVCLDVDSDNNVVANHCKCL  508

Query  226  NNDSSCDPASQWFKII  179
              D SC+PASQWFKI 
Sbjct  509  TGDISCEPASQWFKIF  524



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 134/211 (64%), Gaps = 23/211 (11%)
 Frame = -2

Query  715  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  536
             GSYYLREG +GL+E YGVL W WC+PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  357  QGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALRRVQALQRPLRGPGLAEAAPYAVLFHP  416

Query  535  MTGLC--VRRVS----LFQPLE--LGPCSESDPWGYTAGK---ALTVEGTYFCLQAEKLG  389
            ++G+C  VRR S    L QP E  LGPCSE+  W Y+A +    L       CL+AE  G
Sbjct  417  VSGMCVVVRRRSPTPTLAQPFELGLGPCSETGAWEYSAQQQRLGLRDTAALLCLRAEGAG  476

Query  388  KPAKLGLFCTDDSSKWEIISDSRMHLS----------SKLKDGSN-VCLDVDSNN-VIIT  245
            +PA LG+ C D  ++W ++SDS++H++              DG+  +CLDV ++   ++T
Sbjct  477  RPATLGVTCGDAMARWSLVSDSKLHVAVNATSSSSAGVSDSDGNGLLCLDVGADGRSVVT  536

Query  244  NTCKCLNNDSSCDPASQWFKIIDSTRGTTTK  152
            N C+CL+ D+SCDP SQWFK++ STR   TK
Sbjct  537  NPCRCLSADNSCDPQSQWFKLVSSTRSVVTK  567



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 126/196 (64%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YY+REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDMDWAVWALTGVYYIREGKRGVVESYGMLDANWHNVHNSTYLRRLSVIQQPHKGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  404
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+ G  L ++G +  CL+
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSPCHESELTLGPCTKDEPWSYSHGGVLEIKGGHKSCLE  455

Query  403  AEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
             E   GK  KLG  CT    K   IS ++MHLS K  +GS VCLDVD +N ++ N CKCL
Sbjct  456  GETAEGKSVKLGKRCT----KIMQISATKMHLSFKTNEGSLVCLDVDPDNNVVANPCKCL  511

Query  226  NNDSSCDPASQWFKII  179
              D SC+PASQWFKI 
Sbjct  512  TGDVSCEPASQWFKIF  527



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 123/208 (59%), Gaps = 12/208 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DWA W L GSY LR+G  G++E YGVL W+W +PRN + L RI  +Q P +GPG
Sbjct  338  AAKHDLDWAYWALQGSYALRQGVAGMDEVYGVLDWSWTKPRNETVLSRIQALQRPIQGPG  397

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVE-------GTY  416
            Y E+  + ++FHP+TGLC    +    LEL PC+E+D W Y    +  V        G  
Sbjct  398  YGEALPYTVLFHPLTGLCAAASAAAGTLELRPCNETDAWAYAPPSSTLVRRDAAAAGGLL  457

Query  415  FCLQAEKLGKPAKLGL-FCTDDSSKWEIISDSRMHLSSKLK---DGSNVCLDVDSNN-VI  251
             CL+AE  G PA+LG   C D  S W I SDS MH++        G  +CLDV ++   I
Sbjct  458  PCLRAEGRGLPARLGTKACGDALSTWRIASDSGMHVAVDAAPELGGGTLCLDVGADGRSI  517

Query  250  ITNTCKCLNNDSSCDPASQWFKIIDSTR  167
            +TN C CL  D +CDP  QWFK++ STR
Sbjct  518  VTNPCACLRGDGTCDPERQWFKLVTSTR  545



>gb|EMT10461.1| Endoglucanase E1 [Aegilops tauschii]
Length=498

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 134/218 (61%), Gaps = 16/218 (7%)
 Frame = -2

Query  712  GSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPM  533
            GSYYLR+G + L+E YGVL   W  PRN + L+R+  +Q P RGPGY E+  + ++FHP 
Sbjct  284  GSYYLRQGVLDLDEVYGVLDRAWSRPRNDTALRRVQPLQRPLRGPGYAEAAPYTVLFHPA  343

Query  532  TGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQAEKLGKPAKLGLFCT  359
            TGLCV R SL QPLELG C++++ W Y    G+    +    CL+A+  G+P +LG  C 
Sbjct  344  TGLCVLRRSLTQPLELGACADTEAWEYAPQQGRLALRDSPLMCLRAQGAGRPVRLGTPCD  403

Query  358  DDSSKWEIISDSRMHLSSKLKDGSN-------VCLDVDSN-NVIITNTCKCLNNDSSCDP  203
            DD S+W ++SDS++H++      S+       +CLDV ++   ++TN C+CL+ D+SCDP
Sbjct  404  DDMSRWRLVSDSKLHVAVNTSSSSSSGSGSGMLCLDVGADGQSVVTNPCRCLSADNSCDP  463

Query  202  ASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  89
             SQWFK++ STR         +   L  L  KL +S I
Sbjct  464  ESQWFKLVSSTRSVA------ANGMLAELPVKLGSSKI  495



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 136/201 (68%), Gaps = 8/201 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++WTL GSYYLREG VG+ EFYG+L  +W   R+ SFLQR+S++ SP +GPG
Sbjct  311  AAENDVDWSIWTLQGSYYLREGVVGMSEFYGILDSDWVRVRSQSFLQRLSLILSPLQGPG  370

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
             ++S+++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    LT++    CL++
Sbjct  371  -SQSKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPQNTLTLKDKSLCLES  428

Query  400  EKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
                 P KL    C+  + S+WE IS S M L++K  + S +CLDVD  N ++ + CKC+
Sbjct  429  TGPNAPVKLSETSCSSPNLSEWETISASNMLLAAKSTNNS-LCLDVDETNNLMASNCKCV  487

Query  226  N-NDSSCDPASQWFKIIDSTR  167
               DSSCDP SQWFKI+  ++
Sbjct  488  KGEDSSCDPISQWFKIVKVSK  508



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 128/203 (63%), Gaps = 15/203 (7%)
 Frame = -2

Query  715  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  536
             GSYYLREG +GL+E YGVL W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  271  QGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHP  330

Query  535  MTGLCVRRV----SLFQP--LELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPA  380
            ++G+CV R     SL QP  L LGPC+E++ W Y+A +      +    CL+AE  G+PA
Sbjct  331  VSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPA  390

Query  379  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNN  221
             L + C D  ++W  +SDS++H++      +       +CLDV ++   ++TN C+CL+ 
Sbjct  391  SLAVSCGDAMARWGFVSDSKLHVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSA  450

Query  220  DSSCDPASQWFKIIDSTRGTTTK  152
            D+SCDP  QWFK++ STR   TK
Sbjct  451  DNSCDPQGQWFKLVSSTRSVVTK  473



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 126/198 (64%), Gaps = 11/198 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W LAG YYLR+G  GL E YG+L  NW    N +FL+RIS++Q P++GPG
Sbjct  339  AAEKDVDWAIWALAGDYYLRQGKRGLVETYGMLNPNWHHIHNSTFLRRISVIQPPYKGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTV---EGTYFC  410
             + ++ H  IFHP+TG CV R S  +   L LGPC   +PW Y       V     +  C
Sbjct  399  VSHNQ-HNRIFHPLTGFCVVRNSRKRRSELTLGPCGRHEPWSYNGHIGTLVMKDHRSVLC  457

Query  409  LQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCK  233
            L+ +   G+  KLG  C    SK E +S S+MHLS K + GS++CLDVDS N ++ N CK
Sbjct  458  LEGDVTGGRRVKLGKKC----SKIERVSASKMHLSFKTRLGSSLCLDVDSMNNVVANPCK  513

Query  232  CLNNDSSCDPASQWFKII  179
            CL+ D+SCDP SQWFKI+
Sbjct  514  CLSKDASCDPTSQWFKIL  531



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 137/226 (61%), Gaps = 18/226 (8%)
 Frame = -2

Query  745  LDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTE  566
            LD DWALW L GSYYLREG  G +E YGVL  +W  PRN + L+R+  +Q PFRGPG  E
Sbjct  361  LDLDWALWALQGSYYLREGVAGHDEAYGVLGHDWLRPRNGTALRRVRALQRPFRGPGLDE  420

Query  565  SRLHKLIFHPMTGLCV---RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYF--CLQA  401
            +  +  +FHP TGLCV   RR SL   LELGPC+E++ W Y     L + G++   CL+A
Sbjct  421  AAPYDALFHPATGLCVVRRRRSSL--TLELGPCNETEAWEYNPEHRLVLRGSWLRPCLRA  478

Query  400  EKLGKPAKLGL---FCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSNN-VI  251
            E  G+P +LG+    C    ++W + S S++H++      S+      +CLDV ++   I
Sbjct  479  EGAGRPVRLGVGRAGCAGAQARWLLESKSKLHVAVHAPPSSSSSRSEILCLDVSADGRSI  538

Query  250  ITNTCKCLNNDSS-CDPASQWFKIIDSTRGTTTKSDFQSTSFLYFL  116
            +TN C+CL+  SS CDP SQWFK++ STR   + S   +   L+ L
Sbjct  539  VTNRCRCLSGGSSRCDPESQWFKLVSSTRKVASGSSVLAQLLLHVL  584



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 135/204 (66%), Gaps = 11/204 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFR---  584
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   RN+SFLQR+S++QSP +   
Sbjct  311  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRNMSFLQRLSLIQSPLQSLP  370

Query  583  GPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFC  410
            GPG ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    LT++    C
Sbjct  371  GPG-SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPDNTLTLKDKSLC  428

Query  409  LQAEKLGKPAKLGLF--CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTC  236
            L+      P KL      + + SKW  IS S M L++K  + S +CLDVD +N +I + C
Sbjct  429  LENTGPNAPVKLSKTSCSSPNLSKWHTISASNMLLAAKSTNNS-LCLDVDESNNLIASNC  487

Query  235  KCLN-NDSSCDPASQWFKIIDSTR  167
            KC+   DSSCDP SQWFKII  ++
Sbjct  488  KCVKGEDSSCDPMSQWFKIIKVSK  511



>gb|KFK38059.1| hypothetical protein AALP_AA3G064700 [Arabis alpina]
Length=449

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 125/196 (64%), Gaps = 9/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            A E D DWA+W L G YYLREG   + E +G+L  NW + RN S+LQR+S++Q P +GPG
Sbjct  259  AVEKDIDWAVWVLTGDYYLREGKRNVVEPFGILDTNWHDARNSSYLQRLSVIQQPHKGPG  318

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTVE-GTYFCLQ  404
               +  HK IFHP+TGLC+ R SL     L LGPC++ +PW Y     L ++     C++
Sbjct  319  LRHNH-HKKIFHPLTGLCIVRESLCHDSELVLGPCTKEEPWSYNNHGTLMIKTHESICVE  377

Query  403  AEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
              K+ GK  KLG  C    SK E IS S+MH S K +DGS +CLDVDS N ++ + CKCL
Sbjct  378  GGKVAGKVVKLGKEC----SKIERISASKMHFSLKDQDGSLICLDVDSKNKVVWSPCKCL  433

Query  226  NNDSSCDPASQWFKII  179
              D++C+P SQWFKI 
Sbjct  434  TGDATCEPESQWFKIF  449



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 128/203 (63%), Gaps = 15/203 (7%)
 Frame = -2

Query  715  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  536
             GSYYLREG +GL+E YGVL W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  355  QGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHP  414

Query  535  MTGLCVRR----VSLFQP--LELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPA  380
            ++G+CV R     SL QP  L LGPC+E++ W Y+A +      +    CL+AE  G+PA
Sbjct  415  VSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPA  474

Query  379  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSNN-VIITNTCKCLNN  221
             L + C D  ++W  +SDS++H++      +       +CLDV ++   ++TN C+CL+ 
Sbjct  475  SLAVSCGDAMARWGFVSDSKLHVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSA  534

Query  220  DSSCDPASQWFKIIDSTRGTTTK  152
            D+SCDP  QWFK++ STR   TK
Sbjct  535  DNSCDPQGQWFKLVSSTRSVVTK  557



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA  D DW+LW L G YYLREG VGL E+YGVL  +W   RN SFLQ+I+++QS  +GPG
Sbjct  341  AAGNDVDWSLWALTGRYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLLQSQLQGPG  400

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
               +  + L+FHP TGLC VR  +    L LGPC+ S+PW YT  + L  +    CLQ+ 
Sbjct  401  -PSTDAYNLVFHPYTGLCLVRSPNDTTMLTLGPCNSSEPWSYTK-QTLRSKDQSLCLQSN  458

Query  397  KLGKPAKLGLF-CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  221
              G    +    C+   S W+ IS S MHL+S   + ++VCLDVD++N ++ N CKCL+ 
Sbjct  459  GPGNRVTMTKRDCSSPGSIWQTISASNMHLASTTSNNTSVCLDVDADNNVLANDCKCLSK  518

Query  220  DSSCDPASQWFKIIDSTR  167
            DSSC+P SQWF I  +TR
Sbjct  519  DSSCEPMSQWFTITKATR  536



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 127/203 (63%), Gaps = 15/203 (7%)
 Frame = -2

Query  715  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  536
             GSYYLREG +GL+E YGVL W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  355  QGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHP  414

Query  535  MTGLCVRR----VSLFQP--LELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPA  380
            ++G+CV R     SL QP  L LGPC+E++ W Y+A +           CL+AE  G+PA
Sbjct  415  VSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQRLALRNAALLCLRAEGAGRPA  474

Query  379  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNN  221
             L + C D  ++W  +SDS++H++      +       +CLDV ++   ++TN C+CL+ 
Sbjct  475  SLAVSCGDAMARWGFVSDSKLHVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSA  534

Query  220  DSSCDPASQWFKIIDSTRGTTTK  152
            D+SCDP  QWFK++ STR   TK
Sbjct  535  DNSCDPQGQWFKLVSSTRSVVTK  557



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 135/198 (68%), Gaps = 9/198 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++WTL GSYYLREG VG+ E+YG+L  +W   R+ +FLQR+S++QSP +GPG
Sbjct  311  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGILDSDWVRVRSQNFLQRLSLIQSPLQGPG  370

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKA-LTVEGTYFCLQ  404
             ++S+++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT     LT++    CL+
Sbjct  371  -SQSKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPENTLLTLKDKSLCLE  428

Query  403  AEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKC  230
                  P KL    C+  + SKWE IS S M L++K  + S +CLDVD +N +I + CKC
Sbjct  429  TTGPNAPVKLSEASCSSPNLSKWETISASNMLLAAKSTNNS-LCLDVDESNNLIASNCKC  487

Query  229  LN-NDSSCDPASQWFKII  179
            +   DSSCDP SQWFKI+
Sbjct  488  VKGEDSSCDPISQWFKIV  505



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 135/197 (69%), Gaps = 8/197 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   R+ SFLQR+S++QSP +GPG
Sbjct  358  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRSFLQRLSLIQSPLQGPG  417

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
             ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    L ++    CL++
Sbjct  418  -SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPDNTLKLKEKSLCLES  475

Query  400  EKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
                 P KL  + C+  + SKW+ IS S M L++K  + S +CLDVD +N ++ + CKC+
Sbjct  476  TGSNVPVKLSKMSCSSPNLSKWQSISASNMLLAAKSSNNS-LCLDVDESNNLMASDCKCV  534

Query  226  N-NDSSCDPASQWFKII  179
               D+SCDP SQWFKI+
Sbjct  535  KGEDTSCDPTSQWFKIV  551



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 134/197 (68%), Gaps = 8/197 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   R+  FLQR+S++QSP +GPG
Sbjct  337  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRIFLQRLSLIQSPLQGPG  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
             ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    L ++    CL++
Sbjct  397  -SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESRPWSYTPDNTLKLKEKSLCLES  454

Query  400  EKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
                 P KL  + C+  + SKW+ IS S M L++K  + S +CLDVD +N ++ + CKC+
Sbjct  455  TGSNAPVKLSKMSCSSPNLSKWQTISASNMLLAAKSSNNS-LCLDVDESNNLMASDCKCV  513

Query  226  N-NDSSCDPASQWFKII  179
               D+SCDP SQWFKI+
Sbjct  514  KGEDNSCDPTSQWFKIV  530



>ref|XP_010266913.1| PREDICTED: plastocyanin, chloroplastic-like [Nelumbo nucifera]
Length=290

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -2

Query  577  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
            G    R + +IFHP TGLCV R SL +PL+LG C+ES+PW Y+  + L ++GTYFC+QA+
Sbjct  117  GRPRGRPYNMIFHPPTGLCVLRKSLTEPLQLGSCAESEPWKYSPQQILFLKGTYFCMQAD  176

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  218
             LGKPAKLG+ CTD  S W++ISD  MHLSS L DG+ VCLDVDSNN I+TN+CK  + D
Sbjct  177  GLGKPAKLGIMCTDPGSNWDVISDGNMHLSSNLVDGTAVCLDVDSNNNIVTNSCKYSSED  236

Query  217  SSCDPASQWFKIIDSTR  167
             + D ASQWF+I+ +++
Sbjct  237  HTPDSASQWFEIVRNSK  253



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 132/225 (59%), Gaps = 29/225 (13%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L GSY LR+G  G +E YGVL W+W +PRN + L RI  +Q P RGPG
Sbjct  339  AAELDLDWALWALQGSYALRQGVAGADEVYGVLDWSWSKPRNATALSRIQSLQRPLRGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRR------VSLFQPLELGPCSESDPWGYTA-GKALTVEGTY  416
            Y E+R + ++FHP+TG CV R       +    LELG C ++D W YT     L + G  
Sbjct  399  YDEARPYTVLFHPLTGRCVVRRAADDAAAAAATLELGRCEDTDAWAYTQPASTLAMRGAG  458

Query  415  -----FCLQAEKLGKPAKLGLF----CTDDS-SKWEIISDSRMHLS---------SKLKD  293
                  CL+AE  G+PA+L       C  D+ S W ++S S MH++         S+   
Sbjct  459  RGSPPLCLRAEGSGRPARLATSDAGGCRGDALSTWRLVSGSTMHVAVNATTTTTPSRDGG  518

Query  292  GSNVCLDV-DSNNVIITNTCKCLNNDSS--CDPASQWFKIIDSTR  167
            G  +CLDV D    ++TN C+CL++ ++  CDP +QWFK++ STR
Sbjct  519  GGLLCLDVGDDGRSVVTNPCRCLDDAAAGECDPETQWFKLVTSTR  563



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 124/221 (56%), Gaps = 25/221 (11%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA W L GSY LR+G VG++E YGVL W+W +PRN + L RI  +Q P +GPG
Sbjct  340  AAEHDVDWAYWALQGSYALRQGVVGMDEVYGVLDWSWSKPRNQTVLPRIQALQRPLQGPG  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQ---PLELGPCSESDPWGYTA--------GKALTV  428
            Y E+  + ++FHP+TGLC  R +       LELGPC+E+D W Y            A   
Sbjct  400  YGEALPYTVLFHPLTGLCAVRRASAAAATTLELGPCNETDAWAYAPPSSTLVLRDAAAAA  459

Query  427  EGTYFCLQAEKLGKPAKLGL-FCTDDSSKWEIISDSRMHLS------------SKLKDGS  287
             G   CL+AE  G+PA+LG   C D  S W + +DS MH++                   
Sbjct  460  GGLPTCLRAEGRGQPARLGTNACGDPLSTWRLATDSAMHVAVDAAALGLGGGEDGGGGSG  519

Query  286  NVCLDVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  167
             +CLDV ++   I+TN C C   D +CDP  QWFK++ STR
Sbjct  520  MLCLDVGTDGRSIVTNPCACQRGDGACDPEGQWFKLVTSTR  560



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 6/202 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++W L GSYYLREG VG+ E+YGVL  +W   RN SF+QR+S++QS  +GP 
Sbjct  258  AAENDIDWSIWALQGSYYLREGVVGMTEYYGVLDSDWISVRNNSFMQRLSLIQSTLQGPD  317

Query  574  YTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
              +  +  LIFHP+TGLC+ + SL    + LG C++S PW YT    L ++    CL   
Sbjct  318  -PQPEVSNLIFHPLTGLCMLQSSLDLTKVNLGRCNQSQPWDYTTDNTLKLKNIPLCLANT  376

Query  397  KLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
                P KL    C+  S S+W+ IS S M L++K  + S +CLDVD +N ++   CKC+N
Sbjct  377  GPNAPVKLSEASCSIPSLSQWQPISASNMLLAAKSTNNS-LCLDVDGDNNVVATNCKCVN  435

Query  223  -NDSSCDPASQWFKIIDSTRGT  161
              D+SCDP SQWFKI+   +  
Sbjct  436  GEDTSCDPMSQWFKIVKVNKAN  457



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 126/201 (63%), Gaps = 6/201 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++W L GSYYLREG VG+ E+YGVL  +W   RN SF+QR+S++QS  +GP 
Sbjct  336  AAENDIDWSIWALQGSYYLREGVVGMTEYYGVLNSDWISVRNNSFMQRLSLIQSTLQGPD  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
              +  +  LIFHP+TGLC+ + SL    + LG C++S PW YT    L ++    CL   
Sbjct  396  -PQPEVSNLIFHPLTGLCMLQSSLDPTKVNLGRCNQSQPWDYTTDNTLKLKNIPLCLANT  454

Query  397  KLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
                P KL    C+  S S+W+ IS S M L++K  + S +CLDVD +N ++   CKC+N
Sbjct  455  GPNAPVKLSEASCSTPSLSQWQPISASNMLLAAKSTNNS-LCLDVDGDNNVVATNCKCVN  513

Query  223  -NDSSCDPASQWFKIIDSTRG  164
              DSSCDP SQWFKI+   + 
Sbjct  514  GEDSSCDPMSQWFKIVKVNKA  534



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 128/216 (59%), Gaps = 20/216 (9%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA W L GSY LR+G  G++E YGVL W+W +PRN + L RI  +Q P +GPG
Sbjct  323  AAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQALQRPLQGPG  382

Query  574  YTESRLHKLIFHPMTGLC-VRR-VSLFQPLELGPCSESDPWGYTAGKALTV-----EGTY  416
            Y E+  + ++FHP+TGLC VRR  ++   LELGPC+E+D W Y    +  V         
Sbjct  383  YGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGPCNETDAWAYAPPSSTLVLRDAAAAGL  442

Query  415  FCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRMHLS-----------SKLKDGSNVCLD  272
             CL+AE  G+PA+LG+  C D  S W + +DS MH++                G  +CLD
Sbjct  443  PCLRAEGPGQPARLGIRDCGDPMSTWRLATDSGMHVAVDAALGLGGGEDGGGGGGMLCLD  502

Query  271  VDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  167
            V ++   I+TN C C   D +CDP  QWFK++ STR
Sbjct  503  VGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTSTR  538



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 128/216 (59%), Gaps = 20/216 (9%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA W L GSY LR+G  G++E YGVL W+W +PRN + L RI  +Q P +GPG
Sbjct  339  AAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQALQRPLQGPG  398

Query  574  YTESRLHKLIFHPMTGLC-VRR-VSLFQPLELGPCSESDPWGYTAGKALTV-----EGTY  416
            Y E+  + ++FHP+TGLC VRR  ++   LELGPC+E+D W Y    +  V         
Sbjct  399  YGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGPCNETDAWAYAPPSSTLVLRDAAAAGL  458

Query  415  FCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRMHLS-----------SKLKDGSNVCLD  272
             CL+AE  G+PA+LG+  C D  S W + +DS MH++                G  +CLD
Sbjct  459  PCLRAEGPGQPARLGIRDCGDPMSTWRLATDSGMHVAVDAALGLGGGEDGGGGGGMLCLD  518

Query  271  VDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  167
            V ++   I+TN C C   D +CDP  QWFK++ STR
Sbjct  519  VGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTSTR  554



>ref|XP_006378255.1| hypothetical protein POPTR_0010s05970g [Populus trichocarpa]
 gb|ERP56052.1| hypothetical protein POPTR_0010s05970g [Populus trichocarpa]
Length=120

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  505  LFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISD  326
            +  PL LG C+ES+ W YT  K L+V+GTYFCLQ +   KPAKLG+ CTD +SKWE ISD
Sbjct  1    MLAPLRLGRCTESEAWSYTPQKILSVKGTYFCLQTDDAAKPAKLGIICTDSNSKWETISD  60

Query  325  SRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  158
            S+MHLSS    G  VCLD+DSNN I+TNTCKCL+ D++CDP SQWFK+++STR +T
Sbjct  61   SKMHLSSNASSGITVCLDIDSNNTIVTNTCKCLSKDNACDPESQWFKLVNSTRSST  116



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 6/202 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++W L GSYY+REG VG+ E+YGVL  +W   RN SF+QR+S++QS  +GP 
Sbjct  258  AAENDIDWSIWGLQGSYYIREGVVGMTEYYGVLDSDWISVRNNSFMQRLSLIQSTLQGPD  317

Query  574  YTESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
              +  +  LIFHP+TGLC+ + SL    + LG C++S PW YT    L ++    CL   
Sbjct  318  -PQPDVSNLIFHPLTGLCMLQSSLDPTKVNLGRCNQSQPWDYTTENTLKLKNIPLCLANT  376

Query  397  KLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
                P KL    C+  S S+W+ IS S M L++K  + S +CLDVD +N ++   CKC+N
Sbjct  377  GPNAPLKLSETSCSIPSLSQWQPISASNMLLAAKSTNNS-LCLDVDGDNNVVATNCKCVN  435

Query  223  -NDSSCDPASQWFKIIDSTRGT  161
              DSSCDP SQWFKI+   +  
Sbjct  436  GEDSSCDPMSQWFKIVKVNKAN  457



>gb|KEH20758.1| cellulase (glycosyl hydrolase family 5), putative [Medicago truncatula]
Length=154

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = -2

Query  589  FRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFC  410
            F GPG T    HKL+FHP TGLCV R SL +PL+L PCS SD W YT  K L+V+GTYFC
Sbjct  35   FTGPGITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCSLSDGWNYTPQKILSVKGTYFC  94

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGS-NVCLDVDSNNVIITNTCK  233
            +QA K G PA L + C++ +SKW++ISDS++HLSSK+  GS NVCLDV+ NN+I+TN CK
Sbjct  95   IQAVKEGMPATLSILCSNPNSKWDMISDSKLHLSSKINSGSTNVCLDVNDNNIIVTNACK  154



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W LAG YYLR G   + E YGVL  NW + RN SFLQ++S +Q PFRGPG
Sbjct  334  AAENDLDWAVWALAGDYYLRTGDTNMVETYGVLDANWIDVRNTSFLQQLSGIQLPFRGPG  393

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                    L+FHP+TGLC+    S   P L LGPC++S+P  Y   K   +     C++A
Sbjct  394  LQS---KNLLFHPLTGLCISNNPSANSPTLRLGPCAKSEPSTYNP-KEGNLWINKMCVEA  449

Query  400  EK-LGKPAKL--GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCK  233
               +G+  KL  G  C    SK   IS ++MHLS K  +G  +CLDVD  +N I+ N CK
Sbjct  450  PNVVGQKVKLRVGTRC----SKLGQISATKMHLSFKTSNGLLLCLDVDQRDNSIVANPCK  505

Query  232  CLNNDSSCDPASQWFKII  179
            CL  D+SCDPASQWFK++
Sbjct  506  CLTRDASCDPASQWFKVL  523



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 8/180 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW+LW L GSYYLR+G VGL E+YG L  +W   RN SFLQ++ ++QS  +GPG
Sbjct  318  AAENDVDWSLWALTGSYYLRQGVVGLNEYYGALDTDWNSVRNSSFLQKLYLLQSSLQGPG  377

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
                  + L+ HP+TGLC VR ++    L LGPC+ S+PW YT  K L ++    CLQ+ 
Sbjct  378  -PRIDAYNLVLHPLTGLCLVRSLNDKTMLTLGPCNSSEPWSYTK-KTLKIKDQSLCLQSN  435

Query  397  KLGKPAKLGLF---CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
              G   ++ +    C+   SKWE IS SRMHL+S   + +++CLDVD+ N ++ N CKCL
Sbjct  436  --GPKNRITMTRTSCSRPDSKWETISASRMHLASTTSNKTSLCLDVDATNNVVANACKCL  493



>emb|CDY26627.1| BnaA09g46500D [Brassica napus]
Length=337

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 118/196 (60%), Gaps = 28/196 (14%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DW+LW L G+YYLR G VGL E+YGVL  +W   RN SFLQ+I ++QS  +GPG
Sbjct  149  AAKNDVDWSLWALTGTYYLRLGVVGLNEYYGVLDSDWISVRNSSFLQKIYLLQSTLQGPG  208

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  395
               +  + L+FHP+TGLC+             CS  D    TA   L  +        +K
Sbjct  209  -PRTDAYNLVFHPLTGLCL------------VCSLKD----TAMLTLVTD--------QK  243

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  215
            +G P  LG    +  S+W+ IS SRMHL+      +++CLDVD+ N I+ N CKCL+ DS
Sbjct  244  IGLPC-LGRVVRE--SRWQTISASRMHLALTTSKNNSLCLDVDATNNILANPCKCLSKDS  300

Query  214  SCDPASQWFKIIDSTR  167
            SC P SQWFKII++TR
Sbjct  301  SCQPMSQWFKIINATR  316



>emb|CDY38093.1| BnaC02g06800D [Brassica napus]
Length=415

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 112/195 (57%), Gaps = 8/195 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR GT  + E YGVL   W   RN ++LQ++S +Q PFRGPG
Sbjct  226  AAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPG  285

Query  574  YTESRLHKLIFHPMTGLCV--RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
              E    KLI HP TGLCV          L L  C++S+P  +   + +           
Sbjct  286  LQEK---KLILHPHTGLCVTNNHSGNVPTLRLELCTKSEPSTFDPKEGILWINKMCVETP  342

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            +  G+  KLG+      SK   IS ++MHLS K  +G  +CLDVD  +N I+ N CKCL 
Sbjct  343  DVAGQKVKLGV--GTKCSKLGQISATKMHLSFKTSNGLLLCLDVDERDNSIVANPCKCLT  400

Query  223  NDSSCDPASQWFKII  179
             D+SCDPA+QWFK++
Sbjct  401  KDASCDPANQWFKVL  415



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 121/201 (60%), Gaps = 7/201 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++W L GSYY+REG  G+ E+YG+L  +    R++ FL R+S++Q+  +GP 
Sbjct  336  AAENDVDWSIWALTGSYYIREGVAGMVEYYGMLDSDGISIRSIGFLLRLSLIQTLLQGP-  394

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
              + +++ L+FHP+TGLC V+  S    + LG C+ S  W YT    L ++    CL+  
Sbjct  395  VPQPKVYNLVFHPLTGLCMVQTSSDPNKVTLGTCNTSPQWSYTLDNTLKIKDKSLCLENT  454

Query  397  KLGKPAKLGLFC--TDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
               +  KL      + + SKW+ IS S  M L+SK  D S +CLDVD +  I+   CKC+
Sbjct  455  GPNQRVKLSETSCWSPNLSKWQTISGSINMLLASKSSDNS-LCLDVDGHKNIVATNCKCV  513

Query  226  N-NDSSCDPASQWFKIIDSTR  167
               DSSCDP SQWFKI+  +R
Sbjct  514  KGEDSSCDPTSQWFKIVKVSR  534



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 112/195 (57%), Gaps = 8/195 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR GT  + E YGVL   W   RN ++LQ++S +Q PFRGPG
Sbjct  334  AAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPG  393

Query  574  YTESRLHKLIFHPMTGLCV--RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
              E    KL+ HP TGLCV          L L  C++S+   +   + +           
Sbjct  394  LQEK---KLVLHPHTGLCVTTNHSGNVPTLRLELCTQSESSTFNPKEGILWVNKMCVETP  450

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            +  G+  KLG+      SK   IS ++MHLS K  +G  +CLDVD  +N+I+ N CKCL 
Sbjct  451  DVAGQKVKLGV--GSKCSKLGQISATKMHLSFKTSNGLLLCLDVDERDNIIVANPCKCLT  508

Query  223  NDSSCDPASQWFKII  179
             D+SCDPASQWFK++
Sbjct  509  KDASCDPASQWFKVL  523



>ref|XP_009387704.1| PREDICTED: uncharacterized protein LOC103974573 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  583  GPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQ  404
            G  Y   R   +IFHP TG CV R S+  PL LGPC++SD W YT  K L V+GTYFCLQ
Sbjct  41   GQVYASRRPSNVIFHPPTGSCVLRKSVTDPLRLGPCNQSDDWNYTPQKFLVVKGTYFCLQ  100

Query  403  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  224
            +   GKPAKLG+ C++  S W+I S S+  +S +L DG+ +CLDVD  N +ITN C CL 
Sbjct  101  SVDSGKPAKLGIVCSESDSSWDITSKSKAQISKELPDGTALCLDVDPENTLITNPCLCL-  159

Query  223  NDSSCDPASQWFK  185
            +  +CD  SQWF+
Sbjct  160  SIGTCDRESQWFE  172



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 117/197 (59%), Gaps = 5/197 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A+ D DWALWTL GSYY REG  G EE Y VL +NW +PR+  +L+R++I+Q   + P 
Sbjct  339  VADKDLDWALWTLQGSYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPN  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
                  + L+ HP +G CV  V     +    C E   W ++  G  + + G+  CL+A 
Sbjct  399  SIALSYYVLV-HPESGFCV-NVEGQDNVHGSSCRERSKWSHSGDGSPIQLVGSELCLKAV  456

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  224
              G P  L   C    + W+++SDS +H+++  + G+++CL+  S+N   I+T +C CLN
Sbjct  457  GDGVPVALSTDCKSPWATWKLVSDSMLHIAAMDEQGNSLCLESTSSNYSSILTRSCACLN  516

Query  223  NDSSCDPASQWFKIIDS  173
            N+++CDP SQWF+++ S
Sbjct  517  NETNCDPQSQWFRLVPS  533



>ref|XP_010932263.1| PREDICTED: uncharacterized protein LOC105052971 [Elaeis guineensis]
Length=194

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = -2

Query  562  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  383
            R + +IFHP T  CV R SL +PL+LGPC++SD W YT  K L V+GTYFCLQA   GKP
Sbjct  47   RPNNIIFHPSTNSCVLRQSLNEPLKLGPCNQSDGWTYTPQKLLMVKGTYFCLQAVDSGKP  106

Query  382  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDP  203
            A+LG+ C+ D S+WE+ S  + HLS+K  DGS +CLDVD  N +ITN C CL+N+  C+ 
Sbjct  107  ARLGIVCSSD-SEWEVTSSGKPHLSTKKADGSFLCLDVDPGNTLITNPCLCLSNE-RCEA  164

Query  202  ASQWFKI  182
             +QWF+I
Sbjct  165  DNQWFEI  171



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 111/195 (57%), Gaps = 8/195 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR GT  + E YGVL   W   RN ++LQ++S +Q PFRGPG
Sbjct  334  AAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPG  393

Query  574  YTESRLHKLIFHPMTGLCV--RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
              E    KLI HP TGLCV          L L  C++S+   +   + +           
Sbjct  394  LQEK---KLILHPHTGLCVTNNHSGNVPTLRLELCTQSESSTFNPKEGILWVNKMCVETP  450

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  224
            +  G+  KLG+      SK   IS ++MHLS K  +G  +CLDVD  +N I+ N CKCL 
Sbjct  451  DVAGQKVKLGV--GSKCSKLGPISATKMHLSFKTSNGLLLCLDVDERDNSIVANPCKCLT  508

Query  223  NDSSCDPASQWFKII  179
             D+SCDPASQWFK++
Sbjct  509  KDASCDPASQWFKVL  523



>ref|XP_008807477.1| PREDICTED: uncharacterized protein LOC103719832 [Phoenix dactylifera]
Length=175

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = -2

Query  550  LIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG  371
            +IFHP T  CV R SL +PL+LGPC++SD W YT  K L V GTYFCLQA   GKPA+LG
Sbjct  49   VIFHPSTRSCVLRKSLNEPLKLGPCNQSDAWSYTPQKILMVRGTYFCLQAVDSGKPARLG  108

Query  370  LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQW  191
            + C+ D S+WE+ S ++ HLS+K  DGS +CLDVD  N +ITN C CL+N   C+  +QW
Sbjct  109  VVCSSD-SEWEVTSSAKPHLSTKRADGSLLCLDVDPGNTLITNPCLCLSNQ-RCEADNQW  166

Query  190  FKI  182
            F+I
Sbjct  167  FEI  169



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DWA+W L G YYLR G   + E +G+L  NW + RN ++LQ++S +Q PF+GPG
Sbjct  334  AAQNDLDWAVWALTGDYYLRTGKTDMVETFGILDANWKDVRNATYLQQLSGIQYPFKGPG  393

Query  574  YTESRLHKLIFHPMTGLCVRR--VSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                     IFHP++GLCV          L LGPC ++D   +   + + +     C++A
Sbjct  394  LQSK---NAIFHPLSGLCVTHNPSDKLPTLRLGPCPKADTSTFNPNEGI-LWINKMCVEA  449

Query  400  EKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  227
              + G+  KLG+      SK   I+ ++MHL+ K  +G  +CLDVD  +N ++ N CKCL
Sbjct  450  PNVAGQKVKLGV--GTKCSKLGQIAATKMHLAFKTSNGLLLCLDVDERDNSVVANPCKCL  507

Query  226  NNDSSCDPASQWFKII  179
              D+SCDPASQWFK++
Sbjct  508  TKDASCDPASQWFKVL  523



>emb|CBI34407.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AE D DWALWTL  SYY REG  G EE Y VL +NW +PR+  +L+R++I+Q   + P 
Sbjct  280  VAEKDLDWALWTLQASYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPN  339

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
             T +  + LI H  +G CV  V     +    C E   W +   G  + + G   CL+A 
Sbjct  340  ST-TLSYYLIVHTESGFCV-NVEGEDNVHGSSCRERSKWSHGGDGWPIRLVGGELCLKAV  397

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  224
              G P  L   C    + W+++SDSR+H+++  + G+++CL+  S+N   I+T  C C+ 
Sbjct  398  GDGVPVTLSTDCKSPRATWKLVSDSRLHVAAMDEQGNSLCLEATSSNYSSILTRRCACVK  457

Query  223  NDSSCDPASQWFKIIDST  170
            N+++CDP SQWFK++ S 
Sbjct  458  NEANCDPQSQWFKLVPSN  475



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P RGPG
Sbjct  335  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVRGPG  394

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                   KL+FHP TGLCV   +S   P L L  C +++P  +   + + +     C++A
Sbjct  395  LQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGI-LWSNKMCVEA  450

Query  400  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  227
             + +G+  KLG       SK    S + MHLS K  +GS +CLDVD  +N I+ N CKCL
Sbjct  451  PDAVGQKVKLG--AGTKCSKLGQTSATHMHLSFKTNNGSLICLDVDELDNSIVANPCKCL  508

Query  226  NNDSSCDPASQWFKII  179
              D+SCDPASQWFK++
Sbjct  509  TMDASCDPASQWFKVL  524



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 114/197 (58%), Gaps = 5/197 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AE D DWALWTL  SYY REG  G EE Y VL +NW +PR+  +L+R++I+Q   + P 
Sbjct  333  VAEKDLDWALWTLQASYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPN  392

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
             T +  + LI H  +G CV  V     +    C E   W +   G  + + G   CL+A 
Sbjct  393  ST-TLSYYLIVHTESGFCV-NVEGEDNVHGSSCRERSKWSHGGDGWPIRLVGGELCLKAV  450

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  224
              G P  L   C    + W+++SDSR+H+++  + G+++CL+  S+N   I+T  C C+ 
Sbjct  451  GDGVPVTLSTDCKSPRATWKLVSDSRLHVAAMDEQGNSLCLEATSSNYSSILTRRCACVK  510

Query  223  NDSSCDPASQWFKIIDS  173
            N+++CDP SQWFK++ S
Sbjct  511  NEANCDPQSQWFKLVPS  527



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DWA+W L G YYLR G   + E YG+L  NW + RN ++LQ++S +Q PFRGPG
Sbjct  334  AAQNDLDWAVWALTGDYYLRSGKTDMAETYGILNPNWKDVRNATYLQKLSGIQQPFRGPG  393

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                +   ++FHP +GLCV    S   P L LGPC ++D   +   + + +     C++ 
Sbjct  394  L---QTKNVLFHPSSGLCVTNNPSDRSPTLRLGPCPKADTSAFNINEGI-LWVNKMCVKI  449

Query  400  EKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  227
                G+  +LG+    + SK   I+ ++MH S K  +G  +CLDVD  +N ++ N CKCL
Sbjct  450  PSFAGQKVELGV--GTNCSKLGQIAATKMHWSFKTSNGLLLCLDVDERDNSVVVNPCKCL  507

Query  226  NNDSSCDPASQWFKII  179
              D SCDPASQWFK++
Sbjct  508  TKDGSCDPASQWFKVL  523



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 114/206 (55%), Gaps = 12/206 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A+ D DWALWTL GSYY R+G VG EE YGVL +NW +PRN  FL+RI I+Q   + P 
Sbjct  339  VAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLDYNWDKPRNPKFLKRIRILQDILQDPN  398

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGP-CSESDPWGYTA-GKALTVEGTYFCLQA  401
                + H LIFHP +G CV      Q    G  C +   W +   G A+ + G+  CL+A
Sbjct  399  SNVPKYH-LIFHPRSGRCVSVKGEGQDQIHGRNCKKGSRWSHDGNGGAIRLMGSGLCLKA  457

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKCL  227
               G PAKL   C+   ++W++IS S++H+++  + G  +CLD  ++N   I+T TC C 
Sbjct  458  VGDGLPAKLSTDCSSPQARWKLISKSKLHIAAMDEQGKPLCLDGKNSNSSSILTRTCICA  517

Query  226  NNDSS-------CDPASQWFKIIDST  170
              D          +P  QWFK + S 
Sbjct  518  LQDGDGSDLDCLTNPQRQWFKFVPSN  543



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P RGPG
Sbjct  335  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVRGPG  394

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                   KL+FHP TGLCV   +S   P L L  C +++P  +   + + +     C++A
Sbjct  395  LQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGI-LWSNKMCVEA  450

Query  400  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  227
             + +G+  KLG       SK    S + MHLS K  +GS +CLDVD  +N I+ N CKCL
Sbjct  451  PDAVGQKVKLG--AGTKCSKLGQTSATHMHLSFKTNNGSLICLDVDERDNSIVANPCKCL  508

Query  226  NNDSSCDPASQWFKII  179
              D+SCDPA+QWFK++
Sbjct  509  TMDASCDPATQWFKVL  524



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 114/206 (55%), Gaps = 12/206 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A+ D DWALWTL GSYY R+G VG EE YGVL +NW +PRN  FL+RI I+Q   + P 
Sbjct  355  VAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLDYNWDKPRNPKFLKRIRILQDILQDPN  414

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGP-CSESDPWGYTA-GKALTVEGTYFCLQA  401
                + H LIFHP +G CV      Q    G  C +   W +   G A+ + G+  CL+A
Sbjct  415  SNVPKYH-LIFHPRSGRCVSVKGEGQDQIHGRNCKKGSRWSHDGNGGAIRLMGSGLCLKA  473

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKCL  227
               G PAKL   C+   ++W++IS S++H+++  + G  +CLD  ++N   I+T TC C 
Sbjct  474  VGDGLPAKLSTDCSSPQARWKLISKSKLHIAAMDEQGKPLCLDGKNSNSSSILTRTCICA  533

Query  226  NNDSS-------CDPASQWFKIIDST  170
              D          +P  QWFK + S 
Sbjct  534  LQDGDGSDLDCLTNPQRQWFKFVPSN  559



>emb|CDY21995.1| BnaC09g01010D [Brassica napus]
Length=178

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = -2

Query  610  ISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-  434
            +S +QSP +GPG  E++  K++FHP TGLC+ R SLFQ L+L  C+  + +  ++   L 
Sbjct  2    LSSIQSPLQGPGLMETQPKKIMFHPATGLCIVRNSLFQ-LKLSSCNGPERFILSSHGVLS  60

Query  433  -TVEGTYFCLQAEKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-  263
             T E  +FCL+  + GK  KL LF ++ +SSKW+++S+S+M LS   KDG +VCLDVDS 
Sbjct  61   RTEEHVFFCLKVYEEGKSVKLRLFSSESNSSKWKVLSESKMQLSLVTKDGESVCLDVDSG  120

Query  262  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  167
            +  I+T +CKCL  + SCDP SQWFK++ +TR
Sbjct  121  SGNIVTKSCKCLEGNGSCDPTSQWFKLVTNTR  152



>emb|CBI16819.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 3/94 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELDFDWALWTL GSYY REG +GLEEFYG+L WNWCE RN SFLQRIS +QSPF+GP 
Sbjct  211  AAELDFDWALWTLVGSYYTREGVIGLEEFYGLLNWNWCEVRNSSFLQRISALQSPFQGPD  270

Query  574  YTESRLHKLIFHPMTGLCV---RRVSLFQPLELG  482
             +++R HK+IFHP TGLC+   +R+S F+ +  G
Sbjct  271  LSDARPHKVIFHPATGLCIVWKKRISAFKQMGQG  304



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   R+ SFLQR+S++QSP +GPG
Sbjct  359  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRSFLQRLSLIQSPLQGPG  418

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
             ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    L ++    CL++
Sbjct  419  -SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPDNTLRLKDKSLCLES  476

Query  400  EKLGKPAKL-GLFCTDDS-SKWEIISDSRMHLSSK  302
                 P KL  + C+  + SKW+  S S M L++K
Sbjct  477  TGSNAPVKLSNMSCSSPNLSKWQTTSASNMLLAAK  511



>emb|CDX69431.1| BnaA10g17800D [Brassica napus]
Length=418

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 11/197 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P RGPG
Sbjct  228  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVRGPG  287

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                   KL+FHP +GLCV   +S   P L L  C +++P  +   +   +     C++A
Sbjct  288  LQSK---KLLFHPTSGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGF-LWSNKLCVEA  343

Query  400  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK-LKDGSNVCLDVDS-NNVIITNTCKC  230
             + +G+  KLG+      SK    S + MHLS K   +GS +CLDVD  +N I+ N CKC
Sbjct  344  PDAVGQKVKLGV--GTKCSKLGQTSATHMHLSFKTTSNGSLLCLDVDERDNSIVANPCKC  401

Query  229  LNNDSSCDPASQWFKII  179
            L  D+SCDPASQWFK++
Sbjct  402  LTMDASCDPASQWFKVL  418



>gb|KGN50360.1| hypothetical protein Csa_5G168960 [Cucumis sativus]
Length=343

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
             E D DWALW   GSYY R+G VG EE +GVL +NW + RN  F Q   ++Q+  + P  
Sbjct  142  VEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLNYNWSDVRNPHFSQMFQLLQTMLQDPNS  201

Query  571  TESRLHKLIFHPMTGLCVRRVSL-FQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
              S  + +++HP +G CV    +    + L  CS +  W Y   G  + +  T FCL+A 
Sbjct  202  NSSNTY-VMYHPQSGQCVLVQDMKHMQIYLNDCSNASHWSYEGDGTPIMLASTNFCLKAS  260

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN-VCLDVDSNNV--IITNTCKCL  227
              G P  L   C  + S W  ISDS++HL++  K G+N +CL+ +S+N   I+  +C C+
Sbjct  261  GDGLPPSLSRDCFGEQSVWTAISDSKLHLATLTKQGNNGMCLEKESSNSSRILMRSCVCV  320

Query  226  NNDSSC--DPASQWFKII  179
             NDS+C  D  +QWF+++
Sbjct  321  GNDSNCLQDTQAQWFQLV  338



>ref|XP_008467306.1| PREDICTED: uncharacterized protein LOC103504686 [Cucumis melo]
Length=539

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (58%), Gaps = 8/198 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
             E D DWALW   GSYY R+G V LEE +GVL +NW + RN  F Q   ++Q+  + P  
Sbjct  338  VEKDLDWALWGWQGSYYYRQGKVELEEVFGVLNYNWSDVRNPRFSQMFQLLQTMLQDPNS  397

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
              S  + L++HP +G CV+   + Q  + L  CS +  W Y   G  + +  T FCL+A 
Sbjct  398  NSSNTY-LMYHPQSGQCVQVHDMKQKEIFLNNCSNASHWSYEGDGTPIMLASTNFCLKAN  456

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN-VCLDVDSNNV--IITNTCKCL  227
              G P  L   C  + S W  ISDS++HL++  K G+N +CL+ +S+N   I+  +C C+
Sbjct  457  GNGLPPSLSRDCFGEQSVWTAISDSKLHLATLTKQGNNGMCLEKESSNSSRILMRSCVCV  516

Query  226  NNDSSC--DPASQWFKII  179
             +DS+C  D  +QWF+++
Sbjct  517  GSDSNCLQDTQAQWFQLV  534



>emb|CDY16991.1| BnaC09g41180D [Brassica napus]
Length=495

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 11/197 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P  GPG
Sbjct  305  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVTGPG  364

Query  574  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  401
                   KL+FHP TGLCV   +S   P L L  C +++P  +   + + +     C++A
Sbjct  365  LQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGI-LWSNKMCVEA  420

Query  400  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK-LKDGSNVCLDVDS-NNVIITNTCKC  230
             + +G+  KLG+      SK    S + MHLS K   +GS +CLDVD  +N I+ N CKC
Sbjct  421  PDAVGQKVKLGV--GTKCSKLGQTSATHMHLSFKTTSNGSLLCLDVDERDNSIVANPCKC  478

Query  229  LNNDSSCDPASQWFKII  179
            L  D+SCDPASQWFK++
Sbjct  479  LTMDASCDPASQWFKVL  495



>ref|XP_009403630.1| PREDICTED: uncharacterized protein LOC103987145 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = -2

Query  547  IFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGL  368
            IFHP TGLCV R ++  PL+LGPCS SD W YT  + L V GTYFCL+A  LG P +LG+
Sbjct  47   IFHPPTGLCVTRRTMADPLKLGPCSASDSWRYTPQEFLMVTGTYFCLRAVGLGAPVRLGI  106

Query  367  FCTDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN--NDSSCDPAS  197
             C    S+W+++S S + HL++KL DG+ VCLDVDS+  +++N+C   +  +D      S
Sbjct  107  ICDPSDSRWQLVSGSEKTHLATKLTDGTEVCLDVDSDGCLVSNSCDGFHGGDDEHLQVDS  166

Query  196  QWFKIIDSTRGTTTKS  149
            QWFK++  T G T +S
Sbjct  167  QWFKLV--TAGFTKQS  180



>ref|XP_004143723.1| PREDICTED: uncharacterized protein LOC101213113 [Cucumis sativus]
Length=539

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
             E D DWALW   GSYY R+G VG EE +GVL +NW + RN  F Q   ++Q+  + P  
Sbjct  338  VEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLNYNWSDVRNPHFSQMFQLLQTMLQDPNS  397

Query  571  TESRLHKLIFHPMTGLCVRRVSL-FQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
              S  + +++HP +G CV    +    + L  CS +  W Y   G  + +  T FCL+A 
Sbjct  398  NSSNTY-VMYHPQSGQCVLVQDMKHMQIYLNDCSNASHWSYEGDGTPIMLASTNFCLKAS  456

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN-VCLDVDSNNV--IITNTCKCL  227
              G P  L   C  + S W  ISDS++HL++  K G+N +CL+ +S+N   I+  +C C+
Sbjct  457  GDGLPPSLSRDCFGEQSVWTAISDSKLHLATLTKQGNNGMCLEKESSNSSRILMRSCVCV  516

Query  226  NNDSSC--DPASQWFKII  179
             NDS+C  D  +QWF+++
Sbjct  517  GNDSNCLQDTQAQWFQLV  534



>ref|XP_003608279.1| Endoglucanase [Medicago truncatula]
 gb|ABD32354.1| Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago 
truncatula]
 gb|AES90476.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=536

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 112/200 (56%), Gaps = 6/200 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA +D DW+LW+  GSYY REG+VG  E Y V+ ++W   R+  F Q+  ++Q   + P 
Sbjct  336  AASVDLDWSLWSFGGSYYFREGSVGAGETYAVMDYDWKNYRDPKFPQKFQLLQKKIQDPT  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
               S+ H ++FHP+TG C         L LG C     W +   G  + +  +  CL+AE
Sbjct  396  SNLSKSH-IMFHPLTGKCAHANGSNNELVLGDCKSHSEWSFEGDGSPIRLMDSAMCLKAE  454

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCLN-  224
              G PA L   C    S W+ +S + +HL++   +G   CL+++S++  I+T  C C++ 
Sbjct  455  GEGLPATLSEHCLSPQSSWKSVSKTGLHLATSHGNGPLFCLEMESDSSKIVTRKCICIDE  514

Query  223  NDSSC--DPASQWFKIIDST  170
            NDSSC  +P SQWF++I + 
Sbjct  515  NDSSCLDNPQSQWFQLISTN  534



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 114/197 (58%), Gaps = 7/197 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA  D DWALW L GSYY R+G VG EE +GVL +NW   RN  F +R  ++Q+  + P 
Sbjct  340  AAGKDLDWALWALQGSYYYRQGVVGPEETFGVLDFNWDGLRNPKFKERFQLVQTMVQDPS  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPW-GYTAGKALTVEGTYFCLQAE  398
             + S +  +++HP +GLC+R  +  + +    C     W  Y  G  + + GT  CL+A 
Sbjct  400  -SNSPMSYIMYHPQSGLCIRANNNHE-IGTAECQHWSRWIHYRDGSPIRLMGTPLCLKAL  457

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN--NVIITNTCKCLN  224
              G P  L   C++  S W  IS+S++H+++  + G+ +CL+  SN  +VI+T  C C++
Sbjct  458  GDGLPPVLSNDCSNRRSAWRSISNSKLHVAATDEHGNRLCLEKKSNESSVILTRKCICVD  517

Query  223  NDSSC--DPASQWFKII  179
            +DS C  +P  QWFK +
Sbjct  518  DDSGCTENPQGQWFKFV  534



>ref|XP_008445780.1| PREDICTED: uncharacterized protein LOC103488703 [Cucumis melo]
Length=448

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 114/199 (57%), Gaps = 6/199 (3%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P  
Sbjct  249  AQKDLDWALWTWQGSYYYREGQAELPETFGVLESNWTQIKNPNFVQKFQLLQTMLQDPN-  307

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  395
            + +    +I+HP +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  308  SNASFSYVIYHPQSGQCIEVSNDNKDIFLTNCSTSSRWSHDNDSTPIKMSNTGLCLKASG  367

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNN  221
             G  A L   C    S W  IS+S++HL++  ++G ++CL ++S+N   I+TN+C C  +
Sbjct  368  EGLAASLSNDCLGKQSVWSAISNSKLHLATVTENGKSLCLQIESSNSSKIVTNSCICTTD  427

Query  220  DSSC--DPASQWFKIIDST  170
            D +C  D  SQWF+++++ 
Sbjct  428  DPTCLQDTQSQWFELVETN  446



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 109/202 (54%), Gaps = 14/202 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L GSYYLR G  G EE +G L   W  PRN +FL+R+  +Q+    P 
Sbjct  333  AAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQRPRNPNFLERLRFLQTKTHVPT  392

Query  574  YTESRLHKLIFHPMTGLCVR---RVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCL  407
             + +R   +IFHP++G CV    R  L+     GP S    W Y   G  + +     CL
Sbjct  393  TSRTRTSYIIFHPLSGNCVNANARNELYAS-NRGPFSR---WSYGGDGTPIRLMDRSLCL  448

Query  406  QAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD--GSNVCLDVDSNNV--IITNT  239
            +    G P  L   C  + S W ++S S++HL++K  +  G  +CL V   N   ++T  
Sbjct  449  KVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQVSPTNSSQVVTTK  508

Query  238  CKCLNNDSSC--DPASQWFKII  179
            C C+ +DSSC  +P SQWFK++
Sbjct  509  CICVGDDSSCLQNPQSQWFKLV  530



>ref|XP_004151386.1| PREDICTED: uncharacterized protein LOC101207450 [Cucumis sativus]
Length=364

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (56%), Gaps = 7/197 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P Y
Sbjct  163  AQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTMLQDP-Y  221

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  395
            + +    +I+H  +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  222  SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLCLKASG  281

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD-VDSNNV--IITNTCKCLN  224
             G  A L   C    S W  IS+S +HL +  +DG ++CL  ++S+N   I+TN+C C  
Sbjct  282  EGLEASLSTDCIGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTNSCICTT  341

Query  223  NDSSC--DPASQWFKII  179
            ND +C  D  SQWF+++
Sbjct  342  NDPTCLQDTQSQWFELV  358



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (56%), Gaps = 7/197 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P Y
Sbjct  338  AQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTMLQDP-Y  396

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  395
            + +    +I+H  +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  397  SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLCLKASG  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD-VDSNNV--IITNTCKCLN  224
             G  A L   C    S W  IS+S +HL +  +DG ++CL  ++S+N   I+TN+C C  
Sbjct  457  EGLEASLSTDCIGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTNSCICTT  516

Query  223  NDSSC--DPASQWFKII  179
            ND +C  D  SQWF+++
Sbjct  517  NDPTCLQDTQSQWFELV  533



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 110/200 (55%), Gaps = 11/200 (6%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AE D DWALWT  GSY LREGTV LEE YGV   NW  PRN +FL R+ +++   + P 
Sbjct  335  VAETDIDWALWTFQGSYMLREGTVNLEEVYGVNDLNWDRPRNPAFLDRLQLIRQLNQEP-  393

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWG-YTAGKALTVEGTYFCLQAE  398
             T    + ++FHP +G CVR       + L  C  +  W  +  G  + V G+  CL   
Sbjct  394  KTNRPTYYIMFHPQSGQCVRIGK--TNIVLANCKTASHWDQHQDGGTIKVAGSPQCLGVA  451

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD-SNNVIITNTCKCLNN  221
              GK A +   C+ + SKW+ +S S +HL ++  +G  +CL+   SN+ ++T  C C+ +
Sbjct  452  GDGKVAGVSDDCSSNGSKWKHVSSSGLHLGAQDGEGKYLCLERSASNSTLVTKKCLCVGD  511

Query  220  D----SSCD--PASQWFKII  179
            +     +CD  P  QWFK++
Sbjct  512  NLVDFPTCDDNPEVQWFKLV  531



>ref|XP_006584934.1| PREDICTED: uncharacterized protein LOC100811735 [Glycine max]
Length=337

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 111/196 (57%), Gaps = 7/196 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A +D DW+LW   GSYY R+G VGL E Y V+  +W   R+ +F Q+  ++Q   + P  
Sbjct  140  ASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMDDDWKSYRDPNFTQKFELLQRMVQDPTS  199

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  395
              S+   +IFHP+TG C   V+  + L +G C  +  W Y   G  + +  +  CL+A  
Sbjct  200  NVSK-SNIIFHPLTGYCA-HVNNSKELVMGDCKSNSLWSYEGDGSPIRLMNSAKCLKAVG  257

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCL-NN  221
               P  L   C    S W+ +S + +HL++  KDG  +CL+ DSN+  I+T+ C C+ ++
Sbjct  258  ERLPPSLSEDCLSPQSSWKTVSMTGLHLATFDKDGDLLCLEKDSNSSKIVTSKCICISDD  317

Query  220  DSSC--DPASQWFKII  179
            DSSC  +P SQWFK++
Sbjct  318  DSSCLDNPQSQWFKLV  333



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 109/197 (55%), Gaps = 7/197 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P  
Sbjct  338  AQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTMLQDPN-  396

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  395
            + +    +I+H  +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  397  SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLCLKASG  456

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD-VDSNNV--IITNTCKCLN  224
             G  A L   C    S W  IS+S +HL +  +DG ++CL  ++S+N   I+TN+C C  
Sbjct  457  EGLEASLSTDCVGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTNSCICTA  516

Query  223  NDSSC--DPASQWFKII  179
            ND +C  D  SQWF+++
Sbjct  517  NDPTCLQDTQSQWFELV  533



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 113/205 (55%), Gaps = 11/205 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE DFDWALWTL GSYYLR G  G EE YG+    W + R+  F+ R+  +Q PF+   
Sbjct  336  AAEGDFDWALWTLQGSYYLRNGQPGFEETYGIFNGRWDDLRDPPFVSRLKSLQKPFQESF  395

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQA  401
             +   L+K ++HP TGLC+   S    L+L  C     + Y +  G     + +  C+ A
Sbjct  396  SSSEPLYKTLYHPATGLCL-ATSGEGGLKLDSCDSPTLFEYKSPQGAFTLSDESSTCIAA  454

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK-DGSN--VCLDVDSNNVIITNTCKC  230
            +  G  A+L   C   +SKW+ +S S + +S  L  +G++  +CLD  S+  ++TN C C
Sbjct  455  KGPGLAAELSTQCAASNSKWQRVSSSNLQVSVTLSVNGTSQMLCLDGKSSPQVLTNDCIC  514

Query  229  LNNDSSC----DPASQWFKIIDSTR  167
            L  DS C    +P  QWFK+I + R
Sbjct  515  L-KDSDCRKDENPEMQWFKLITTNR  538



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 111/202 (55%), Gaps = 9/202 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AE D DWALWTL  SY+ R+G  G  E Y VL ++W +PR   FL+R+ I+Q+  + P 
Sbjct  374  VAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQNLLQDPN  433

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPC---SESDPWGYTAGKA-LTVEGTYFCL  407
               S  + L+ H  +G CV  V     + +  C   S +  W +   ++ +   G   CL
Sbjct  434  SNVSPYY-LLVHAQSGFCV-NVKHNDVVSVSSCRKNSRNSRWNHEGDRSPIKKLGRKHCL  491

Query  406  QAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDV--DSNNV-IITNTC  236
            +A   G P  L   C+   + W+++SDS + +++  + G+ +CLD    SN+  I+T  C
Sbjct  492  KAVGDGVPLTLSDDCSSPRATWQLVSDSMLQIAAMDEQGNPLCLDATPSSNSTPILTRAC  551

Query  235  KCLNNDSSCDPASQWFKIIDST  170
             CLNN++ CDP SQWFK++ S 
Sbjct  552  ACLNNEAGCDPLSQWFKLVPSN  573



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 108/194 (56%), Gaps = 8/194 (4%)
 Frame = -2

Query  745  LDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTE  566
            +D +W+LW   GSYYLR+G VG  E YGV+ + W   R+ +F Q+  ++Q   + P    
Sbjct  335  VDLEWSLWAFQGSYYLRQGNVGPGESYGVMDFEWENYRDPNFTQKFQLLQRIIQDPNSKA  394

Query  565  SRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEKLG  389
            S+ H +IFHP TG C       + L +G C  +  W +   G  + +  +  CL+A   G
Sbjct  395  SKSH-IIFHPSTGYCAHVND--KELVMGDCKSNSLWSFEGDGSPIRLMNSAMCLKAVGEG  451

Query  388  KPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCL-NNDS  215
             P  L   C    S W+ +S S +HL+S  K+G  +CL+ DSN+  ++T  C C+ N+DS
Sbjct  452  LPPTLSEDCLSAQSSWKAVSMSGLHLASFDKNGDLLCLEKDSNSTKLVTRKCICIENDDS  511

Query  214  SC--DPASQWFKII  179
            SC   P +QWF+++
Sbjct  512  SCLDSPLNQWFRLV  525



>gb|KHN45741.1| Endoglucanase [Glycine soja]
Length=531

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 7/199 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A +D DW+LW   GSYY R+G VGL E Y V+  +W   R+ +F Q+  ++Q   + P  
Sbjct  334  ASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMDDDWKSYRDPNFTQKFELLQRMVQDPTS  393

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  395
              S+   +IFHP+TG C   V+  + L +G C  +  W Y   G  + +  +  CL+A  
Sbjct  394  NVSK-SNIIFHPLTGYCA-HVNNSKELVMGDCKSNSLWSYEGDGSPIRLMNSAKCLKAVG  451

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCL-NN  221
               P  L   C    S W+ +S + +HL++  KDG  +CL+ DSN+  I+T+ C C+ ++
Sbjct  452  ERLPPSLSEDCLSPQSSWKTVSMTGLHLATFDKDGDLLCLEKDSNSSKIVTSKCICISDD  511

Query  220  DSSC--DPASQWFKIIDST  170
            DSSC  +P SQWFK++ + 
Sbjct  512  DSSCLDNPQSQWFKLVSTN  530



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 104/201 (52%), Gaps = 34/201 (17%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW++W L GSYY+REG  G+ E+YG                       P   P 
Sbjct  336  AAENDVDWSIWALTGSYYIREGVAGMVEYYG-----------------------PVPQP-  371

Query  574  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  398
                +++ L+FHP+TGLC V+  S    + LG C+ S  W YT    L ++    CL+  
Sbjct  372  ----KVYNLVFHPLTGLCMVQTSSDPNKVTLGTCNTSPQWSYTLDNTLKIKDKSLCLENT  427

Query  397  KLGKPAKLGLFC--TDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  227
               +  KL      + + SKW+ IS S  M L+SK  D S +CLDVD +  I+   CKC+
Sbjct  428  GPNQRVKLSETSCWSPNLSKWQTISGSINMLLASKSSDNS-LCLDVDGHKNIVATNCKCV  486

Query  226  N-NDSSCDPASQWFKIIDSTR  167
               DSSCDP SQWFKI+  +R
Sbjct  487  KGEDSSCDPTSQWFKIVKVSR  507



>emb|CDX94332.1| BnaC01g18520D [Brassica napus]
Length=165

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 99/171 (58%), Gaps = 10/171 (6%)
 Frame = -2

Query  679  LEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV--RRVS  506
            + E YGVL   W   RN ++LQ++S +Q PFRGPG  E    KL+ HP TGLCV      
Sbjct  1    MVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPGLQEK---KLLLHPHTGLCVTNNHSG  57

Query  505  LFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKL-GKPAKLGLFCTDDSSKWEIIS  329
                L L  C++S+P  +   + + +     C++   + G+  KLG+      SK   IS
Sbjct  58   NVPTLRLELCTKSEPSTFNPKEGI-LWINKMCVETPNVAGQKVKLGV--GTKCSKLGQIS  114

Query  328  DSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  179
             ++MHLS K  +G  +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  115  ATKMHLSFKTSNGLLLCLDVDERDNSIVANPCKCLTKDASCDPASQWFKVL  165



>ref|XP_004151560.1| PREDICTED: uncharacterized protein LOC101211788 [Cucumis sativus]
Length=341

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 108/199 (54%), Gaps = 6/199 (3%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALW   GSYY REG     E +GVL  NW + +N +F+Q+  ++Q+    P  
Sbjct  142  AQRDLDWALWAWQGSYYFREGQAEPGESFGVLDSNWTQIKNPNFVQKFQLLQTMLHDPN-  200

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  395
            + +    +I+HP +  C++  +  + + L  CS    W +   G  + +  T   L+A  
Sbjct  201  SNASFSYVIYHPQSSQCIQVSNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASG  260

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNN  221
             G  A L        S W  IS+S++HL++  + G ++CL +DS+N   ++TN+C C N 
Sbjct  261  EGLEASLSTDTLSQQSVWSAISNSKLHLATFTQGGKSLCLQMDSSNSSKVVTNSCICTNG  320

Query  220  DSSC--DPASQWFKIIDST  170
            D +C  D  SQWF+++++ 
Sbjct  321  DPNCLQDTRSQWFELVETN  339



>ref|XP_006378254.1| hypothetical protein POPTR_0010s059501g, partial [Populus trichocarpa]
 gb|ERP56051.1| hypothetical protein POPTR_0010s059501g, partial [Populus trichocarpa]
Length=97

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -2

Query  379  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPA  200
            KLG+ CTD +SKWE ISDS+MH SS   +G  VCLDVDSNN I+TNTCKCL+ D++CDP 
Sbjct  1    KLGIICTDSNSKWETISDSKMHFSSTAANGIAVCLDVDSNNTIVTNTCKCLSKDNACDPE  60

Query  199  SQWFKIIDSTRGTT-TKSDFQSTSFLYFLAKKLFASY  92
            SQWFK+++STR +T TK   +  S L F AK    S+
Sbjct  61   SQWFKLVNSTRSSTMTKPLSRMNSILNFPAKDFHGSF  97



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 7/195 (4%)
 Frame = -2

Query  742  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  563
            DFDW LW L GSYY REG    EE +GVL   +   +N  FLQ+  +MQ+  + P  +  
Sbjct  340  DFDWGLWALQGSYYYREGVKNDEETFGVLDSKFTNVKNPKFLQKFQLMQTKLQDPS-SNL  398

Query  562  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEKLGK  386
                +++HP++G CVR    +Q L +  C  S+ W +      + + G+  CLQA   G 
Sbjct  399  TTSFIMYHPLSGECVRMNKKYQ-LGVSSCKTSNRWSHEQDDTPIKLAGSILCLQAVGDGL  457

Query  385  PAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNNDSSC  209
            P  L   C+   S W+  S++++ L++  ++G  +CL   S+ + I+TN C C  NDS C
Sbjct  458  PPILSKDCSSQQSAWKYASNAKLQLATVDEEGQALCLQRASHSHQILTNKCMC-PNDSEC  516

Query  208  --DPASQWFKIIDST  170
              DP SQWF ++ S 
Sbjct  517  QGDPQSQWFTLVPSN  531



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 111/202 (55%), Gaps = 9/202 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A  D DWALWTL  SYY R+G++ LEE Y VL +NW +PRN  FL++++I+Q   + P 
Sbjct  340  VAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLDFNWEKPRNPQFLEKLTILQEMLQDPN  399

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
             +E+  + +I H  +GLCV  V   + +    C     W ++  G  + + G+  CL+A 
Sbjct  400  -SEASPYYVIVHAKSGLCV-NVDGEKKVHGSGCRHRTKWTHSGDGWPIELMGSNLCLKAV  457

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG--SNVCLDVDSNN--VIITNTCKC  230
              G+P K+   C    S+W  +S  ++HL+ + +     ++CLD  S++   I+T  C C
Sbjct  458  GDGRPVKVSTDCRSQQSRWRRVSKEKLHLAVRDEHDHTESLCLDASSSDPSSIVTRKCAC  517

Query  229  LNNDSSC--DPASQWFKIIDST  170
               D +C  +  S WF+++ S 
Sbjct  518  KEGDLNCHHEEQSNWFQLVPSN  539



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 108/192 (56%), Gaps = 7/192 (4%)
 Frame = -2

Query  742  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  563
            D DW LW   G YY+RE  V L+E +GV+   W + R  +F  +  ++Q   + P    S
Sbjct  346  DLDWGLWAFHGGYYVREDKVQLDETFGVVDATWHKLRYPNFTDKFQLLQRKNQDPTSKRS  405

Query  562  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  383
            + + +++HP+TG CV +V+    LE+G C     W Y  G  + ++ +  CL A   G P
Sbjct  406  KAY-IMYHPLTGKCV-QVNENNKLEIGSCENQKRWTY-KGSQIFLKESQKCLTASGEGLP  462

Query  382  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDG-SNVCLDVDSN-NVIITNTCKCLNNDSSC  209
              +   C   +S W+  S S++HL++  +DG   +CL  D+N + ++T+ C C+++DS C
Sbjct  463  VSVSDDCESKNSSWKTASPSKLHLATVNQDGKQQLCLQKDTNSSAVVTSKCICIHDDSLC  522

Query  208  --DPASQWFKII  179
              DP SQWF+++
Sbjct  523  LDDPQSQWFQLV  534



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 111/195 (57%), Gaps = 12/195 (6%)
 Frame = -2

Query  742  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  563
            D DW LW   GSYY+RE  V L+E +GVL   W   R  +F  +  ++Q   + P    S
Sbjct  347  DLDWGLWAFHGSYYVREDKVQLDESFGVLDATWHNLRYPNFTDKFQLLQRMNQDP---TS  403

Query  562  RLHK--LIFHPMTGLCVRRVSLFQPLELGPCSES-DPWGYTAGKALTVEGTYFCLQAEKL  392
            +L K  +++HP+TG C  +V+    LE+G C E+ + W Y  G  +   GT  CL A   
Sbjct  404  KLPKAYIMYHPLTGKCA-QVNEKNELEIGSCGENKNRWIYD-GSQILWNGTKKCLTASGE  461

Query  391  GKPAKLGLFCTDDSSKWEIISDSRMHLS-SKLKDGSNVCLDVDSN-NVIITNTCKCLNND  218
              P  +   C   +S W+ +S SR+HL+ S  ++G  +CL  DSN +V++T+ C C+N+D
Sbjct  462  DLPVSVSDDCKSKNSSWKPVSLSRLHLATSHDQNGKQLCLHKDSNSSVVVTSKCICINDD  521

Query  217  SSC--DPASQWFKII  179
            S C  DP SQWF+++
Sbjct  522  SLCLDDPQSQWFQLV  536



>gb|KGN57440.1| hypothetical protein Csa_3G186670 [Cucumis sativus]
Length=348

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 107/196 (55%), Gaps = 6/196 (3%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALW   GSYY REG     E +GVL  NW + +N +F+++  ++Q+  + P  
Sbjct  149  AQRDLDWALWAWQGSYYFREGQAEPGESFGVLDSNWTQIKNPNFVRKFQLLQTMLQDPN-  207

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  395
            + +    +I+HP +  C++  +  + + L  CS    W +   G  + +  T   L+A  
Sbjct  208  SNASFSYVIYHPQSSQCIQVSNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASG  267

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNN  221
             G  A L        S W  IS+S++HL++  + G ++CL +DS+N   ++TN+C C N 
Sbjct  268  KGLEASLSSDTLSQQSVWSAISNSKLHLATFTQGGKSLCLQIDSSNSSKVVTNSCICTNG  327

Query  220  DSSC--DPASQWFKII  179
            D +C  D  SQWF+++
Sbjct  328  DPNCLQDTRSQWFELV  343



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 106/208 (51%), Gaps = 14/208 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L GSYYLR G  G  E YGVL  NW  P+N  F ++  ++Q   +   
Sbjct  346  AAERDLDWALWALQGSYYLRNGIPGFNETYGVLDANWDRPKNPRFREKFRLIQDTLQDKY  405

Query  574  YT-----ESRL----HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGK-ALTVE  425
             T     + RL    +++I+HP +G CV  V     + L  C +   W Y   + A+ + 
Sbjct  406  PTKYSNPDPRLSVAAYQIIYHPHSGQCV-SVDDSSNVVLSDCKKRKRWSYNGNRTAVWLM  464

Query  424  GTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVI  251
            G+  CL+ E  G P  L   C D+ S W  +S S   +S     G ++CL+ +S  +N I
Sbjct  465  GSAQCLRVEGEGLPVLLSAECDDNRSVWGPVSSSWFQISGMDAQGRHLCLERNSSNSNSI  524

Query  250  ITNTCKCLNN-DSSCDPASQWFKIIDST  170
             T  C CL+N   S +P +QWF  I S 
Sbjct  525  FTKKCLCLDNLGCSKNPQTQWFHFIPSN  552



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 111/202 (55%), Gaps = 9/202 (4%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A  D DWALWTL  SYY R+G++ LEE Y VL +NW +PRN  FL++++I+Q   + P 
Sbjct  769  VAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLDFNWEKPRNPQFLEKLTILQEMLQDPN  828

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
             +E+  + +I H  +GLCV  V   + +    C     W ++  G  + + G+  CL+A 
Sbjct  829  -SEASPYYVIVHAKSGLCV-NVDGEKKVHGSGCRHRTKWTHSGDGWPIELMGSNLCLKAV  886

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG--SNVCLDVDSNN--VIITNTCKC  230
              G+P K+   C    S+W  +S  ++HL+ + +     ++CLD  S++   I+T  C C
Sbjct  887  GDGRPVKVSTDCRSQQSRWRRVSKEKLHLAVRDEHDHTESLCLDASSSDPSSIVTRKCAC  946

Query  229  LNNDSSC--DPASQWFKIIDST  170
               D +C  +  S WF+++ S 
Sbjct  947  KEGDLNCHHEEQSNWFQLVPSN  968


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AE D DWALWTL  SY+ R+G  G  E Y VL ++W +PR   FL+R+ I+Q+  +  G
Sbjct  336  VAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQNLLQESG  395

Query  574  YTESRLHKLIFH  539
              + ++    FH
Sbjct  396  GKKKKIFN--FH  405



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 110/201 (55%), Gaps = 13/201 (6%)
 Frame = -2

Query  748  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGP--  578
            E DFDW LW L GSYY REG    EE +GVL   + + +N   FLQR  +MQ+  + P  
Sbjct  339  ENDFDWGLWALQGSYYYREGVKNAEENFGVLDSTFAKAKNSKLFLQRFQLMQTKLQDPSS  398

Query  577  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQA  401
             +T S    +++HP++G CVR    +Q L +  C  S+ W +    + + + G+  CL+A
Sbjct  399  NFTTSL---IMYHPLSGGCVRMNKKYQ-LGISSCKTSNRWIHEQDSSPIKLAGSVLCLKA  454

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD--VDSNNVIITNTCKCL  227
              +G P  L   C+   S W+  S +++ L++  + G  +CL      ++ I+TN C C 
Sbjct  455  IGVGLPPILSQDCSSQQSIWKYGSSAKLQLATVDEQGQALCLQRAASHSHQIVTNKCLC-  513

Query  226  NNDSSC--DPASQWFKIIDST  170
            +NDS C  DP SQWF ++ S 
Sbjct  514  SNDSQCQEDPQSQWFTLVPSN  534



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 8/198 (4%)
 Frame = -2

Query  748  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGPGY  572
            E DFDW LW L GSYY + G    EE +GVL  N+ + +N   FLQR  +MQ+  + P  
Sbjct  340  ENDFDWGLWALQGSYYYKVGVKNAEENFGVLDSNFTKAKNSKLFLQRFQLMQTKLQDPSS  399

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  395
              +    +++HP++G CVR    +Q L +  C  S+ W +   G  + + G+  CL+A  
Sbjct  400  NFTTTF-IMYHPLSGGCVRMNKKYQ-LGISSCKTSNRWSHEQDGAPIKLAGSILCLKAIG  457

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNND  218
            +G P  L   C+   S W   S++++ L++  + G  +CL   S+ + I+TN C C   D
Sbjct  458  VGLPPILSQDCSSQQSIWRYASNAKLQLATVDEQGQALCLQRASHSHQIVTNKCLC-TID  516

Query  217  SSC--DPASQWFKIIDST  170
            S C  DP SQWF ++ S 
Sbjct  517  SQCQEDPQSQWFTLVPSN  534



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 105/199 (53%), Gaps = 6/199 (3%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DWALW L GSYY+R+G  G +E YGVL  NW + +N  F ++  ++Q   + P 
Sbjct  287  AAERDLDWALWALQGSYYMRDGIPGSKETYGVLDSNWDQAKNPRFQEKFRLIQEMLQEP-  345

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGK-ALTVEGTYFCLQAE  398
             + +  +++I+HP +G CV  V     + L  C     W Y   + A+ + G+  CL+ E
Sbjct  346  RSSTATNQIIYHPHSGQCV-SVDDDNNVVLSDCKNRKWWSYDGNRTAIWLAGSTHCLRVE  404

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKCLN  224
              G    L   C D+ S W  +S S   +S     G N+CL+ +S+N   I T  C C +
Sbjct  405  GEGLSVLLSAECNDNQSFWGPVSSSWFQISGMDAQGRNLCLERNSSNSDSIWTKECLCSD  464

Query  223  N-DSSCDPASQWFKIIDST  170
            N   S +P +QWF+ I S 
Sbjct  465  NLGCSKNPQTQWFRFIPSN  483



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 25/207 (12%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSP-----  590
             AE+D DWALWT  GSY LREGT+ LEE YGV+  NW  PRN  +L R+ I++       
Sbjct  338  VAEIDIDWALWTFQGSYILREGTLNLEEVYGVMDLNWDGPRNPQYLDRLQILRQKNQELE  397

Query  589  FRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPW--GYTAGKALTVEGTY  416
             + P Y       ++FHP +G C   +  +  + L  C  +  W      G      G+ 
Sbjct  398  SKNPNYY------IMFHPQSGKCA-HIYKYGDIILATCETATRWEQHQDGGPIKLAGGSS  450

Query  415  FCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITN  242
             CL     G  A +   C   SSKW+I+S S +HL+++   G  +CL++++  N  I+T 
Sbjct  451  RCLTVAGDGGAASVSGDC---SSKWKIVSSSGLHLAAQDGKGKYLCLEMNATDNFTIVTK  507

Query  241  TCKCLNND------SSCDPASQWFKII  179
             C C+ +D       S +P  QWFK++
Sbjct  508  KCLCVGDDLRDFPTCSDNPQGQWFKLV  534



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 125/228 (55%), Gaps = 26/228 (11%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             AE D DWALWTL GSY LR+G V LEE YG+   NW   RN +  +R+ +++     P 
Sbjct  717  VAEHDLDWALWTLQGSYILRQGVVELEEVYGMFDVNWDHIRNSTLSRRLQLVKQIIWDPK  776

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYT-AGKALTV----EGTYFC  410
             + +  H  ++HP +GLC  ++     +    C     W    AG ++ +    EGT+ C
Sbjct  777  -SNNTTHSKLYHPQSGLCA-QIGNNGSVRGSDCQSPGRWKQQEAGSSIQLEAEAEGTFGC  834

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD-SNNVIITNTCK  233
            L+A   G+PA +   C + ++ W+++S S++H++++   G  +CL+++ S++V++T  C 
Sbjct  835  LRAVGDGQPATVSSDCGNQTTLWKLVSSSQLHIAAQ---GGYLCLEMNSSDSVVVTRKCL  891

Query  232  CLNNDS----SC--DPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKK  107
            CL+ +S    +C  +P  QWFK++ +          +S  F +F  KK
Sbjct  892  CLDENSNDVPNCAENPEGQWFKLVPTN---------ESLIFFFFGDKK  930


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AE D DWALW L GSYYLR+G    EE YG+   +W   RN  F  ++ ++Q      G
Sbjct  281  AENDLDWALWALQGSYYLRDGKHDPEETYGLFNSSWGPLRNPQFHTKLQLIQRTLIATG  339



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 111/201 (55%), Gaps = 13/201 (6%)
 Frame = -2

Query  748  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGP--  578
            E DFDW LW L GSYY REG    EE +GVL   + + +N   FLQR  +MQ+  + P  
Sbjct  339  ENDFDWGLWALQGSYYYREGVKNAEENFGVLDSTFAKAKNSKLFLQRFQLMQTKLQDPSS  398

Query  577  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQA  401
             +T S    +++HP++G CVR    +Q L +  C  S+ W +    + + + G+  CL+A
Sbjct  399  NFTTSL---IMYHPLSGGCVRMNKKYQ-LGISSCKTSNRWIHEQDSSPIKLAGSVLCLKA  454

Query  400  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD--VDSNNVIITNTCKCL  227
              +G P  L   C+   S W+  S++++ L++  + G  +CL      ++ ++TN C C 
Sbjct  455  IGVGLPPILSQDCSSQQSIWKYGSNAKLQLATIDEQGQALCLQRAASHSHQLVTNKCLC-  513

Query  226  NNDSSC--DPASQWFKIIDST  170
            ++DS C  DP SQWF ++ S 
Sbjct  514  SSDSQCQEDPQSQWFTLVPSN  534



>ref|XP_011026965.1| PREDICTED: uncharacterized protein LOC105127394 [Populus euphratica]
Length=535

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 109/200 (55%), Gaps = 9/200 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW LW L GSYYLR+    +EE++GVL  +W   +N +  +R+ +++     P 
Sbjct  337  AAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLEIDWDRVKNPAVERRLGLLKQTLLDPK  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAE  398
             + + L+ +++HP +G CV    +   +  G C     W +   +  L ++GT  CL+A 
Sbjct  397  -SMAPLNYIMYHPQSGACVGE-GMDGQIRAGNCKGLTRWTHNGHEGPLELKGTGLCLKAI  454

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLN  224
              G P  L   C+   + W+ IS S++HL+SK   G  +CL +       I+T  C C+ 
Sbjct  455  GDGLPPILTPDCS--QTTWKPISASKLHLASKDHKGEYLCLHLAPPFAGNIVTKKCICVG  512

Query  223  NDSSC--DPASQWFKIIDST  170
            +D +C  +P SQWFK++++ 
Sbjct  513  DDPTCKDNPTSQWFKLVETN  532



>gb|KDP25367.1| hypothetical protein JCGZ_20523 [Jatropha curcas]
Length=483

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 104/204 (51%), Gaps = 11/204 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D +W LW   GSY+ RE  +G+EE YGV+ +NW   RN  + +R+ +++   + P 
Sbjct  280  AAEFDLEWGLWAWQGSYHYRENQIGMEETYGVMDYNWDRVRNPEYQRRMELIKLKLQDPS  339

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  398
              +S++ +++FHP +G C+      + +  G C     W +T  G  + ++G   C++  
Sbjct  340  -LKSQVSRIMFHPQSGTCISADGT-EGISAGDCKAPSHWVHTRDGDPIRLKGKRLCIKVV  397

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLN  224
              G    L   C+ + S W+ +S ++ H +S    G  VCL  +S     IIT  C  + 
Sbjct  398  SNGWEPMLSEDCSSEQSSWKKLSKTKFHFASVDDKGQQVCLQKESPYTRKIITRNCTLML  457

Query  223  NDSSC------DPASQWFKIIDST  170
             D+        +P +QWFK +++ 
Sbjct  458  EDAEYLKSPLNEPVAQWFKFVETN  481



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 109/205 (53%), Gaps = 24/205 (12%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRG---  581
            AE+D DW+LW + GSY LREG   +EE YGV+ +NW  P+N +F+ R+ I++   +G   
Sbjct  340  AEIDIDWSLWAIQGSYILREGNADVEETYGVMNFNWDGPKNPAFVDRLQILKQVNQGANS  399

Query  580  --PGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWG-YTAGKALTVEGTYFC  410
              PGY       ++ HP +G CV ++     + L  C  +  W  +  G  L + G+  C
Sbjct  400  KNPGYY------IMLHPQSGKCV-QIGNNNSVRLADCKTASRWDQHQDGGPLKLSGSSLC  452

Query  409  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTC  236
            L     G    +   CT   SKW+ +S S + L+++   G   CL+++ ++   +IT  C
Sbjct  453  LAVAGDGGATSVSDNCT---SKWKYVSSSGLQLAAQDGMGKYFCLEMNGSDHSTVITKKC  509

Query  235  KCLNND----SSC--DPASQWFKII  179
             C+ +D    S+C  +P  QWFK++
Sbjct  510  LCVGDDLGDFSTCADNPQVQWFKLV  534



>ref|XP_003621369.1| Endoglucanase E1 [Medicago truncatula]
 gb|AES77587.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 104/193 (54%), Gaps = 7/193 (4%)
 Frame = -2

Query  745  LDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTE  566
            +D DWALW   G+YY+R+  + + E +G+ ++++   R + F QR  +M      P    
Sbjct  337  VDLDWALWAAQGAYYIRKNEIIVSETFGIWSYDFRTLRYIEFPQRFQLMHKKLLEPSSNS  396

Query  565  SRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGK  386
            S+ + +I+HP++G CV +V+    L LG C     W    G+ + + G   C++A K G 
Sbjct  397  SKSY-IIYHPLSGQCV-KVNKRNKLVLGDCDGKSKWN-QVGQQIKLVGNDACIEAIKDGS  453

Query  385  PAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLNNDSS  212
              KL   C    S W+ +S + +HL +    G N+CL   S  +  I+T  C C++++ +
Sbjct  454  QVKLSNDCRSKQSFWKTLSATNLHLGTLDSQGQNLCLQRKSPTSPKIVTKKCICIDDNPA  513

Query  211  C--DPASQWFKII  179
            C  DP SQWF+++
Sbjct  514  CLEDPQSQWFQLV  526



>ref|XP_002298005.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
 gb|EEE82810.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
Length=535

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 108/200 (54%), Gaps = 9/200 (5%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAE D DW LW L GSYYLR+    +EE++GVL  +W   +N    +R+ +++     P 
Sbjct  337  AAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLEIDWDRVKNPEVERRLGLLKQTLLDPK  396

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAE  398
             T + L+ +++HP +G CV    +   +  G C     W +   +  L ++ T  CL+A 
Sbjct  397  ST-APLNYIMYHPQSGACVGE-GMDGQIRAGNCKGLTRWTHNGHEGPLELKRTGLCLKAI  454

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLN  224
              G P  L   C+   + W+ IS S++HL+SK   G  +CL ++      I+T  C C+ 
Sbjct  455  GDGLPPILTPDCS--QTTWKPISASKLHLASKDHRGEYLCLHLEPPFAGNIVTKKCICVG  512

Query  223  NDSSC--DPASQWFKIIDST  170
            +D +C  +P SQWFK++++ 
Sbjct  513  DDPTCKDNPTSQWFKLVETN  532



>gb|AES77604.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 104/195 (53%), Gaps = 7/195 (4%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A +D DWALWT  GSYY+RE    + E YG+   ++   R   F QR  ++Q     P  
Sbjct  335  AGVDLDWALWTAQGSYYIREKESNVSEHYGLWNIDFKSLRYPDFPQRFQLVQKKLLEPSS  394

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKL  392
              S+ + +I+HP++G CV +V+    LELG C  +  W    G+ + + G    ++A   
Sbjct  395  NSSKSY-VIYHPLSGQCV-KVNTNNELELGDCEWASKWN-QEGQQIKLVGNGTYIEAVSD  451

Query  391  GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNND  218
            G   K+   C    S W+ +S + +HL +  + G N+CL  +S     I+T  C C++++
Sbjct  452  GSQVKVSNDCKSKQSFWKTLSATNLHLGTLDEQGQNLCLQRESTTSPKIVTKKCICIDDN  511

Query  217  SSC--DPASQWFKII  179
             +C  DP SQWF+++
Sbjct  512  PACLDDPQSQWFQLV  526



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 109/201 (54%), Gaps = 14/201 (7%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
             A+ D DWALWT  GSY LREG V  EE YGV+  NW  PRN +FL ++ +++       
Sbjct  339  VADRDIDWALWTFQGSYILREGKVNSEEAYGVMDLNWDRPRNPAFLDKLQLIRQ-MNQEL  397

Query  574  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWG-YTAGKALTVEGTYFCLQAE  398
             ++   + ++FHP +G CV +V     + L  C  +  W  +  G  + + G+  C+   
Sbjct  398  ESKKPTNYIMFHPQSGQCV-QVGKNNNIILSNCKTASRWDQHQDGGPIKLAGSPQCIGVA  456

Query  397  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKCLN  224
              G  A++   C   SSKW+I S S +HL+++   G  +CL++++++   I+T  C C+ 
Sbjct  457  GDGGAARVSGDC---SSKWKIASTSGLHLAAQDGKGKYLCLEMNASDHSTIVTKKCLCVG  513

Query  223  ND------SSCDPASQWFKII  179
            +D       S +P  QWFK++
Sbjct  514  DDLVDFPTCSDNPQVQWFKLV  534



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AAELD DWALW L GSY LR+G  G +E YGVL W+W +PRN + L RI  +Q P RGPG
Sbjct  339  AAELDLDWALWALQGSYALRQGVAGADEVYGVLDWSWSKPRNATALSRIQSLQRPLRGPG  398

Query  574  YTESRLHKLIFHPMTGLCVRR  512
            Y E+R + ++FHP+TG CV R
Sbjct  399  YDEARPYTVLFHPLTGRCVVR  419



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 104/198 (53%), Gaps = 9/198 (5%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            AELD DWA+W L G+YY REG  G+EE YG+    W   R+  +  ++ ++Q   + P  
Sbjct  333  AELDLDWAVWALQGNYYTREGQQGMEEMYGMFNSTWNSLRSPEYHAKLQLIQQKLQDPKS  392

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEK  395
             +   H L+FHP +G C+   +    L    C  +  W Y      + + GT  CL   +
Sbjct  393  KQPMYH-LLFHPQSGKCLHAAA-NNVLYASDCIGASRWSYDGDDTPIRLTGTSLCLTTSR  450

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD---SNNVIITNTCKCLN  224
             G P  L   C++ S+ W+ +S+ +  LS+  ++G+ +CLD D   S++ ++   C  L+
Sbjct  451  EGLPVTLSTDCSEQST-WKFVSNYQ--LSNHDENGTELCLDFDTYYSSSKVLVRKCIGLD  507

Query  223  NDSSCDPASQWFKIIDST  170
              S+ +P +QWFK + + 
Sbjct  508  EKSNDNPQTQWFKFVSAN  525



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 111/206 (54%), Gaps = 15/206 (7%)
 Frame = -2

Query  748  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGPG-  575
            E DFDW LW L GSYY + G     E +GVL  N+ + +N   FLQR  +MQ+  +    
Sbjct  511  ENDFDWGLWALQGSYYYKVGVKNAGENFGVLDSNFTKAKNSKLFLQRFQLMQTKLQESQR  570

Query  574  ---YTESRLH----KLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGT  419
               YT+   +     +++HP++G C+R    +Q L +  C  S+ W +   G  + + G+
Sbjct  571  LLFYTDPSSNFTTSFIMYHPLSGGCMRMNKKYQ-LGISSCKTSNRWSHEQDGAPIKLAGS  629

Query  418  YFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITN  242
              CL+A  +G P  L   C+   S W+  S++++ L++  + G  +CL   S+ + I+TN
Sbjct  630  ILCLKAIGVGLPPILSQDCSSQQSIWKYGSNAKLQLATVDEQGQALCLQRASHSHQIVTN  689

Query  241  TCKCLNNDSSC--DPASQWFKIIDST  170
             C C +NDS C  DP SQWF ++ S 
Sbjct  690  KCLC-SNDSQCQEDPQSQWFTLVPSN  714



>gb|KGN57438.1| hypothetical protein Csa_3G185670 [Cucumis sativus]
Length=427

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 96/180 (53%), Gaps = 5/180 (3%)
 Frame = -2

Query  742  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  563
            DFDW LW L GSYY REG    EE +GVL   +   +N  FLQ+  +MQ+  + P  +  
Sbjct  251  DFDWGLWALQGSYYYREGVKNDEETFGVLDSKFTNVKNPKFLQKFQLMQTKLQDPS-SNL  309

Query  562  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEKLGK  386
                +++HP++G CVR    +Q L +  C  S+ W +      + + G+  CLQA   G 
Sbjct  310  TTSFIMYHPLSGECVRMNKKYQ-LGVSSCKTSNRWSHEQDDTPIKLAGSILCLQAVGDGL  368

Query  385  PAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNNDSSC  209
            P  L   C+   S W+  S++++ L++  + G  +CL   S+ + I+TN C C  NDS C
Sbjct  369  PPILSKDCSSQQSAWKYASNAKLQLATVDEQGQALCLQRASHSHQILTNKCICP-NDSDC  427



>ref|XP_004168759.1| PREDICTED: uncharacterized protein LOC101223591 [Cucumis sativus]
Length=522

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 95/179 (53%), Gaps = 4/179 (2%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            A+ D DWALW   GSYY REG     E +GVL  NW + +N +F+Q+  ++Q+  + P  
Sbjct  246  AQRDLDWALWAWQGSYYFREGQAEPGESFGVLDSNWTQIKNPNFVQKFQLLQTMLQDPNS  305

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  395
              S    +I+HP +  C++  +  + + L  CS    W +   G  + +  T   L+A  
Sbjct  306  NAS-FSYVIYHPQSSQCIQVSNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASG  364

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  224
             G  A L        S W  IS+S++HL++  + G N+CL +DS+N   ++TN+C C N
Sbjct  365  EGLEASLSSDTLSQQSVWSAISNSKLHLATFTQGGKNLCLQIDSSNSSKVVTNSCICTN  423



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 101/198 (51%), Gaps = 9/198 (5%)
 Frame = -2

Query  751  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  572
            AELD DWA+W L G+YY REG  G+EE YG+    W   RN  +  ++ ++Q   + P  
Sbjct  333  AELDLDWAVWALQGNYYTREGQQGMEEMYGMFNSTWKTLRNPEYHAKLQLIQQTLQDPKS  392

Query  571  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEK  395
             +   H L+FHP +G C+        +    C  +  W Y      + + GT  CL   +
Sbjct  393  KQPMYH-LLFHPQSGKCLHAAD-NNVVYASDCIGASRWSYDGDDTPIRLTGTSLCLTTSR  450

Query  394  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD---SNNVIITNTCKCLN  224
             G P  L   C++ S+ W+  S+ +  LS+  ++GS +CLD D   S++ ++   C  L+
Sbjct  451  EGLPVALSTDCSEQST-WKFASNYQ--LSNHDENGSELCLDFDTYYSSSKVLVRKCIGLD  507

Query  223  NDSSCDPASQWFKIIDST  170
              S  +P +QWFK + + 
Sbjct  508  EKSIDNPQNQWFKFVSAN  525



>ref|XP_002509877.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51264.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=547

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 104/215 (48%), Gaps = 21/215 (10%)
 Frame = -2

Query  754  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  575
            AA+ D DW  W   GSYY RE   G EE +GV+ +NW   RN  F  R+ ++    + P 
Sbjct  332  AADTDVDWGFWAWQGSYYYRENQTGTEETFGVMNFNWNRVRNPEFQNRMQLITKKLQDPS  391

Query  574  YTESRLHKLIFHPMTGLCVR---RVSLFQPLELGPCSESDPWGYTA---------GKALT  431
             + S    ++FH ++G C+       ++      P   SDP G            G  + 
Sbjct  392  -SNSSTSYIMFHALSGSCIHTDGNKEIYATSCKAPRRWSDPAGDVIPMKWLHDGDGAPIR  450

Query  430  VEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NN  257
            ++GT  CL+A   G    L   C+   S W+ +S +++HL++  ++G  +CL  +S   +
Sbjct  451  LKGTKLCLKALGEGLAPILSEDCSSPQSSWKFLSKTKLHLAATDENGEYLCLQKESPYTS  510

Query  256  VIITNTCKCLNNDSSC------DPASQWFKIIDST  170
             I+TN C  +N +  C      DP +QWFK++ + 
Sbjct  511  KILTNACIFMNEEPECGKDPQKDPVTQWFKLVKTN  545



>ref|XP_004170742.1| PREDICTED: uncharacterized protein LOC101225189, partial [Cucumis 
sativus]
Length=337

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 101/190 (53%), Gaps = 5/190 (3%)
 Frame = -2

Query  742  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  563
            D DWA W   GSY  R+G   ++E +G++  +W + R+    Q + + +   + P  ++ 
Sbjct  146  DIDWAYWAFQGSYMYRQGQQDVDESFGIMDSSWTKDRSPRLQQMLQLAKRINQDPN-SKG  204

Query  562  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  383
             +  ++ HP++G CV ++     +ELG C     W +T   +        CL++   GKP
Sbjct  205  PMSYIMLHPVSGQCV-KLDGKGGIELGDCETPTLWDHTGDGSPMKLWNGQCLKSAGDGKP  263

Query  382  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSC--  209
              +   C+ D S W + S +++ LS+K   G N+CL+ +S+  I+   C CL ++ +C  
Sbjct  264  PVVSAECSGDGSSWTVASKAKLQLSTK-SGGENICLEKESDTSIVVKKCICLKDEWNCFD  322

Query  208  DPASQWFKII  179
            DP SQWFK++
Sbjct  323  DPQSQWFKLV  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260