BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024O04

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13211.1|  unnamed protein product                                255   1e-80   Coffea canephora [robusta coffee]
gb|AGZ20104.1|  copper methylamine oxidase-like protein                 268   2e-80   Camellia sinensis [black tea]
gb|KCW86673.1|  hypothetical protein EUGRSUZ_B032971                    256   6e-80   Eucalyptus grandis [rose gum]
gb|KHN13432.1|  Copper methylamine oxidase                              258   5e-77   Glycine soja [wild soybean]
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        257   9e-77   
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    258   1e-76   
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      258   2e-76   
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             258   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    257   2e-76   Glycine max [soybeans]
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    256   3e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    257   3e-76   Eucalyptus grandis [rose gum]
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    256   4e-76   Nelumbo nucifera [Indian lotus]
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      257   4e-76   
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       255   5e-76   Vitis vinifera
emb|CAN62304.1|  hypothetical protein VITISV_023689                     255   6e-76   Vitis vinifera
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       256   6e-76   Vitis vinifera
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    254   2e-75   Cicer arietinum [garbanzo]
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             253   2e-75   
ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             254   3e-75   Citrus sinensis [apfelsine]
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             254   3e-75   Citrus clementina [clementine]
ref|XP_008777611.1|  PREDICTED: copper amine oxidase 1-like             239   3e-75   Phoenix dactylifera
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             254   4e-75   
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             252   5e-75   Medicago truncatula
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             253   5e-75   Medicago truncatula
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             253   6e-75   Medicago truncatula
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             253   6e-75   Medicago truncatula
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    253   6e-75   Malus domestica [apple tree]
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             253   7e-75   Vitis vinifera
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             253   7e-75   Nicotiana tomentosiformis
gb|KJB50258.1|  hypothetical protein B456_008G160800                    253   7e-75   Gossypium raimondii
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    253   8e-75   
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    251   1e-74   Populus euphratica
ref|XP_010102489.1|  Putative primary amine oxidase 2                   251   1e-74   
gb|KJB50254.1|  hypothetical protein B456_008G160800                    253   1e-74   Gossypium raimondii
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   251   1e-74   Citrus sinensis [apfelsine]
ref|XP_002314600.1|  copper amine oxidase family protein                251   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    253   1e-74   Nicotiana sylvestris
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         253   1e-74   Jatropha curcas
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    252   1e-74   Populus euphratica
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             251   2e-74   Medicago truncatula
ref|XP_003613133.1|  Copper amine oxidase                               252   2e-74   
gb|KHG02854.1|  Copper methylamine oxidase                              253   2e-74   Gossypium arboreum [tree cotton]
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             252   2e-74   Prunus persica
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             252   2e-74   Prunus mume [ume]
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   252   3e-74   Citrus sinensis [apfelsine]
ref|XP_002527922.1|  copper amine oxidase, putative                     252   3e-74   Ricinus communis
gb|KHG02564.1|  Primary amine oxidase                                   251   4e-74   Gossypium arboreum [tree cotton]
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             251   4e-74   
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             251   4e-74   
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  251   5e-74   Solanum lycopersicum
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         251   5e-74   Cicer arietinum [garbanzo]
ref|XP_002511334.1|  copper amine oxidase, putative                     251   5e-74   Ricinus communis
gb|KJB15626.1|  hypothetical protein B456_002G186900                    251   5e-74   Gossypium raimondii
gb|AIS23648.1|  amine oxidase 5                                         251   5e-74   Malus domestica [apple tree]
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             251   6e-74   Glycine max [soybeans]
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    251   6e-74   Populus euphratica
gb|AIS23644.1|  amine oxidase 1                                         251   6e-74   Malus domestica [apple tree]
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    251   6e-74   Populus euphratica
gb|KHN00390.1|  Copper methylamine oxidase                              250   8e-74   Glycine soja [wild soybean]
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             250   9e-74   
ref|XP_004309984.2|  PREDICTED: copper amine oxidase 1-like             250   1e-73   Fragaria vesca subsp. vesca
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             250   1e-73   Phaseolus vulgaris [French bean]
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             250   1e-73   Populus euphratica
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             249   1e-73   Phaseolus vulgaris [French bean]
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             249   2e-73   Phaseolus vulgaris [French bean]
gb|AFK48029.1|  unknown                                                 232   5e-73   Lotus japonicus
emb|CBI14968.3|  unnamed protein product                                252   8e-73   Vitis vinifera
gb|AIS23647.1|  amine oxidase 4                                         248   8e-73   Malus domestica [apple tree]
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             248   9e-73   
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             248   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             248   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             247   1e-72   Solanum tuberosum [potatoes]
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             247   1e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004301007.1|  PREDICTED: copper amine oxidase 1-like             247   1e-72   Fragaria vesca subsp. vesca
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      245   8e-72   
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   245   9e-72   Citrus sinensis [apfelsine]
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    245   9e-72   Citrus sinensis [apfelsine]
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       245   9e-72   Cucumis melo [Oriental melon]
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       244   9e-72   Cucumis melo [Oriental melon]
ref|XP_010100391.1|  Copper methylamine oxidase                         246   9e-72   
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    243   1e-71   Citrus sinensis [apfelsine]
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             244   1e-71   Citrus clementina [clementine]
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          245   1e-71   Amborella trichopoda
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             244   2e-71   Sesamum indicum [beniseed]
emb|CDP12746.1|  unnamed protein product                                244   2e-71   Coffea canephora [robusta coffee]
gb|EPS71193.1|  hypothetical protein M569_03564                         228   3e-71   Genlisea aurea
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             244   3e-71   Tarenaya hassleriana [spider flower]
gb|AES71447.2|  copper amine oxidase, enzyme domain protein             239   3e-71   Medicago truncatula
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    242   4e-71   Glycine max [soybeans]
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             243   5e-71   Prunus mume [ume]
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    243   5e-71   Glycine max [soybeans]
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  243   5e-71   Elaeis guineensis
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  243   6e-71   Eucalyptus grandis [rose gum]
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     246   9e-71   Eucalyptus grandis [rose gum]
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             242   1e-70   Tarenaya hassleriana [spider flower]
gb|KHG07734.1|  Primary amine oxidase                                   241   2e-70   Gossypium arboreum [tree cotton]
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         241   2e-70   
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         241   3e-70   
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             239   3e-70   Medicago truncatula
ref|XP_003601195.1|  Primary amine oxidase                              241   3e-70   Medicago truncatula
ref|XP_003601196.1|  Primary amine oxidase                              239   4e-70   
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         240   4e-70   Cicer arietinum [garbanzo]
gb|KJB19706.1|  hypothetical protein B456_003G116000                    240   5e-70   Gossypium raimondii
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             238   5e-69   Phaseolus vulgaris [French bean]
ref|XP_004289862.2|  PREDICTED: copper amine oxidase 1-like             236   8e-69   Fragaria vesca subsp. vesca
gb|KHN18421.1|  Copper methylamine oxidase                              235   2e-68   Glycine soja [wild soybean]
gb|ACN27241.1|  unknown                                                 223   2e-68   Zea mays [maize]
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    235   3e-68   Glycine max [soybeans]
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    234   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006411505.1|  hypothetical protein EUTSA_v100163161mg            224   4e-68   
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    234   4e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             235   4e-68   Sesamum indicum [beniseed]
gb|KJB19705.1|  hypothetical protein B456_003G116000                    234   9e-68   Gossypium raimondii
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                234   1e-67   Erythranthe guttata [common monkey flower]
dbj|BAD95322.1|  putative copper amine oxidase                          227   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             231   8e-67   Solanum lycopersicum
ref|NP_001169559.1|  uncharacterized protein LOC100383438               222   9e-67   
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             231   1e-66   
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             231   1e-66   Nicotiana tomentosiformis
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             231   2e-66   Arabidopsis lyrata subsp. lyrata
gb|ABR16250.1|  unknown                                                 231   2e-66   Picea sitchensis
emb|CAN76391.1|  hypothetical protein VITISV_023592                     230   3e-66   Vitis vinifera
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             229   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    229   4e-66   Nicotiana tomentosiformis
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             230   4e-66   Nicotiana sylvestris
gb|AAD23730.1|  putative copper amine oxidase                           229   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053078.1|  Os04g0476100                                       224   4e-66   
ref|NP_181777.2|  copper amine oxidase family protein                   229   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             229   6e-66   Solanum tuberosum [potatoes]
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             229   9e-66   Camelina sativa [gold-of-pleasure]
dbj|BAJ87935.1|  predicted protein                                      224   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             228   1e-65   Solanum lycopersicum
dbj|BAF49520.1|  N-methylputrescine oxidase                             228   2e-65   Nicotiana tabacum [American tobacco]
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          228   2e-65   Sorghum bicolor [broomcorn]
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    228   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    228   2e-65   Nicotiana tomentosiformis
emb|CAE05498.2|  OSJNBa0022H21.18                                       226   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             227   3e-65   Nicotiana sylvestris
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             227   3e-65   Brassica rapa
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             227   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             227   3e-65   Capsella rubella
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    227   3e-65   Arabis alpina [alpine rockcress]
emb|CAH67316.1|  OSIGBa0106G07.12                                       226   4e-65   Oryza sativa [red rice]
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             226   5e-65   Camelina sativa [gold-of-pleasure]
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          227   6e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             226   6e-65   Brachypodium distachyon [annual false brome]
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             225   7e-65   
gb|EAY94528.1|  hypothetical protein OsI_16305                          226   9e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_001774529.1|  predicted protein                                  224   1e-64   
emb|CDY35376.1|  BnaA03g19840D                                          227   2e-64   Brassica napus [oilseed rape]
gb|EMS63127.1|  Primary amine oxidase                                   224   3e-64   Triticum urartu
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    224   5e-64   
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             224   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47975.1|  BnaA04g24530D                                          223   8e-64   Brassica napus [oilseed rape]
emb|CDY14839.1|  BnaC04g48360D                                          223   9e-64   Brassica napus [oilseed rape]
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    223   1e-63   Brassica rapa
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             223   1e-63   Setaria italica
ref|XP_001753509.1|  predicted protein                                  221   1e-63   
gb|KJB50256.1|  hypothetical protein B456_008G160800                    223   1e-63   Gossypium raimondii
gb|KJB50255.1|  hypothetical protein B456_008G160800                    223   1e-63   Gossypium raimondii
gb|KJB50257.1|  hypothetical protein B456_008G160800                    223   1e-63   Gossypium raimondii
emb|CDY22564.1|  BnaC03g23740D                                          224   2e-63   Brassica napus [oilseed rape]
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             225   2e-63   Phaseolus vulgaris [French bean]
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             221   2e-63   Medicago truncatula
ref|XP_001757203.1|  predicted protein                                  220   5e-63   
ref|XP_001759255.1|  predicted protein                                  218   4e-62   
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    217   1e-61   Glycine max [soybeans]
gb|EMT09520.1|  Copper methylamine oxidase                              217   2e-61   
emb|CAE02362.2|  OSJNBb0016B03.15                                       217   2e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EMS61925.1|  Copper methylamine oxidase                              215   8e-61   Triticum urartu
ref|NP_001173054.1|  Os02g0593150                                       199   1e-58   
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    208   2e-58   Nicotiana tomentosiformis
gb|EEC76708.1|  hypothetical protein OsI_14715                          203   9e-57   Oryza sativa Indica Group [Indian rice]
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          204   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEE57286.1|  hypothetical protein OsJ_07344                          199   1e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985875.1|  hypothetical protein SELMODRAFT_123165             197   2e-54   
ref|XP_002984811.1|  hypothetical protein SELMODRAFT_121227             196   3e-54   
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358             193   3e-53   
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550          189   9e-52   
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642             183   2e-49   Selaginella moellendorffii
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             173   5e-46   
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   169   9e-45   Citrus sinensis [apfelsine]
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      169   2e-44   
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   166   3e-43   Citrus sinensis [apfelsine]
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      165   4e-43   
gb|KJB19704.1|  hypothetical protein B456_003G116000                    161   9e-42   Gossypium raimondii
ref|WP_027094208.1|  tyramine oxidase                                   149   1e-37   Cohnella thermotolerans
ref|WP_036584415.1|  tyramine oxidase                                   147   4e-37   Paenibacillus darwinianus
ref|WP_025696771.1|  tyramine oxidase                                   146   6e-37   Paenibacillus durus
gb|EEC73513.1|  hypothetical protein OsI_07883                          146   6e-37   Oryza sativa Indica Group [Indian rice]
ref|WP_008317043.1|  Cu2+-containing amine oxidase                      143   1e-35   Leptolyngbya sp. PCC 6406
ref|WP_007920030.1|  tyramine oxidase                                   140   2e-34   Ktedonobacter racemifer
ref|WP_017299862.1|  tyramine oxidase                                   139   3e-34   Nodosilinea nodulosa
ref|WP_015845121.1|  tyramine oxidase                                   139   3e-34   Paenibacillus sp. JDR-2
ref|WP_039728302.1|  MULTISPECIES: tyramine oxidase                     138   7e-34   Lyngbya confervoides
gb|ABD03718.1|  putative copper methylamine oxidase                     138   1e-33   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_041436864.1|  tyramine oxidase                                   138   1e-33   
ref|WP_035986372.1|  tyramine oxidase                                   138   1e-33   Leptolyngbya sp. KIOST-1
ref|WP_011430198.1|  tyramine oxidase                                   138   1e-33   
ref|WP_008314860.1|  Cu2+-containing amine oxidase                      137   2e-33   Leptolyngbya sp. PCC 6406
ref|WP_036002001.1|  tyramine oxidase                                   137   3e-33   [Leptolyngbya] sp. JSC-1
gb|ETX01504.1|  hypothetical protein ETSY2_37115                        132   3e-33   Candidatus Entotheonella gemina
ref|WP_015186652.1|  Copper amine oxidase domain-containing protein     136   4e-33   Gloeocapsa sp. PCC 7428
ref|WP_015124381.1|  Cu2+-containing amine oxidase                      135   1e-32   Synechococcus sp. PCC 6312
ref|WP_006456034.1|  tyramine oxidase                                   134   2e-32   Synechococcus sp. PCC 7335
ref|WP_012627324.1|  tyramine oxidase                                   134   4e-32   Cyanothece sp. PCC 7425
ref|WP_036531589.1|  tyramine oxidase                                   133   4e-32   Neosynechococcus sphagnicola
ref|WP_029635581.1|  hypothetical protein                               133   5e-32   
ref|WP_006520181.1|  Cu2+-containing amine oxidase                      133   5e-32   Leptolyngbya sp. PCC 7375
ref|WP_026159538.1|  hypothetical protein                               133   7e-32   
ref|WP_012935344.1|  tyramine oxidase                                   133   8e-32   Conexibacter woesei
gb|AIA11119.1|  Copper amine oxidase, enzyme domain protein             125   1e-31   uncultured bacterium
ref|WP_041858942.1|  hypothetical protein                               132   2e-31   
gb|ABJ81915.1|  Amine oxidase (copper-containing)                       132   2e-31   Candidatus Solibacter usitatus Ellin6076
ref|WP_035742293.1|  tyramine oxidase                                   127   2e-31   
emb|CEG30995.1|  Primary amine oxidase precursor                        131   2e-31   Bacillus simplex
ref|WP_012873420.1|  tyramine oxidase                                   131   3e-31   Sphaerobacter thermophilus
ref|WP_009633550.1|  Cu2+-containing amine oxidase                      131   3e-31   Synechocystis sp. PCC 7509
ref|WP_036480875.1|  tyramine oxidase                                   131   4e-31   
ref|WP_024819190.1|  tyramine oxidase                                   130   5e-31   Arthrobacter sp. 31Y
ref|WP_043457655.1|  tyramine oxidase                                   130   5e-31   
ref|WP_035741463.1|  tyramine oxidase                                   127   6e-31   
ref|WP_042206338.1|  tyramine oxidase                                   130   7e-31   Paenibacillus durus
ref|WP_028930454.1|  tyramine oxidase                                   130   7e-31   Pseudonocardia asaccharolytica
ref|WP_029018078.1|  hypothetical protein                               130   8e-31   
ref|WP_040597665.1|  tyramine oxidase                                   130   1e-30   Patulibacter medicamentivorans
gb|EHN12772.1|  Monoamine oxidase                                       129   1e-30   Patulibacter medicamentivorans
ref|WP_036725089.1|  tyramine oxidase                                   129   3e-30   Paenibacillus forsythiae
ref|WP_020471082.1|  hypothetical protein                               128   3e-30   Zavarzinella formosa
ref|WP_003805961.1|  copper-containing amine oxidase                    125   4e-30   
ref|WP_037078438.1|  tyramine oxidase                                   128   4e-30   Pseudonocardia spinosispora
ref|WP_035743334.1|  tyramine oxidase                                   127   7e-30   Arthrobacter sp. MA-N2
ref|WP_034315126.1|  tyramine oxidase                                   127   7e-30   Bacillus simplex
ref|WP_019310622.1|  tyramine oxidase                                   127   7e-30   Kocuria
ref|WP_034299865.1|  hypothetical protein                               120   8e-30   
ref|WP_009075996.1|  tyramine oxidase                                   126   1e-29   Actinobacteria
ref|WP_033288818.1|  tyramine oxidase                                   125   2e-29   Amycolatopsis jejuensis
ref|WP_028063099.1|  tyramine oxidase                                   126   2e-29   Solirubrobacter soli
ref|WP_037709969.1|  tyramine oxidase                                   126   2e-29   Streptomyces mirabilis
ref|WP_034290510.1|  tyramine oxidase                                   125   3e-29   Bacillus sp. 72
ref|WP_026556508.1|  tyramine oxidase                                   125   3e-29   Arthrobacter sp. 35W
ref|WP_026556533.1|  tyramine oxidase                                   125   3e-29   Arthrobacter sp. 35W
ref|WP_017651781.1|  tyramine oxidase                                   125   3e-29   Fortiea contorta
ref|WP_015320499.1|  Cu2+-containing amine oxidase                      125   4e-29   Natronococcus occultus
ref|WP_043836428.1|  tyramine oxidase                                   125   4e-29   Amycolatopsis orientalis
ref|WP_037715216.1|  tyramine oxidase                                   125   4e-29   Actinobacteria
ref|WP_037817779.1|  tyramine oxidase                                   125   5e-29   Streptomyces sp. NRRL F-3213
gb|EFL10175.1|  tyramine oxidase                                        125   5e-29   Streptomyces sp. AA4
ref|WP_027416719.1|  tyramine oxidase                                   125   5e-29   Aneurinibacillus terranovensis
gb|EMP12147.1|  primary amine oxidase                                   125   5e-29   Gordonia sp. NB4-1Y
sp|Q07123.1|AMO2_ARTS1  RecName: Full=Copper methylamine oxidase;...    125   5e-29   Arthrobacter sp. P1
sp|Q07121.1|AMO1_ARTS1  RecName: Full=Primary amine oxidase; AltN...    125   5e-29   Arthrobacter sp. P1
ref|WP_037411516.1|  tyramine oxidase                                   124   7e-29   Solirubrobacter sp. URHD0082
ref|WP_018685630.1|  hypothetical protein                               124   8e-29   Actinokineospora enzanensis
ref|WP_028921142.1|  tyramine oxidase                                   124   8e-29   Pseudonocardia acaciae
ref|XP_005964261.1|  PREDICTED: copper amine oxidase 1-like             124   9e-29   
ref|WP_037362055.1|  tyramine oxidase                                   124   1e-28   Amycolatopsis orientalis
ref|WP_028074137.1|  tyramine oxidase                                   124   1e-28   
ref|WP_004562824.1|  tyramine oxidase                                   124   1e-28   Amycolatopsis vancoresmycina
ref|WP_012411235.1|  tyramine oxidase                                   124   1e-28   Nostoc punctiforme
ref|WP_026844103.1|  tyramine oxidase                                   124   2e-28   Geodermatophilaceae bacterium URHA0031
ref|WP_043709977.1|  tyramine oxidase                                   123   2e-28   
ref|WP_034266611.1|  tyramine oxidase                                   123   2e-28   Bacillus sp. Aph1
gb|EEB83863.1|  amine oxidase (copper-containing)                       117   2e-28   Roseobacter sp. GAI101
ref|WP_026104174.1|  tyramine oxidase                                   123   2e-28   Anabaena sp. PCC 7108
ref|WP_039923589.1|  tyramine oxidase                                   123   3e-28   
ref|XP_008907114.1|  hypothetical protein PPTG_13290                    123   3e-28   Phytophthora parasitica INRA-310
ref|WP_028921006.1|  hypothetical protein                               122   3e-28   
ref|WP_016205391.1|  tyramine oxidase                                   123   3e-28   Bacillus nealsonii
gb|ETO72786.1|  hypothetical protein F444_11200                         122   3e-28   Phytophthora parasitica P1976
gb|ETI44133.1|  hypothetical protein F443_11140                         122   3e-28   Phytophthora parasitica P1569
gb|ERK69570.1|  histamine oxidase                                       122   4e-28   Leifsonia aquatica ATCC 14665
ref|WP_018393282.1|  hypothetical protein                               122   4e-28   Bacillus sp. 37MA
ref|WP_034284434.1|  tyramine oxidase                                   122   4e-28   Bacillus sp. 72
ref|WP_005168021.1|  Monoamine oxidase                                  122   4e-28   Amycolatopsis azurea
ref|WP_033349571.1|  tyramine oxidase                                   122   4e-28   
ref|WP_005179100.1|  putative copper-containing amine oxidase           122   5e-28   Gordonia aichiensis
ref|WP_036335313.1|  tyramine oxidase                                   122   5e-28   Modestobacter caceresii
ref|WP_015595580.1|  tyramine oxidase                                   122   5e-28   Bacillus sp. 1NLA3E
ref|WP_033318483.1|  hypothetical protein                               122   6e-28   
ref|WP_014740127.1|  tyramine oxidase                                   122   7e-28   
ref|WP_034306167.1|  tyramine oxidase                                   121   7e-28   
ref|WP_024819386.1|  histamine oxidase                                  122   7e-28   
ref|WP_016333935.1|  primary-amine oxidase                              121   7e-28   
ref|XP_005703912.1|  primary-amine oxidase                              122   8e-28   
ref|WP_003350826.1|  tyramine oxidase                                   122   8e-28   
ref|WP_043710196.1|  tyramine oxidase                                   121   9e-28   
ref|WP_043427296.1|  tyramine oxidase                                   121   9e-28   
gb|AHY48354.1|  Cu2+-containing amine oxidase                           121   1e-27   
ref|WP_036338604.1|  tyramine oxidase                                   121   1e-27   
ref|WP_041339143.1|  tyramine oxidase                                   121   1e-27   
ref|WP_034285194.1|  tyramine oxidase                                   121   1e-27   
ref|WP_041242048.1|  tyramine oxidase                                   121   1e-27   
ref|WP_043470977.1|  histamine oxidase                                  121   1e-27   
ref|WP_035837338.1|  histamine oxidase                                  121   1e-27   
ref|WP_043806482.1|  histamine oxidase                                  121   1e-27   
gb|AFR27483.1|  Cu2+-containing amine oxidase                           121   1e-27   
gb|ADB74456.1|  Primary-amine oxidase                                   121   1e-27   
gb|ABM10002.1|  amine oxidase (copper-containing)                       121   1e-27   
gb|KGT47861.1|  hypothetical protein GW12_10980                         117   2e-27   
ref|WP_028066479.1|  tyramine oxidase                                   120   2e-27   
ref|WP_028065493.1|  tyramine oxidase                                   120   2e-27   
ref|WP_032385619.1|  hypothetical protein                               120   2e-27   
gb|AFY34999.1|  Copper amine oxidase domain-containing protein          121   2e-27   
ref|WP_035485230.1|  tyramine oxidase                                   120   2e-27   
ref|WP_042341482.1|  tyramine oxidase                                   120   2e-27   
ref|WP_034584673.1|  tyramine oxidase                                   117   2e-27   
gb|ETI43485.1|  hypothetical protein F443_11515                         120   2e-27   
gb|ETP41443.1|  hypothetical protein F442_11410                         120   2e-27   
ref|XP_008907589.1|  hypothetical protein PPTG_13573                    120   2e-27   
ref|WP_005556120.1|  tyramine oxidase                                   120   2e-27   
ref|WP_028276189.1|  histamine oxidase                                  120   2e-27   
ref|WP_041457930.1|  tyramine oxidase                                   120   2e-27   
ref|WP_011777249.1|  tyramine oxidase                                   120   2e-27   
gb|AFW94818.1|  amine oxidase                                           120   2e-27   
ref|WP_037336996.1|  tyramine oxidase                                   120   2e-27   
ref|WP_041312973.1|  tyramine oxidase                                   120   3e-27   
ref|WP_037305302.1|  tyramine oxidase                                   120   3e-27   
ref|WP_015217010.1|  Copper amine oxidase domain-containing protein     120   3e-27   
ref|WP_028390396.1|  tyramine oxidase                                   120   3e-27   
ref|WP_044853065.1|  tyramine oxidase                                   120   3e-27   
ref|XP_009515861.1|  hypothetical protein PHYSODRAFT_343894             120   3e-27   
ref|WP_026421607.1|  tyramine oxidase                                   120   3e-27   
ref|WP_038514355.1|  tyramine oxidase                                   120   3e-27   
emb|CCH30742.1|  Histamine oxidase                                      120   3e-27   
ref|WP_038549924.1|  histamine oxidase                                  120   3e-27   
ref|XP_009515875.1|  hypothetical protein PHYSODRAFT_343895             121   3e-27   
ref|WP_018760783.1|  tyramine oxidase                                   120   4e-27   
ref|WP_007029111.1|  tyramine oxidase                                   119   4e-27   
ref|WP_016730365.1|  tyramine oxidase                                   120   4e-27   
ref|WP_039731529.1|  tyramine oxidase                                   119   4e-27   
ref|WP_020636390.1|  tyramine oxidase                                   119   4e-27   
ref|WP_014513326.1|  tyramine oxidase                                   120   4e-27   
ref|WP_012714637.1|  tyramine oxidase                                   120   4e-27   
ref|WP_043742548.1|  tyramine oxidase                                   119   4e-27   
ref|WP_043643838.1|  tyramine oxidase                                   119   4e-27   
ref|WP_026552762.1|  histamine oxidase                                  119   4e-27   
ref|XP_005702395.1|  primary-amine oxidase                              119   4e-27   
ref|WP_034341918.1|  hypothetical protein                               119   5e-27   
ref|WP_040728048.1|  tyramine oxidase                                   119   5e-27   
ref|WP_028271227.1|  histamine oxidase                                  119   5e-27   
ref|WP_002616189.1|  nickel transporter                                 119   5e-27   
ref|WP_040270524.1|  tyramine oxidase                                   119   5e-27   
ref|WP_043806534.1|  tyramine oxidase                                   119   5e-27   
ref|WP_035876493.1|  histamine oxidase                                  119   5e-27   
ref|WP_018774097.1|  tyramine oxidase                                   119   6e-27   
gb|ABM07053.1|  copper methylamine oxidase                              119   6e-27   
ref|WP_037040542.1|  tyramine oxidase                                   119   6e-27   
ref|WP_024477500.1|  histamine oxidase                                  119   7e-27   
gb|EXF24973.1|  Histamine oxidase                                       119   7e-27   
ref|WP_036475588.1|  tyramine oxidase                                   119   7e-27   
ref|WP_025780611.1|  histamine oxidase                                  119   7e-27   
ref|WP_018770046.1|  tyramine oxidase                                   119   9e-27   
ref|WP_009377663.1|  tyramine oxidase                                   119   9e-27   
ref|WP_043834413.1|  tyramine oxidase                                   118   9e-27   
ref|WP_028676864.1|  tyramine oxidase                                   119   1e-26   
ref|WP_010144585.1|  tyramine oxidase                                   118   1e-26   
ref|WP_018330660.1|  hypothetical protein                               118   1e-26   
ref|WP_022928833.1|  tyramine oxidase                                   118   1e-26   
ref|WP_011693327.1|  tyramine oxidase                                   118   1e-26   
ref|WP_006090340.1|  tyramine oxidase                                   118   1e-26   
ref|WP_026538164.1|  histamine oxidase                                  118   1e-26   
ref|WP_009881574.1|  tyramine oxidase                                   118   1e-26   
ref|WP_003895293.1|  primary amine oxidase                              118   1e-26   
ref|WP_037049762.1|  tyramine oxidase                                   118   2e-26   
ref|WP_043484145.1|  histamine oxidase                                  118   2e-26   
ref|WP_027749196.1|  tyramine oxidase                                   117   2e-26   
ref|WP_011729366.1|  tyramine oxidase                                   118   2e-26   
ref|WP_026005433.1|  histamine oxidase                                  118   2e-26   
ref|WP_043807325.1|  histamine oxidase                                  118   2e-26   
ref|WP_020673325.1|  hypothetical protein                               118   2e-26   
gb|ABM10664.1|  amine oxidase, copper-containing                        118   2e-26   
gb|AJT42947.1|  tyramine oxidase                                        118   2e-26   
ref|WP_021765533.1|  hypothetical protein                               110   2e-26   
gb|AHG88986.1|  Copper amine oxidase domain-containing protein          118   2e-26   
ref|WP_014877840.1|  tyramine oxidase                                   118   2e-26   
ref|WP_039705665.1|  hypothetical protein                               117   2e-26   
ref|WP_037368234.1|  tyramine oxidase                                   117   2e-26   
ref|WP_036454811.1|  tyramine oxidase                                   117   2e-26   
ref|WP_019483707.1|  tyramine oxidase                                   117   2e-26   
gb|AGB23966.1|  Cu2+-containing amine oxidase                           117   2e-26   
ref|WP_041312313.1|  tyramine oxidase                                   117   2e-26   
gb|ELQ86689.1|  primary amine oxidase                                   117   2e-26   
ref|WP_018778238.1|  tyramine oxidase                                   117   3e-26   
gb|KJF19252.1|  Histamine oxidase                                       117   3e-26   
ref|WP_009078783.1|  tyramine oxidase                                   117   3e-26   
ref|WP_040019527.1|  tyramine oxidase                                   117   3e-26   
ref|WP_003803495.1|  tyramine oxidase                                   117   3e-26   
ref|WP_026543389.1|  histamine oxidase                                  117   3e-26   
ref|WP_038680250.1|  tyramine oxidase                                   117   3e-26   
ref|WP_028267210.1|  histamine oxidase                                  117   3e-26   
ref|WP_007144763.1|  tyramine oxidase                                   117   3e-26   
ref|WP_032366965.1|  tyramine oxidase                                   117   4e-26   
ref|WP_018395580.1|  hypothetical protein                               117   4e-26   
pdb|2E2U|A  Chain A, Substrate Schiff-base Analogue Of Copper Ami...    117   4e-26   
ref|WP_043742191.1|  tyramine oxidase                                   117   4e-26   
ref|WP_043806367.1|  histamine oxidase                                  117   4e-26   
ref|WP_039731313.1|  tyramine oxidase                                   117   4e-26   
pdb|1UI7|A  Chain A, Site-Directed Mutagenesis Of His433 Involved...    117   4e-26   
ref|WP_003799421.1|  tyramine oxidase                                   117   4e-26   
ref|WP_014922900.1|  tyramine oxidase                                   117   4e-26   
pdb|3WA2|X  Chain X, High Resolution Crystal Structure Of Copper ...    116   5e-26   
pdb|2CWT|A  Chain A, Catalytic Base Deletion In Copper Amine Oxid...    116   5e-26   
pdb|2YX9|A  Chain A, Crystal Structure Of D298k Copper Amine Oxid...    116   5e-26   
pdb|1IVV|A  Chain A, Crystal Structure Of Copper Amine Oxidase Fr...    116   5e-26   
ref|WP_043455865.1|  histamine oxidase                                  116   5e-26   
ref|WP_040431327.1|  tyramine oxidase                                   116   5e-26   
ref|WP_039243055.1|  histamine oxidase                                  116   5e-26   
pdb|1SIH|A  Chain A, Agao In Covalent Complex With The Inhibitor ...    116   6e-26   
ref|WP_015938722.1|  tyramine oxidase                                   116   6e-26   
ref|WP_044571418.1|  histamine oxidase                                  116   6e-26   
ref|WP_024818298.1|  histamine oxidase                                  116   7e-26   
ref|WP_037080446.1|  hypothetical protein                               116   7e-26   
ref|WP_026547874.1|  histamine oxidase                                  116   8e-26   
ref|WP_020874939.1|  hypothetical protein                               109   8e-26   
ref|WP_037805791.1|  tyramine oxidase                                   115   9e-26   
ref|WP_014377254.1|  tyramine oxidase                                   115   9e-26   
ref|WP_037709039.1|  tyramine oxidase                                   115   1e-25   
ref|XP_009515100.1|  hypothetical protein PHYSODRAFT_539188             115   1e-25   
ref|WP_015140710.1|  Cu2+-containing amine oxidase                      115   1e-25   
ref|XP_009515103.1|  hypothetical protein PHYSODRAFT_247622             116   1e-25   
ref|WP_031465870.1|  tyramine oxidase                                   115   1e-25   
ref|WP_029431775.1|  tyramine oxidase                                   115   1e-25   
ref|WP_044379234.1|  tyramine oxidase                                   115   1e-25   
ref|WP_020510980.1|  hypothetical protein                               115   1e-25   
ref|WP_024084556.1|  tyramine oxidase                                   115   1e-25   
gb|AJP05492.1|  tyramine oxidase                                        115   1e-25   
ref|WP_007296131.1|  MULTISPECIES: tyramine oxidase                     115   1e-25   
ref|WP_033292479.1|  tyramine oxidase                                   115   2e-25   
ref|WP_027941288.1|  tyramine oxidase                                   115   2e-25   
ref|WP_027133873.1|  hypothetical protein                               115   2e-25   
ref|WP_010523912.1|  tyramine oxidase                                   115   2e-25   
gb|ETK31731.1|  tyramine oxidase                                        115   2e-25   
ref|WP_036331439.1|  hypothetical protein                               115   2e-25   
ref|WP_015211381.1|  Cu2+-containing amine oxidase                      115   2e-25   
ref|WP_007694497.1|  tyramine oxidase                                   115   2e-25   
ref|WP_010612233.1|  tyramine oxidase                                   115   2e-25   
ref|WP_015889407.1|  tyramine oxidase                                   115   2e-25   
gb|AII05461.1|  tyramine oxidase                                        115   2e-25   
ref|WP_006066801.1|  tyramine oxidase                                   115   2e-25   
ref|WP_035770172.1|  hypothetical protein                               114   3e-25   
ref|WP_013675838.1|  tyramine oxidase                                   114   3e-25   
ref|WP_017200065.1|  tyramine oxidase                                   114   3e-25   
ref|WP_015113274.1|  Copper amine oxidase domain-containing protein     114   3e-25   
ref|WP_037408872.1|  tyramine oxidase                                   114   4e-25   
ref|WP_009478859.1|  tyramine oxidase                                   114   4e-25   
ref|WP_016883509.1|  tyramine oxidase                                   114   4e-25   
ref|WP_011597752.1|  tyramine oxidase                                   114   4e-25   
ref|WP_037243707.1|  tyramine oxidase                                   114   4e-25   
ref|WP_026266296.1|  tyramine oxidase                                   114   4e-25   
ref|WP_011278970.1|  tyramine oxidase                                   114   4e-25   
gb|AFA74340.1|  histamine oxidase                                       114   5e-25   
ref|WP_027331473.1|  tyramine oxidase                                   114   5e-25   
ref|WP_043709465.1|  tyramine oxidase                                   114   5e-25   
ref|WP_005562649.1|  tyramine oxidase                                   114   5e-25   
ref|WP_005260964.1|  tyramine oxidase                                   114   5e-25   
sp|Q59118.3|AMOH_ARTGO  RecName: Full=Histamine oxidase; AltName:...    114   5e-25   
ref|WP_007301564.1|  tyramine oxidase                                   114   5e-25   
ref|WP_011595316.1|  tyramine oxidase                                   114   5e-25   
ref|WP_016882495.1|  tyramine oxidase                                   114   5e-25   
ref|WP_005250970.1|  tyramine oxidase                                   114   5e-25   
ref|WP_040815337.1|  hypothetical protein                               114   5e-25   
ref|WP_036398013.1|  histamine oxidase                                  114   5e-25   
ref|WP_043456625.1|  histamine oxidase                                  114   5e-25   
ref|WP_006372895.1|  tyramine oxidase                                   114   6e-25   
ref|WP_026919970.1|  histamine oxidase                                  114   6e-25   
ref|WP_013678400.1|  tyramine oxidase                                   114   6e-25   
ref|WP_024445852.1|  tyramine oxidase                                   113   6e-25   
ref|WP_038993072.1|  histamine oxidase                                  113   6e-25   
ref|WP_020502057.1|  hypothetical protein                               113   7e-25   
ref|WP_037226125.1|  tyramine oxidase                                   113   7e-25   
ref|WP_008356972.1|  tyramine oxidase                                   113   7e-25   
ref|WP_008413752.1|  tyramine oxidase                                   113   7e-25   
gb|AII08562.1|  tyramine oxidase                                        113   7e-25   
ref|WP_043409861.1|  tyramine oxidase                                   113   7e-25   
ref|WP_039714126.1|  tyramine oxidase                                   113   7e-25   
ref|WP_012689537.1|  tyramine oxidase                                   113   8e-25   
ref|WP_005238602.1|  tyramine oxidase                                   113   8e-25   
pdb|1UI8|A  Chain A, Site-directed Mutagenesis Of His592 Involved...    113   8e-25   
ref|WP_015155560.1|  Copper amine oxidase domain-containing protein     113   8e-25   
ref|WP_033288996.1|  tyramine oxidase                                   113   9e-25   
dbj|BAE48148.1|  histamine oxidase                                      113   9e-25   
ref|WP_036460719.1|  tyramine oxidase                                   113   9e-25   
gb|AGQ16873.1|  histamine oxidase                                       113   9e-25   
ref|WP_040167401.1|  hypothetical protein                               113   9e-25   
ref|XP_009517643.1|  hypothetical protein PHYSODRAFT_264020             112   1e-24   
ref|WP_041038062.1|  tyramine oxidase                                   113   1e-24   
ref|WP_044440882.1|  hypothetical protein                               112   1e-24   
ref|WP_026134453.1|  tyramine oxidase                                   113   1e-24   
ref|WP_009475297.1|  tyramine oxidase                                   112   1e-24   
ref|WP_038376103.1|  hypothetical protein                               107   1e-24   
gb|EWM22333.1|  copper amine oxidase                                    112   1e-24   
ref|WP_019545195.1|  hypothetical protein                               112   1e-24   
ref|WP_011894003.1|  tyramine oxidase                                   112   1e-24   
ref|WP_013471531.1|  tyramine oxidase                                   112   1e-24   
ref|XP_005851907.1|  hypothetical protein CHLNCDRAFT_18415              112   1e-24   
gb|EUA67739.1|  copper amine oxidase, enzyme domain protein             110   1e-24   
ref|WP_005191609.1|  tyramine oxidase                                   112   2e-24   
ref|WP_007301176.1|  tyramine oxidase                                   112   2e-24   
ref|WP_005571846.1|  tyramine oxidase                                   112   2e-24   



>emb|CDP13211.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNC  LA  EAKFLRRAAFLKHNLWVTPY+ +E FPGGEFPN
Sbjct  129  TRAVNRTGQLTGYKLVPGSNCQRLARPEAKFLRRAAFLKHNLWVTPYSHDEKFPGGEFPN  188

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV++NRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  189  QNPRVGEGLATWVRENRPLEETDIVLWYVFGVTHVPRLEDWPVMPVEHIGFTLMPHGFFN  248

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPA+DVP SS D D KENG+ITKPCH GLVAKL
Sbjct  249  CSPAIDVPLSSCDSDVKENGMITKPCHNGLVAKL  282



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  598  TRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  657

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEETDIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  658  QNPRVGEGLATWVKQNRPLEETDIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  717

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPSS D D K+N V+TKP + GLVAKL
Sbjct  718  CSPAVDVPPSSCDSDVKDNVVVTKPINNGLVAKL  751



>gb|KCW86673.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
 gb|KCW86674.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
Length=345

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  192  TRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  251

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  252  QNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  311

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  312  CSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  345



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   258 bits (660),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PGGEFPN
Sbjct  585  TRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPGGEFPN  644

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  645  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  704

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  705  CSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  738



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PGGEFPN
Sbjct  548  TRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPGGEFPN  607

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  608  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  667

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  668  CSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  701



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PGGEFPN
Sbjct  613  TRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPGGEFPN  672

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  673  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  732

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  733  CSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  766



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PGGEFPN
Sbjct  616  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  676  QNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  735

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  736  CSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  769



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R+EM+PGGEFPN
Sbjct  628  TRSVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSRDEMYPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGLA+WVKQ+R LEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  688  QNPRIGEGLATWVKQDRSLEETDIVLWYVFGITHIPRLEDWPVMPVERIGFMLMPHGFFN  747

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+++D D K+N ++TK  H GL+AKL
Sbjct  748  CSPAVDVPPNASDLDLKDN-IVTKSIHNGLLAKL  780



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PGGEFPN
Sbjct  611  TRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPGGEFPN  670

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  671  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  730

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  731  CSPAVDVPPNPSDLDDKENGLPAKPIQNGLIAKL  764



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRA+FLKHNLWVTPY+R+EM+PGGEFPN
Sbjct  588  TRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPYSRDEMYPGGEFPN  647

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  648  QNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVERIGFMLMPHGFFN  707

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  708  CSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  740



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  643  TRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  702

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  703  QNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  762

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  763  CSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  796



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRA+FLKHNLWVTPY+R+EM+PGGEFPN
Sbjct  614  TRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPYSRDEMYPGGEFPN  673

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  674  QNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVERIGFMLMPHGFFN  733

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  734  CSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  766



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PGGEFPN
Sbjct  644  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPGGEFPN  703

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  704  QNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  763

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  764  CSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  797



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  547  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMPHGFFN
Sbjct  607  QNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  667  CSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  700



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  553  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  612

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMPHGFFN
Sbjct  613  QNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMPHGFFN  672

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D D K+NGV  KP   GL+AKL
Sbjct  673  CSPAVDVPPSTCDLDLKDNGVTGKPIQNGLLAKL  706



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  621  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  680

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMPHGFFN
Sbjct  681  QNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMPHGFFN  740

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  741  CSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  774



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PGGEFPN
Sbjct  607  TRSVNRTGYLTGYKLVPGANCLPLAGSEAKFLRRAAFLKHNLWVTPYARGEMYPGGEFPN  666

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNRPLEE D+VLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  667  QNPRDGEGLATWVKQNRPLEEADVVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  726

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS +D D KENG+  KP   GL+AKL
Sbjct  727  CSPAVDVPPSPSDLDDKENGMPAKPSQNGLIAKL  760



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  548  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  607

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  608  QNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  667

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  668  CSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  701



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  682  QNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  742  CSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  682  QNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  742  CSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_008777611.1| PREDICTED: copper amine oxidase 1-like, partial [Phoenix dactylifera]
Length=204

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY R+EM+PGGEFPN
Sbjct  51   TRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYNRDEMYPGGEFPN  110

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR  EGLA+WVK+NR LEETDIVLWY+FGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  111  QNPRPNEGLATWVKKNRSLEETDIVLWYIFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  170

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CS AVDVPPS+++ D K+N    K     L+AKL
Sbjct  171  CSTAVDVPPSTSEMDVKDNNGTPKLIQNALLAKL  204



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  632  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  691

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  692  QNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  751

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  752  CSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  785



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PGGEFPN
Sbjct  547  TRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  607  QNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  667  CSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  700



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PGGEFPN
Sbjct  571  TRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPGGEFPN  630

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  631  QNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  690

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  691  CSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  724



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PGGEFPN
Sbjct  621  TRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPGGEFPN  680

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  681  QNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  740

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  741  CSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  774



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PGGEFPN
Sbjct  608  TRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPGGEFPN  667

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  668  QNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  727

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  728  CSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  761



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PGGEFPN
Sbjct  628  TRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMPHGFFN
Sbjct  688  QNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMPHGFFN  747

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  748  CSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  781



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPGGEFPN
Sbjct  634  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  694  QNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQPHGFFN  753

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N V    + KP   GL++K+
Sbjct  754  CSPAVDVPPNACELDGKDNDVKDNGVAKPIQTGLLSKI  791



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY+ +EMFPGGEFPN
Sbjct  625  TRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPYSGDEMFPGGEFPN  684

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  685  QNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVEHIGFMLQPHGFFN  744

Query  381  CspavdvppssadpdPKENGVITKPCHP-GLVAKL  280
            CSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  745  CSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>gb|KJB50258.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=779

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PGGEFPN
Sbjct  626  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPGGEFPN  685

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  686  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  745

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  746  CSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  779



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   253 bits (646),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PGGEFPN
Sbjct  622  TRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMPHGFFN
Sbjct  682  QNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  742  CSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTG+KL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  547  TRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  607  QNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
             SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  667  SSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPGGEFPN
Sbjct  551  TRTVNRTGHLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPN  610

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  611  QNPRVGEGLATWVQQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLTPHGFFN  670

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K++ V    + KP   G+++KL
Sbjct  671  CSPAVDVPPNACELDAKDSDVKDAGVAKPIQNGMLSKL  708



>gb|KJB50254.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=789

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PGGEFPN
Sbjct  636  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPGGEFPN  695

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  696  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  755

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  756  CSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  789



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  548  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  607

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  608  QNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  667

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  668  CSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  701



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  547  TRTVNRSGQLTGYKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP+GFFN
Sbjct  607  QNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPYGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
             SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  667  SSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY  +EMFPGGEFPN
Sbjct  625  TRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPYCGDEMFPGGEFPN  684

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  685  QNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVEHIGFMLQPHGFFN  744

Query  381  CspavdvppssadpdPKENGVITKPCHP-GLVAKL  280
            CSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  745  CSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPGGEFPN
Sbjct  630  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPN  689

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  690  QNPRVGEGLATWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVERIGFMLSPHGFFN  749

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ + D KE  V    + KP   GL++KL
Sbjct  750  CSPAVDVPPNACELDAKETDVKENGVGKPIQSGLLSKL  787



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTG+KL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PGGEFPN
Sbjct  613  TRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPGGEFPN  672

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  673  QNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  732

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
             SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  733  SSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  766



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PGGEFPN
Sbjct  584  TRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPGGEFPN  643

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  644  QNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  703

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  704  CSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  737



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PGGEFPN
Sbjct  597  TRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPGGEFPN  656

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  657  QNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  716

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  717  CSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  750



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PGGEFPN
Sbjct  651  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPGGEFPN  710

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  711  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  770

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  771  CSPAVDVPPSATDLELKDADIATKPIQNGIIAKL  804



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+E++PGGEFPN
Sbjct  624  TRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEVYPGGEFPN  683

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMPHGFFN
Sbjct  684  QNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMPHGFFN  743

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  744  CSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+E++PGGEFPN
Sbjct  624  TRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEVYPGGEFPN  683

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMPHGFFN
Sbjct  684  QNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMPHGFFN  743

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  744  CSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  682  QNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  742  CSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  775



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  641  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAPDEMYPGGEFPN  700

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEET+IVLWYVFGVTH+PRLEDWPVMPVERIGF+LMPHGFFN
Sbjct  701  QNPRVGEGLATWVKQNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVERIGFILMPHGFFN  760

Query  381  CspavdvppssadpdPKENGVITK-PCHPGLVAKL  280
            CSPAVDVPPS+ D D K+NG+  K P   GL+AKL
Sbjct  761  CSPAVDVPPSACDMDIKDNGITAKPPIQNGLLAKL  795



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  603  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  662

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  663  QNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVDRIGFMLMPHGFFN  722

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  723  CSPAVDVPPSTTDLELKDNDIATKPIQNVIIAKL  756



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFL HNLWVTPY   EMFPGGEFPN
Sbjct  616  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPYTHGEMFPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  676  QNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  735

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N      ++KP   G++AKL
Sbjct  736  CSPAVDVPPSACELDAKDNDAKDNSVSKPLQNGVLAKL  773



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPGGEFPN
Sbjct  594  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPGGEFPN  653

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMPHGFFN
Sbjct  654  QNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMPHGFFN  713

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  714  CSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  751



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R EMFPGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSREEMFPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  682  QNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVEHIGFMLQPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCH-PGLVAKL  280
            CSPAVDVPPS +D D KENG + K CH  G+++KL
Sbjct  742  CSPAVDVPPSMSDSDIKENGTVAKSCHNDGVMSKL  776



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PGGEFPN
Sbjct  608  TRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPGGEFPN  667

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  668  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  727

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D D KEN +  KP   GL+AKL
Sbjct  728  CSPAVDVPPSAGDLDDKENVMSAKPIQNGLIAKL  761



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPGGEFPN
Sbjct  640  TRTVNRMGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPN  699

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV EGL++WVKQNR LEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  700  QNPRVAEGLSTWVKQNRSLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  759

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP+  + D KEN V    + KP   GL+AKL
Sbjct  760  CSPAVDVPPNVCELDIKENDVKENGVAKPLQNGLLAKL  797



>gb|KJB15626.1| hypothetical protein B456_002G186900 [Gossypium raimondii]
Length=771

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  618  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  678  QNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVDRIGFMLMPHGFFN  737

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  738  CSPAVDVPPSTTDLELKDNDIATKPVQNVIIAKL  771



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EMFPGGEFPN
Sbjct  631  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMFPGGEFPN  690

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  691  QNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  750

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
             SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  751  ASPAVDVPPSACELEAKENDVKDSGVAKPIQSGLLAKL  788



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PGGEFPN
Sbjct  607  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPGEMHPGGEFPN  666

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  667  QNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVERIGFMLMPHGFFN  726

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  727  CSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  760



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPGGEFPN
Sbjct  614  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPGGEFPN  673

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMPHGFFN
Sbjct  674  QNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMPHGFFN  733

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  734  CSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  771



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM PGGEFPN
Sbjct  622  TRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMNPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMPHGFFN
Sbjct  682  QNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  742  CSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPGGEFPN
Sbjct  617  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPGGEFPN  676

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMPHGFFN
Sbjct  677  QNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMPHGFFN  736

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  737  CSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  774



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   250 bits (639),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLP+AG+EAKFLRRAAFLKHNLWVTPY   EM PGGEFPN
Sbjct  617  TRTVNRTGQLTGYKLVPGSNCLPMAGSEAKFLRRAAFLKHNLWVTPYVPGEMHPGGEFPN  676

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  677  QNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVERIGFMLMPHGFFN  736

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  737  CSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  770



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EMFPGGEFPN
Sbjct  631  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMFPGGEFPN  690

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  691  QNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  750

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
             SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  751  ASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_004309984.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PGGEFPN
Sbjct  627  TRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPGGEFPN  686

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+Q+R LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGF LMPHGFFN
Sbjct  687  QNPRVGEGLATWVQQDRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFTLMPHGFFN  746

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CS AVDVPP++ + D KEN + TKP    LVAKL
Sbjct  747  CSTAVDVPPNTCENDLKENEMSTKPIQTALVAKL  780



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PGGEFPN
Sbjct  616  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPEEMHPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF+LMPHGFFN
Sbjct  676  QNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFLLMPHGFFN  735

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  736  CSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  769



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFL HNLWVTPY   EMFPGGEFPN
Sbjct  620  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPYTHGEMFPGGEFPN  679

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  680  QNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  739

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + + K+N      + KP   G++AKL
Sbjct  740  CSPAVDVPPSACELEAKDNDAKDNSVAKPLQNGVLAKL  777



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PGGEFPN
Sbjct  604  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPEEMHPGGEFPN  663

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF+LMPHGFFN
Sbjct  664  QNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFLLMPHGFFN  723

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  724  CSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  757



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PGGEFPN
Sbjct  601  TRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPGGEFPN  660

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  661  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMPHGFFN  720

Query  381  CspavdvppssadpdPKE-NGVITKPCHPGLVAKL  280
            CSPA+DVPP+  D D KE NG+  KP   GL+AKL
Sbjct  721  CSPAIDVPPNPGDLDDKENNGLPAKPNQNGLIAKL  755



>gb|AFK48029.1| unknown [Lotus japonicus]
Length=174

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 135/158 (85%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLA +EAKFLRRAAFLKHNLWVT Y+ +E+FPGGEFPN
Sbjct  17   TRSGNRTGQLTGYKLVPGSNCLPLARSEAKFLRRAAFLKHNLWVTKYSHDEVFPGGEFPN  76

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV EGLA+WVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  77   QNPRVSEGLATWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  136

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++   D K+N V     +K     L AKL
Sbjct  137  CSPAVDVPPNTCVGDSKDNDVKDNGASKTIPGALAAKL  174



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   252 bits (644),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPGGEFPN
Sbjct  633  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPN  692

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  693  QNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQPHGFFN  752

Query  381  C  379
            C
Sbjct  753  C  753



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   248 bits (633),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  631  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPGGEFPN  690

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  691  QNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  750

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
             SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  751  ASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   248 bits (632),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  631  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPGGEFPN  690

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  691  QNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  750

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
             SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  751  ASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   248 bits (632),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  628  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  688  QNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  747

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
             SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  748  ASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  628  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  688  QNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVERIGFMLMPHGFFN  747

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
             SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  748  ASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R E+FPGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSREEIFPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  682  QNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVEHIGFMLQPHGFFN  741

Query  381  CspavdvppssadpdPKENGVITKPCHPGLV  289
            CSPAVDVPPS +D D KENG + K CH   V
Sbjct  742  CSPAVDVPPSMSDSDIKENGTVAKSCHNDAV  772



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YA+NEM+PGGEFPN
Sbjct  619  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSYAQNEMYPGGEFPN  678

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK++R LEE DIVLWYVFG+TH+PRLEDWPVMPVE +GFMLMPHGFFN
Sbjct  679  QNPRSGEGLATWVKKDRSLEEADIVLWYVFGLTHIPRLEDWPVMPVEHLGFMLMPHGFFN  738

Query  381  CspavdvppssadpdPKE-NGVITKPCHPGLVAKL  280
            CSPAVDVPP++ + D KE NGV+ KP   GL+AKL
Sbjct  739  CSPAVDVPPNTHESDSKETNGVVAKPVQNGLIAKL  773



>ref|XP_004301007.1| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EM+PGGEFPN
Sbjct  632  TRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMYPGGEFPN  691

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE +GF+LMPHGFFN
Sbjct  692  QNPRVGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVEHLGFVLMPHGFFN  751

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            C PAVDVPPS+ + + KE+ V    + KP   GL+AKL
Sbjct  752  CCPAVDVPPSACESEVKEDDVKDNGVAKPIQNGLMAKL  789



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPGGEFPN
Sbjct  640  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRYAPDEMFPGGEFPN  699

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  700  QNPRAGEGLATWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMPHGFFN  759

Query  381  CspavdvppssadpdPKEN----GVITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N     V+ K    GL+AKL
Sbjct  760  CSPAVDVPPNACELDTKDNEIKENVVPKSTQNGLLAKL  797



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPGGEFPN
Sbjct  618  TRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  678  QNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  737

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  738  CSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPGGEFPN
Sbjct  618  TRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  678  QNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  737

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  738  CSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  634  TRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+PHGFFN
Sbjct  694  QNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLPHGFFN  753

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  754  CSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  791



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  547  TRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+PHGFFN
Sbjct  607  QNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLPHGFFN  666

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  667  CSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  704



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   246 bits (627),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EM+PGGEFPN
Sbjct  649  TRNVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAKDEMYPGGEFPN  708

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV QNR LEE DIVLWYVFGVTH+PRLEDWPVMP +RIGFMLMPHGFFN
Sbjct  709  QNPRVGEGLATWVNQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPADRIGFMLMPHGFFN  768

Query  381  CspavdvppssadpdPKE--NGVITKPCH  301
            CSPAVDVPPSS+D + K+  NGV  KP H
Sbjct  769  CSPAVDVPPSSSDLELKDNGNGVTAKPIH  797



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPGGEFPN
Sbjct  547  TRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  607  QNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  667  CSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  704



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPGGEFPN
Sbjct  618  TRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  678  QNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  737

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  738  CSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y R+E +PGGEFPN
Sbjct  634  TRSVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYKRDEKYPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  694  QNPRIDEGLATWVKQNRPLEENDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMPHGFFN  753

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPSS + D KE GV  KP   GLV+KL
Sbjct  754  CSPAVDVPPSSTETDLKEIGV-PKPLQNGLVSKL  786



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR E FPGGEFPN
Sbjct  620  TRSVNRNGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARGEDFPGGEFPN  679

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQNR LEE DIVLWYVFG+THVPRLEDWPVMPVE IGF+L PHGFFN
Sbjct  680  QNPRVGEGLASWVKQNRSLEEADIVLWYVFGITHVPRLEDWPVMPVEHIGFVLQPHGFFN  739

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ D D KEN V    + K    GL+AKL
Sbjct  740  CSPAVDVPPNACDMDAKENDVKDNGVAKSISSGLIAKL  777



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLP+AG EAKFLRRAAFLKHNLWVT YAR E FPGGEFPN
Sbjct  616  TRTVNRTGQLTGYKLVPGSNCLPMAGPEAKFLRRAAFLKHNLWVTQYARGEDFPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL SWVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGF+L PHGFFN
Sbjct  676  QNPRVGEGLDSWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFLLQPHGFFN  735

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP + + D K+N V    + KP   GLVAKL
Sbjct  736  CSPAVDVPPGACEMDGKDNDVKESSLAKPIPTGLVAKL  773



>gb|EPS71193.1| hypothetical protein M569_03564, partial [Genlisea aurea]
Length=202

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YAR E FPGGEFPN
Sbjct  56   TRAVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYARGEDFPGGEFPN  115

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLASWVKQNR LEE DIVLWYVFG+THVPR EDWPVMPVE IGF+L PHGFFN
Sbjct  116  QNPRAGEGLASWVKQNRSLEEADIVLWYVFGITHVPRPEDWPVMPVEHIGFVLQPHGFFN  175

Query  381  CspavdvppssadpdPKEN  325
            CSPAVDVPP++ + + KEN
Sbjct  176  CSPAVDVPPNACETESKEN  194



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 137/162 (85%), Gaps = 8/162 (5%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVTPYA NEMFPGGEFPN
Sbjct  628  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTPYAPNEMFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  688  QNPRVGEGLATWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFTLMPHGFFN  747

Query  381  Cspavdv-------ppssadpdPKENGVITKPCHP-GLVAKL  280
            CSPAVDV          + D D KEN V +KP    GL+AKL
Sbjct  748  CSPAVDVPPSLSPCELDTKDSDVKENVVASKPIQNGGLLAKL  789



>gb|AES71447.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=548

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPGGEFPN
Sbjct  391  TRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPGGEFPN  450

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  451  QNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMPHGFFN  510

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  511  CSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  548



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y+R+E+FPGGEFPN
Sbjct  567  TRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRDELFPGGEFPN  626

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  627  QNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVERIGFMLTPHGFFN  686

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  687  CSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  724



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EMFPGGEFPN
Sbjct  626  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAQDEMFPGGEFPN  685

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV EGLA+WV +NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  686  QNPRVSEGLATWVNKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  745

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVA  286
            CSPAVDVPPS+ + + K+N V    + K    GL+A
Sbjct  746  CSPAVDVPPSACELEAKDNDVKDNGVAKSIPNGLLA  781



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y+R+E+FPGGEFPN
Sbjct  617  TRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRDELFPGGEFPN  676

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  677  QNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVERIGFMLTPHGFFN  736

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  737  CSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  774



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY R+EM+PGGEFPN
Sbjct  618  TRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYNRDEMYPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR  EGLA+WVK+NRPLEETDIVLWY+FGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  678  QNPRPNEGLATWVKKNRPLEETDIVLWYIFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  737

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP  ++ + K+N    K    GL+AKL
Sbjct  738  CSPAVDVPPGHSEVEVKDNNGTPKLIQNGLLAKL  771



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPGGEFPN
Sbjct  612  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYAPDEMFPGGEFPN  671

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  672  QNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  731

Query  381  CspavdvppssadpdPKENGV  319
            CSPAVDVPPS+ D D K+N V
Sbjct  732  CSPAVDVPPSTCDMDAKDNEV  752



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   246 bits (629),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPGGEFPN
Sbjct  612  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYAPDEMFPGGEFPN  671

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  672  QNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  731

Query  381  C  379
            C
Sbjct  732  C  732



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRA FLKHNLWVTPY  NEMFPGGEFPN
Sbjct  629  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRATFLKHNLWVTPYDPNEMFPGGEFPN  688

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WVKQNR LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  689  QNPRVGEGLATWVKQNRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFTLMPHGFFN  748

Query  381  Cspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV        + D D K+N + +KP   GL+AKL
Sbjct  749  CSPAVDVPPNPCEFETKDNDVKDNAISSKPIQSGLLAKL  787



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPGGEFPN
Sbjct  620  TRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPGGEFPN  679

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQ+R LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  680  QNPRAGEGLATWVKQDRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  739

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  740  CSPAVDVPPNACELDTKDNDIKENVVPKSMQNGLMSKL  777



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  634  TRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+PHGFFN
Sbjct  694  QNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLPHGFFN  753

Query  381  CspavdvppssadpdPKE----NGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  754  CSPAVDVPPSTCELDSKDADPKENVVTKPIQTPIIAKL  791



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 7/161 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPGGEFPN
Sbjct  634  TRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+PHGFFN
Sbjct  694  QNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLPHGFFN  753

Query  381  CspavdvppssadpdPKEN-------GVITKPCHPGLVAKL  280
            CSPAVDVPPS+ + D K++        V+TKP    ++AKL
Sbjct  754  CSPAVDVPPSTCELDSKDSKDADPKENVVTKPIQTPIIAKL  794



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPGGEFPN
Sbjct  547  TRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  607  QNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  667  CSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  704



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPGGEFPN
Sbjct  612  TRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPGGEFPN  671

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  672  QNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMPHGFFN  731

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  732  CSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  769



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPGGEFPN
Sbjct  517  TRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPGGEFPN  576

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  577  QNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMPHGFFN  636

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  637  CSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  674



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   240 bits (613),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPGGEFPN
Sbjct  610  TRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPGGEFPN  669

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+W+KQ+R LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  670  QNPRVGEGLATWIKQDRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMPHGFFN  729

Query  381  CspavdvppssadpdPKENGVIT----KPCHPGLVAKL  280
            CSPAVDVPPSS + + K+N +      KP   GL +KL
Sbjct  730  CSPAVDVPPSSCEAESKDNDIKDNGAPKPIPSGLASKL  767



>gb|KJB19706.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
 gb|KJB19707.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=791

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPGGEFPN
Sbjct  634  TRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK++R LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  694  QNPRAGEGLATWVKRDRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMPHGFFN  753

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  754  CSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  791



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y+RNEMFPGGEFPN
Sbjct  613  TRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRNEMFPGGEFPN  672

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR  EGLA+WVKQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  673  QNPRDREGLATWVKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLTPHGFFN  732

Query  381  CspavdvppssadpdPKENGV----ITKPCHPGLVAKL  280
            CSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  733  CSPAVDVPPNACEMDSKDNEIKDNGSSKPIQNGLTAKL  770



>ref|XP_004289862.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 136/154 (88%), Gaps = 4/154 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y+ +EMFPGGEFPN
Sbjct  591  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQYSPDEMFPGGEFPN  650

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLA+WV++NR LEETDIVLWYVFG+THVPRLEDWPVMPVE IGF L+PHGFFN
Sbjct  651  QNPRVGEGLATWVQKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVEHIGFKLVPHGFFN  710

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPS+ +   KE+ V       GL+AKL
Sbjct  711  CSPAVDVPPSACESKAKEDDVKDN----GLMAKL  740



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPGGEFPN
Sbjct  552  TRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPGGEFPN  611

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  612  QNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLMPHGFFN  671

Query  381  C  379
            C
Sbjct  672  C  672



>gb|ACN27241.1| unknown [Zea mays]
Length=246

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPGGEFPN
Sbjct  94   TRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPGGEFPN  153

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  154  QNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMPHGFFN  213

Query  381  C  379
            C
Sbjct  214  C  214



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPGGEFPN
Sbjct  592  TRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPGGEFPN  651

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  652  QNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLMPHGFFN  711

Query  381  C  379
            C
Sbjct  712  C  712



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG++AKFLRRAAFLKHNLWVT YA +EMFPGGEFPN
Sbjct  543  TRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEYACDEMFPGGEFPN  602

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  603  QNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVEHIGFMLMPHGFFN  662

Query  381  C  379
            C
Sbjct  663  C  663



>ref|XP_006411505.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
 gb|ESQ52958.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
Length=329

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  171  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  230

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  231  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  290

Query  381  C  379
            C
Sbjct  291  C  291



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG++AKFLRRAAFLKHNLWVT YA +EMFPGGEFPN
Sbjct  590  TRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEYACDEMFPGGEFPN  649

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  650  QNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVEHIGFMLMPHGFFN  709

Query  381  C  379
            C
Sbjct  710  C  710



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YAR E FPGGEFPN
Sbjct  628  TRTVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYARGEDFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGL SWVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVE IGF+L PHGFFN
Sbjct  688  QNPRAGEGLVSWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVEHIGFVLQPHGFFN  747

Query  381  CspavdvppssadpdPKENGV----ITKP-CHPGLVAKL  280
            CSPAVDVPP+  + D KE+ V    + KP     L+AKL
Sbjct  748  CSPAVDVPPNVCEIDAKESDVKDSSVAKPTSSAALIAKL  786



>gb|KJB19705.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=795

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 8/162 (5%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPGGEFPN
Sbjct  634  TRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVL----WYVFGVTHVPRLEDWPVMPVERIGFMLMPH  394
            QNPR GEGLA+WVK++R LEETDIVL    WYVFG+THVPRLEDWPVMPVERIGFMLMPH
Sbjct  694  QNPRAGEGLATWVKRDRSLEETDIVLWLLNWYVFGITHVPRLEDWPVMPVERIGFMLMPH  753

Query  393  GFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            GFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  754  GFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  795



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+G+LTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  621  TRTVNRSGELTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  680

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL SWVKQNRPLEETD+VLWYVFG+THVPRLEDWPVMPVE IGF+L PHGFFN
Sbjct  681  QNPRVGEGLVSWVKQNRPLEETDVVLWYVFGITHVPRLEDWPVMPVEHIGFVLQPHGFFN  740

Query  381  CspavdvppssadpdPKENGV  319
            CSPAVDVPPS+ + + KEN V
Sbjct  741  CSPAVDVPPSACELEAKENDV  761



>dbj|BAD95322.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=502

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  345  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  404

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  405  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMPHGFFN  464

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  465  CSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  502



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 130/160 (81%), Gaps = 7/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  616  TRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  676  QNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  735

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV         S D D  ENG  +KP   GL AKL
Sbjct  736  CSPAVDVPPPRGCDSESKDSDASENGE-SKPTTTGLTAKL  774



>ref|NP_001169559.1| uncharacterized protein LOC100383438 [Zea mays]
 gb|ACN34121.1| unknown [Zea mays]
Length=352

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPGGEFPN
Sbjct  200  TRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPGGEFPN  259

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  260  QNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMPHGFFN  319

Query  381  C  379
            C
Sbjct  320  C  320



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 129/160 (81%), Gaps = 6/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  627  TRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  686

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  687  QNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  746

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV         S D +  +N  + K    GL+AKL
Sbjct  747  CSPAVDVPPPSGCDSESRDSEVTDNSSVAKHTTTGLMAKL  786



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  628  TRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEEFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE IGF+L PHGFFN
Sbjct  688  QNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVEHIGFVLQPHGFFN  747

Query  381  C  379
            C
Sbjct  748  C  748



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 134/158 (85%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  618  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  678  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMPHGFFN  737

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP+  + + K++     V  KP   GL++KL
Sbjct  738  CSPAVDVPPNPCELETKDSEVKEVVAPKPLQTGLLSKL  775



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFL+HNLWVT Y ++E +PGGEFPN
Sbjct  637  TRTVNRTGQLTGYKLVPGANCLPLAGSEAKFLRRAAFLQHNLWVTQYHKDEQYPGGEFPN  696

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL +WVKQNR LEE D+VLWYVFG+THVPRLEDWPVMPVERIGFML PHGFFN
Sbjct  697  QNPRVGEGLHTWVKQNRNLEEADVVLWYVFGITHVPRLEDWPVMPVERIGFMLSPHGFFN  756

Query  381  C  379
            C
Sbjct  757  C  757



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPGGEFPN
Sbjct  606  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPGGEFPN  665

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML-MPHGFF  385
            QNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML + H  F
Sbjct  666  QNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQILHNLF  725



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKL+PG NCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EM+PGGEFPN
Sbjct  624  TRTVNRTGQPTGYKLMPGLNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMYPGGEFPN  683

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGL +WVK+NR LEE DIVLWYVFG+TH+PRLEDWPVMPV+RIGFMLMPHGFFN
Sbjct  684  QNPRINEGLVTWVKKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVDRIGFMLMPHGFFN  743

Query  381  C  379
            C
Sbjct  744  C  744



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 129/160 (81%), Gaps = 7/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  544  TRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  603

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  604  QNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  663

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  664  CSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  702



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  632  TRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  691

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE IGF+L PHG+FN
Sbjct  692  QNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVEHIGFVLQPHGYFN  751

Query  381  C  379
            C
Sbjct  752  C  752



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  602  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  661

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  662  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMPHGFFN  721

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  722  CSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  759



>ref|NP_001053078.1| Os04g0476100 [Oryza sativa Japonica Group]
 dbj|BAF14992.1| Os04g0476100, partial [Oryza sativa Japonica Group]
Length=518

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  366  TRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPGGEFPN  425

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  426  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  485

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE     K    GL++KL
Sbjct  486  CSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  518



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  619  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  678

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  679  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMPHGFFN  738

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  739  CSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  776



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 130/160 (81%), Gaps = 7/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT +A  E FPGGEFPN
Sbjct  611  TRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQFAPGEDFPGGEFPN  670

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  671  QNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  730

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPA+DV         S D D  ENG  +KP   GL AKL
Sbjct  731  CSPAIDVPPPRGCDLESKDSDASENGE-SKPTTTGLTAKL  769



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   229 bits (583),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  624  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  683

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  684  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  743

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  744  CSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  781



>dbj|BAJ87935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TG++LVPGSNCLP A  EAKFLRRA FLKHNLWVTPY  +E FPGGEFPN
Sbjct  373  TRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPYKSDEKFPGGEFPN  432

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVKQ+RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  433  QNPRLHEGLATWVKQDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  492

Query  381  C  379
            C
Sbjct  493  C  493



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPG NCLPLAG EAKF+RRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  629  TRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFMRRAAFLKHNLWVTQYAPGEDFPGGEFPN  688

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  689  QNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  748

Query  381  C  379
            C
Sbjct  749  C  749



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 129/160 (81%), Gaps = 7/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  608  TRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  667

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  668  QNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  727

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  728  CSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R+EMFPGGEFPN
Sbjct  630  TRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRDEMFPGGEFPN  689

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  690  QNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMPHGFFN  749

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPPSS+D D KE     K    GLV+KL
Sbjct  750  CSPAVDVPPSSSDADVKE-AESPKAIQNGLVSKL  782



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y+ +E FPGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYSPDEKFPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  682  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  741

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  742  CSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  779



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 129/160 (81%), Gaps = 7/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  608  TRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  667

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  668  QNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  727

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  728  CSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  547  TRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  607  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE     K    GL++KL
Sbjct  667  CSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 129/160 (81%), Gaps = 7/160 (4%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG NCLPLAG +AKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  616  TRTSNRTGQLTGYKLVPGPNCLPLAGPKAKFLRRAAFLKHNLWVTKYAPGEDFPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML PHGFFN
Sbjct  676  QNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQPHGFFN  735

Query  381  Cspavdv------ppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  736  CSPAVDVPPPRGCDMEIKDSDGSENGV-AKPTPSNLMAKL  774



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  599  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  658

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  659  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  718

Query  381  CspavdvppssadpdPKENG-----VITKPCHPGLVAKL  280
            CSPAVDVPP+ A     ++      V  KP   GL++KL
Sbjct  719  CSPAVDVPPNPACELDTKDSEVKEVVAPKPLQSGLLSKL  757



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ  GYKL+PGSNCLPLAG EAKFLRRAAFLKHNLWVT Y  +EM+PGGEFPN
Sbjct  620  TRTVNRTGQPAGYKLMPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSYKHDEMYPGGEFPN  679

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WV++NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE IGF+LMPHGFFN
Sbjct  680  QNPRINEGLATWVRKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVEHIGFLLMPHGFFN  739

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            C       P S +   KE G   K  H GLVAKL
Sbjct  740  C-SPAVDVPPSPNEADKECGA-PKLMHNGLVAKL  771



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  614  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPEEKFPGGEFPN  673

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGL++WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  674  QNPRAGEGLSTWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  733

Query  381  CspavdvppssadpdPKENG----VITKPCHPGLVAKL  280
            CSPAVDVPP+  + D K++     V  KP   GL++KL
Sbjct  734  CSPAVDVPPNPCELDTKDSEVKEVVAPKPIQTGLLSKL  771



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  609  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  668

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  669  QNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  728

Query  381  CspavdvppssadpdPKENG-----VITKPCHPGLVAKL  280
            CSPA+DVPP+ A     ++      V  KP   GL++KL
Sbjct  729  CSPAIDVPPNPACELETKDSEVKEVVTPKPIQAGLLSKL  767



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  547  TRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  607  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE     K    GL++KL
Sbjct  667  CSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  699



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  624  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  683

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  684  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  743

Query  381  C  379
            C
Sbjct  744  C  744



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  686  TRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPGGEFPN  745

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  746  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  805

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE     K    GL++KL
Sbjct  806  CSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  838



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVTPY  +E FPGGEFPN
Sbjct  618  TRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTPYNSDEKFPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP GFFN
Sbjct  678  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPDGFFN  737

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE        + GLV+KL
Sbjct  738  CSPAVDVPPGSSDVDAKEAESPKAIQNGGLVSKL  771



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  +AKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  547  TRAVNRTGQPTGYRLVPGSNCLPLALPDAKFLRRAGFLKHNLWVTQYRSDEVFPGGEFPN  606

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  607  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  666

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE     K    GL++KL
Sbjct  667  CSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   226 bits (576),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  635  TRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPGGEFPN  694

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  695  QNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  754

Query  381  CspavdvppssadpdPKENGVITKPCHPGLVAKL  280
            CSPAVDVPP S+D D KE     K    GL++KL
Sbjct  755  CSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  787



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG +AKFLRRAAFLKHNLWVT Y  +E FPGGEFPN
Sbjct  550  TRTFNRTGQLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQYNPDECFPGGEFPN  609

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMPHGFFN
Sbjct  610  QNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFSLMPHGFFN  669

Query  381  C  379
            C
Sbjct  670  C  670



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  599  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  658

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  659  QNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  718

Query  381  C  379
            C
Sbjct  719  C  719



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TG++LVPGSNCLP A  EAKFLRRA FLKHNLWVTPY  +E FPGGEFPN
Sbjct  581  TRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPYKSDEKFPGGEFPN  640

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  641  QNPRLHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMPHGFFN  700

Query  381  C  379
            C
Sbjct  701  C  701



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPGGEFPN
Sbjct  628  TRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  688  QNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMPHGFFN  747

Query  381  C  379
            C
Sbjct  748  C  748



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ  GYKL+PG NCLPLAG EAKF RRAAFLKHNLWVT Y  +EM+PGGEFPN
Sbjct  616  TRTVNRTGQPAGYKLMPGPNCLPLAGPEAKFFRRAAFLKHNLWVTSYKHDEMYPGGEFPN  675

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK+NR LEET+IVLWYVFGVTH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  676  QNPRINEGLATWVKKNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMPHGFFN  735

Query  381  C  379
            C
Sbjct  736  C  736



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPGGEFPN
Sbjct  619  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPGGEFPN  678

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  679  QNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  738

Query  381  C  379
            C
Sbjct  739  C  739



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPGGEFPN
Sbjct  619  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPGGEFPN  678

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  679  QNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  738

Query  381  C  379
            C
Sbjct  739  C  739



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMPHGFFN
Sbjct  682  QNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMPHGFFN  741

Query  381  C  379
            C
Sbjct  742  C  742



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EMFPGGEFPN
Sbjct  628  TRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEMFPGGEFPN  687

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMPHGFFN
Sbjct  688  QNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMPHGFFN  747

Query  381  C  379
            C
Sbjct  748  C  748



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTG LTGYKLVPGSNCLPLAG +AKFLRRAAFLKHNLWVT Y  +E+FPGGEFPN
Sbjct  510  TRTFNRTGHLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQYYPDEIFPGGEFPN  569

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF L+PHGFFN
Sbjct  570  QNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFSLVPHGFFN  629

Query  381  C  379
            C
Sbjct  630  C  630



>gb|KJB50256.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=751

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PGGEFPN
Sbjct  636  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPGGEFPN  695

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  696  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>gb|KJB50255.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=757

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PGGEFPN
Sbjct  636  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPGGEFPN  695

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  696  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>gb|KJB50257.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=775

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PGGEFPN
Sbjct  636  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPGGEFPN  695

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  696  QNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   224 bits (571),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPGGEFPN
Sbjct  599  TRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPGGEFPN  658

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLW--YVFGVTHVPRLEDWPVMPVERIGFMLMPHGF  388
            QNPR GEGLA+WVKQNR LEE+D+VLW  YVFG+THVPRLEDWPVMPVE IGF LMPHGF
Sbjct  659  QNPRAGEGLATWVKQNRSLEESDVVLWYVYVFGITHVPRLEDWPVMPVEHIGFTLMPHGF  718

Query  387  FNC  379
            FNC
Sbjct  719  FNC  721



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NR+G+LTGYKLVPGSNCLPLAG+EA FLRRA FL+HNLW+TPY+ ++MFPGGEFPN
Sbjct  576  TRRGNRSGELTGYKLVPGSNCLPLAGSEAMFLRRAGFLRHNLWITPYSHHQMFPGGEFPN  635

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ +GL +WVKQNR LEET IVLWYVFG+TH+PRLEDWPVMPVERIGFMLMPHGFFN
Sbjct  636  QNPRLNQGLPTWVKQNRSLEETAIVLWYVFGMTHIPRLEDWPVMPVERIGFMLMPHGFFN  695

Query  381  C  379
            C
Sbjct  696  C  696



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PGGEFPN
Sbjct  584  TRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPGGEFPN  643

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLM
Sbjct  644  QNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLM  697



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKL+PG NCLPLAG +AKFLRRAAFL HNLWVT Y R+E FPGGEFPN
Sbjct  555  TRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEYKRDECFPGGEFPN  614

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL +WVKQ+R LEETD+VLWYVFGVTHVPRLEDWPVMPVE +GF L+PHGFFN
Sbjct  615  QNPRVGEGLPTWVKQDRKLEETDVVLWYVFGVTHVPRLEDWPVMPVEHVGFKLLPHGFFN  674

Query  381  C  379
            C
Sbjct  675  C  675



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKL+PG NCLPLAG +AKFLRRAAFL HNLWVT Y  +E FPGGEFPN
Sbjct  555  TRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEYKHDECFPGGEFPN  614

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVKQ+R LEETDIVLWYVFGVTHVPRLEDWPVMPVE +GF L+PHGFFN
Sbjct  615  QNPRIGEGLPTWVKQDRKLEETDIVLWYVFGVTHVPRLEDWPVMPVEHVGFNLLPHGFFN  674

Query  381  C  379
            C
Sbjct  675  C  675



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPGGEFPN
Sbjct  592  TRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPGGEFPN  651

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLM
Sbjct  652  QNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLM  705



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKL+PGSNCLP    EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  657  TRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSYKSDEIFPGGEFPN  716

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVER GFMLMPHGFFN
Sbjct  717  QNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVERSGFMLMPHGFFN  776

Query  381  C  379
            C
Sbjct  777  C  777



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PGGEFPN
Sbjct  651  TRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPGGEFPN  710

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML P GFF+
Sbjct  711  QNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFMLKPDGFFD  770

Query  381  C  379
            C
Sbjct  771  C  771



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKL+PGSNCLP    EAKFLRRA FLKHNLWVT Y  +E+FPGGEFPN
Sbjct  609  TRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSYKSDEIFPGGEFPN  668

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVER GF++MPHGFFN
Sbjct  669  QNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVERSGFIIMPHGFFN  728

Query  381  C  379
            C
Sbjct  729  C  729



>ref|NP_001173054.1| Os02g0593150 [Oryza sativa Japonica Group]
 dbj|BAH91783.1| Os02g0593150 [Oryza sativa Japonica Group]
Length=311

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGEFPN
Sbjct  31   TRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGEFPN  90

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWPVMPVERI FMLM
Sbjct  91   QNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVERISFMLM  144



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPGGEFPN
Sbjct  608  TRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPGGEFPN  667

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML 
Sbjct  668  QNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQ  721



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PGGEFPN
Sbjct  561  TRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPGGEFPN  620

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  403
            QNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML
Sbjct  621  QNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFML  673



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PGGEFPN
Sbjct  651  TRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPGGEFPN  710

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  403
            QNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML
Sbjct  711  QNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFML  763



>gb|EEE57286.1| hypothetical protein OsJ_07344 [Oryza sativa Japonica Group]
Length=681

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGEFPN
Sbjct  401  TRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGEFPN  460

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  400
            QNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWPVMPVERI FMLM
Sbjct  461  QNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVERISFMLM  514



>ref|XP_002985875.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
 gb|EFJ13052.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
Length=710

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T+ VNR G  TGYKLVPG+NCL   G +A  LRRA FLKHNLWVT Y+++E++P GEFP 
Sbjct  577  TKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSYSKDELYPAGEFPK  636

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVERIGF L PHGFF+
Sbjct  637  QNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLTPHGFFD  696

Query  381  C  379
            C
Sbjct  697  C  697



>ref|XP_002984811.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
 gb|EFJ14061.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
Length=710

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T+ VNR G  TGYKLVPG+NCL   G +A  LRRA FLKHNLWVT Y+++E++P GEFP 
Sbjct  577  TKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSYSKDELYPAGEFPK  636

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVERIGF L PHGFF+
Sbjct  637  QNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLTPHGFFD  696

Query  381  C  379
            C
Sbjct  697  C  697



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NR GQLTGYKLVPGSNCLPL G  A  LRRA FL HNLWVT Y+ +E +PGG+FPN
Sbjct  511  TRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSYSPDERYPGGDFPN  570

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            QNPRVGEGL +W K+++ LE+ DIVLWY FGV HVPRLEDWPVMPVE +GF L P GFFN
Sbjct  571  QNPRVGEGLPTWTKRDKNLEQADIVLWYTFGVIHVPRLEDWPVMPVEHLGFSLAPVGFFN  630

Query  381  C  379
            C
Sbjct  631  C  631



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRT +LTGYKL+PGSNC P+A  EAKFLRRA FLKHNLWVTPY  +EMFPGG+FPN
Sbjct  519  TRTVNRTRKLTGYKLMPGSNCKPMALPEAKFLRRAGFLKHNLWVTPYKSDEMFPGGDFPN  578

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  397
            QNP + EGL +WVK++R LEETDIVLWYVFG+TH+PRLEDWPVMPV+R+   ++P
Sbjct  579  QNPHIDEGLPTWVKKDRSLEETDIVLWYVFGLTHIPRLEDWPVMPVDRMDSSIVP  633



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 98/140 (70%), Gaps = 19/140 (14%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR  NR GQLTGYKLVPGSNCLPL G  A  LRRA FL HNLWVT Y+ +E +PGG+FPN
Sbjct  621  TRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSYSPDERYPGGDFPN  680

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLW-------------------YVFGVTHVPRLEDW  439
            QNPRVGEGL +W K+++ LE+ DIVLW                   Y FGV HVPRLEDW
Sbjct  681  QNPRVGEGLPTWTKRDKNLEQADIVLWSVAHFGLIRSFMVFSWISRYTFGVIHVPRLEDW  740

Query  438  PVMPVERIGFMLMPHGFFNC  379
            PVMPVE +GF L P GFFNC
Sbjct  741  PVMPVEHLGFSLAPVGFFNC  760



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EMFPGGEFPN
Sbjct  626  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAQDEMFPGGEFPN  685

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYV  475
            QNPRVGEGLA+WVK+NR LEETDIVLW V
Sbjct  686  QNPRVGEGLATWVKKNRSLEETDIVLWSV  714



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PGGEFPN
Sbjct  622  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPGGEFPN  681

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYV  475
            QNPRVGEGLA+WV+QNR LEETDIVLW V
Sbjct  682  QNPRVGEGLATWVEQNRSLEETDIVLWLV  710



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PGGEFPN
Sbjct  633  TRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPGGEFPN  692

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  448
            QNPRVGEGLA+WVK+NR LEE DIVL +   +T   RL
Sbjct  693  QNPRVGEGLATWVKKNRSLEEADIVLCHTVSLTAHQRL  730



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPGGEFPN
Sbjct  618  TRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPGGEFPN  677

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYV  475
            QNPR+GEGL +WVKQNRPLEE+DIVLW+V
Sbjct  678  QNPRIGEGLPAWVKQNRPLEESDIVLWFV  706



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPGGEFPN
Sbjct  640  TRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRYAPDEMFPGGEFPN  699

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  448
            QNPR GEGLA+WVKQ+RPLEETDIV ++ +    + RL
Sbjct  700  QNPRAGEGLATWVKQDRPLEETDIVCFWNYPCPSIGRL  737


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  484  LVCFWSDSCSSAGRLAGNACGAHWFHAHAAWIL  386
            +VCFW+  C S GRLA  A GAHWFHA+AAWIL
Sbjct  723  IVCFWNYPCPSIGRLACYASGAHWFHANAAWIL  755



>gb|KJB19704.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=743

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPGGEFPN
Sbjct  634  TRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPGGEFPN  693

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLW  481
            QNPR GEGLA+WVK++R LEETDIVLW
Sbjct  694  QNPRAGEGLATWVKRDRSLEETDIVLW  720



>ref|WP_027094208.1| tyramine oxidase [Cohnella thermotolerans]
Length=647

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ  GYK+V G NC P A   +  ++RA F++H+LWVTPY  NEM+  G +PNQ+  
Sbjct  506  NDYGQSVGYKIVTGENCFPFASPNSSLIKRAGFIRHHLWVTPYNENEMYAAGNYPNQHIG  565

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL++WV+Q+RP++ TDIV+WY  G THVPR EDWPVMP   IGFML P GFFN
Sbjct  566  -GDGLSAWVEQDRPVKNTDIVVWYTMGHTHVPRPEDWPVMPAAYIGFMLKPVGFFN  620



>ref|WP_036584415.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX90377.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91103.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91955.1| tyramine oxidase [Paenibacillus darwinianus]
Length=647

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ  GYK++ G NC P A   +  ++RA F+KH+LWVTPY  NEM+  G++PNQN  
Sbjct  506  NDLGQSVGYKIMTGENCFPFASDSSSLIKRAGFIKHHLWVTPYNENEMYASGKYPNQNIG  565

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL++WV+Q+RP+   DIV+WY  G THVPR EDWPVMP   IGF L P GFFN
Sbjct  566  -GDGLSAWVEQDRPVVNKDIVVWYTMGHTHVPRPEDWPVMPAAYIGFTLKPVGFFN  620



>ref|WP_025696771.1| tyramine oxidase, partial [Paenibacillus durus]
Length=475

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ  GYK+V G NC P A   +  L+RA F+KH+LWVTPY  +E++  G++PNQ+  
Sbjct  334  NELGQSVGYKIVTGENCFPFASKNSSLLKRAGFIKHHLWVTPYNEDEIYASGKYPNQHIG  393

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL+SW +Q+RP+  +DIV+WY  G THVPR EDWPVMP   IGFML P  FFN
Sbjct  394  -GEGLSSWAEQDRPVANSDIVVWYTMGHTHVPRPEDWPVMPTAYIGFMLKPVSFFN  448



>gb|EEC73513.1| hypothetical protein OsI_07883 [Oryza sativa Indica Group]
Length=529

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            TR VNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGEFPN
Sbjct  443  TRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGEFPN  502

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLW  481
            QNPR+ EGLA+WVK++R LEET++VLW
Sbjct  503  QNPRINEGLATWVKKDRSLEETNLVLW  529



>ref|WP_008317043.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=632

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -2

Query  738  RXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQ  559
            +  NR GQ  G+KL+PG N LP A  EA  ++RA FL  +LWVTPY   E FP G +PNQ
Sbjct  499  QVTNRLGQPVGFKLIPGENILPFAHPEAPIMKRAGFLNQHLWVTPYQAAENFPAGPYPNQ  558

Query  558  NPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            +P  GEGL  W   +RPLE TD+VLWYVFG  H+PR EDWPVMPV   GF L P GFF+
Sbjct  559  HPG-GEGLPQWTVADRPLENTDVVLWYVFGHHHIPRPEDWPVMPVAYSGFTLKPLGFFD  616



>ref|WP_007920030.1| tyramine oxidase [Ktedonobacter racemifer]
 gb|EFH82153.1| Primary-amine oxidase [Ktedonobacter racemifer DSM 44963]
Length=649

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR G+   YKL+PG N LP    E+  ++RA F+K NLWVTPY   E++P G++PNQ+  
Sbjct  515  NRLGEPVAYKLMPGDNALPFLHPESSIMKRAGFIKKNLWVTPYHEKELYPAGDYPNQHAG  574

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL +W + NR LE TD+VLWYV    HV R EDWPVMP   IGFML P GFF+
Sbjct  575  -GEGLPAWTQANRSLENTDVVLWYVMNAHHVTRPEDWPVMPTTYIGFMLKPVGFFD  629



>ref|WP_017299862.1| tyramine oxidase [Nodosilinea nodulosa]
Length=642

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N  G  T YKL+PG N LP+A + A   +RA ++  +LWVTPYA  E FP G +PNQ+P
Sbjct  509  TNAMGYPTAYKLMPGENTLPMARSGASVTKRATYMTQHLWVTPYAEEEKFPAGNYPNQHP  568

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              GEGL  W +++RP+  TD+V+WY F  +HVPR EDWPVMPV  IGFML P  FFN
Sbjct  569  G-GEGLPKWTERDRPIVNTDLVVWYTFAHSHVPRAEDWPVMPVAYIGFMLKPLNFFN  624



>ref|WP_015845121.1| tyramine oxidase [Paenibacillus sp. JDR-2]
 gb|ACT02179.1| Primary-amine oxidase [Paenibacillus sp. JDR-2]
Length=647

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ  G+K+V G NC P A   +  ++RA F+KH+LWVTPY  +EM+  G++PNQ+  
Sbjct  506  NELGQSVGFKIVTGENCFPFALDNSSLIKRAGFIKHHLWVTPYDEDEMYASGKYPNQH-L  564

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL++W +++R ++ TD+V+WY  G THVPR EDWPVMP   IGFML P  FFN
Sbjct  565  GGDGLSAWAEKDRDIKNTDVVVWYTMGHTHVPRPEDWPVMPAAYIGFMLKPVSFFN  620



>ref|WP_039728302.1| MULTISPECIES: tyramine oxidase [Oscillatoriophycideae]
 gb|KIF15990.1| tyramine oxidase [Aphanocapsa montana BDHKU210001]
 gb|KIF40915.1| tyramine oxidase [Lyngbya confervoides BDU141951]
Length=638

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR GQ  G+KL+PG N LP A  +A  ++RA F+  +LWVTPY  +E FP G +PNQ+P 
Sbjct  507  NRLGQPVGFKLIPGENVLPFAHPDAPIVKRAGFITRHLWVTPYHPDENFPAGPYPNQHPG  566

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL  W +++R L+ TD+V+WYVFG  H+PR EDWPVMPV   GF L P GFF+
Sbjct  567  -GEGLLKWTQRDRALDNTDVVVWYVFGHHHIPRPEDWPVMPVAYSGFTLKPLGFFD  621



>gb|ABD03718.1| putative copper methylamine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=641

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TPY   E FP G++PNQ+P 
Sbjct  501  NRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPAGDYPNQHPG  560

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
             GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP   IGFML P GFF C
Sbjct  561  -GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPASYIGFMLKPLGFFEC  616



>ref|WP_041436864.1| tyramine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=647

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TPY   E FP G++PNQ+P 
Sbjct  507  NRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPAGDYPNQHPG  566

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
             GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP   IGFML P GFF C
Sbjct  567  -GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPASYIGFMLKPLGFFEC  622



>ref|WP_035986372.1| tyramine oxidase [Leptolyngbya sp. KIOST-1]
Length=643

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N  G  T YKL+PG N LPLA   A  + RA ++  +LWVTPYA +E FP G++PNQ+P
Sbjct  510  TNAAGYPTAYKLMPGENTLPLARPHASVINRATYMTKHLWVTPYAPDEKFPAGDYPNQSP  569

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              GEGL  W + +RP++ TD+V+WY F  TH+PR EDWPVMP   IGFML P  +F+
Sbjct  570  G-GEGLPKWTEGDRPVDNTDLVVWYTFAHTHIPRAEDWPVMPTAYIGFMLKPLNYFD  625



>ref|WP_011430198.1| tyramine oxidase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99520.1| copper amine oxidase [Synechococcus sp. JA-3-3Ab]
Length=672

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TPY   E FP G +PNQ+P 
Sbjct  532  NRLGQPVAYKLMPGENVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPAGNYPNQHPG  591

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
             GEGL  W + NR LE T +VLWY FG  H PR EDWPVMPV  IGFML P GFF C
Sbjct  592  -GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPVSYIGFMLKPLGFFEC  647



>ref|WP_008314860.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=643

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N  G  T YKL+PG N LPLA   A  ++RA ++  +LWVTPY+ +E FP G +PNQ+P
Sbjct  509  TNAMGYPTAYKLMPGENTLPLARPNASVIKRATYMTQHLWVTPYSPDEKFPAGNYPNQSP  568

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              GEGL  W + +RP+E TD+V+W+ F  +H PR EDWPVMPV  IGFML P  FF+
Sbjct  569  G-GEGLPQWTQADRPVENTDLVVWHTFAHSHSPRAEDWPVMPVSTIGFMLKPLNFFD  624



>ref|WP_036002001.1| tyramine oxidase [Leptolyngbya sp. JSC-1]
Length=652

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR GQ  G+KLVPG N LP A  +A  L+RA F+  +LWVTPY+ +E +P G +PNQ+P 
Sbjct  512  NRLGQPVGFKLVPGENVLPFAHPDAPILKRAGFMTKHLWVTPYSPSERYPTGNYPNQHPG  571

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
             GEGL  W + NR +E TD+V+WY+FG  H+PR ED+P+MPV   GF+L P GFF+ 
Sbjct  572  -GEGLPQWTQANRSIENTDLVVWYMFGHHHIPRPEDFPIMPVAYAGFLLKPVGFFDA  627



>gb|ETX01504.1| hypothetical protein ETSY2_37115, partial [Candidatus Entotheonella 
sp. TSY2]
Length=278

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N+TG    YKL+PG N LP A  ++   +R A++  +LWVTPY+ NE +P G++PNQ+ 
Sbjct  147  TNKTGAPVAYKLLPGENTLPFAQPDSSIAKRGAYMWKHLWVTPYSPNERYPAGDYPNQH-  205

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            + G+GL +W + +R +E TD+V+WYV    H+ RLEDWPVMPV  IGF L P GFF+
Sbjct  206  QGGDGLPAWTQADRSVENTDLVVWYVMNGNHIARLEDWPVMPVTNIGFKLKPSGFFD  262



>ref|WP_015186652.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ28775.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
Length=646

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ   YKL+PG N LP A  E+  ++RA F+  +LWVTPY  +E++  G++PNQ+P 
Sbjct  514  NSLGQPVSYKLMPGENILPFAHPESSVIKRAGFMTKHLWVTPYDPDELYAAGDYPNQHPG  573

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
               GL +W K NR +E TD+V+WY FG  HV R EDWPVMPV  IGFML P GFF+ 
Sbjct  574  -DAGLPAWTKANREIENTDVVVWYTFGHNHVTRPEDWPVMPVSHIGFMLKPVGFFDA  629



>ref|WP_015124381.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
 gb|AFY60837.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
Length=650

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ   YKL+P   CLP A  +A  ++RA FL  + W TPY  +E FP G+ PNQ+P 
Sbjct  512  NYLGQPVAYKLIPSETCLPFANDQAWVMKRAGFLNTHFWATPYHPDENFPAGDHPNQHPG  571

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL  W + NRP+E TD+V+WY FG  H+PR EDWP+MP   IGF L P GFF+
Sbjct  572  -GEGLQKWTQANRPIENTDVVVWYNFGHHHIPRPEDWPIMPTAYIGFHLKPFGFFD  626



>ref|WP_006456034.1| tyramine oxidase [Synechococcus sp. PCC 7335]
 gb|EDX86269.1| Copper amine oxidase, enzyme domain protein [Synechococcus sp. 
PCC 7335]
Length=646

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N  G  T YKL+PG N LP+A   A   +RAA++  +LWVTP+  +E +P G++PNQNP
Sbjct  514  TNAMGYPTAYKLMPGENTLPMARPSASVSKRAAYMSQHLWVTPFHEDEKYPAGDYPNQNP  573

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              G GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV  IGFML P  FF+
Sbjct  574  G-GAGLPHWTQSDRVVEDTDLVVWYTFAHSHSPRAEDWPVMPVATIGFMLKPLNFFD  629



>ref|WP_012627324.1| tyramine oxidase [Cyanothece sp. PCC 7425]
 gb|ACL44238.1| Amine oxidase (copper-containing) [Cyanothece sp. PCC 7425]
Length=641

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ   YKL+PG N LP A  ++  ++RA F+  +LWVTPY   E +P G++PNQ+P 
Sbjct  507  NSLGQPVAYKLIPGENALPFAHPDSAIIKRATFMTKHLWVTPYHPKENYPAGDYPNQHPG  566

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL  W   NR ++ TD+V+WY FG  H+PR EDWPVMPV  IGF L P GFF+
Sbjct  567  -GDGLPRWTAANRSIDNTDLVVWYNFGHHHIPRPEDWPVMPVAYIGFYLKPSGFFD  621



>ref|WP_036531589.1| tyramine oxidase [Neosynechococcus sphagnicola]
 gb|KGF73303.1| tyramine oxidase [Neosynechococcus sphagnicola sy1]
Length=641

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
            +NR G+   YKL PG N LP A  +A  L+RA F+  +LWVTPY   E +P G++PNQ+P
Sbjct  510  LNRLGKPVSYKLQPGENILPFADPQAWILKRAGFMTRHLWVTPYHPQENYPAGDYPNQHP  569

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
              G GL +W + +R L+ TD+V+WY FG  H+PR EDWPVMPV  IGFML P GFF
Sbjct  570  G-GAGLPAWTEADRSLDNTDLVVWYNFGHHHIPRPEDWPVMPVAYIGFMLKPVGFF  624



>ref|WP_029635581.1| hypothetical protein [actinobacterium SCGC AAA041-L13]
Length=629

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G   GYKL+PG    PLA  E+   +RA F+  +LWVTP+  +E +P G++P Q+  
Sbjct  496  NHVGHSIGYKLIPGHTTYPLAHKESVLGKRAGFMYSHLWVTPHVESERYPAGDYPFQH-E  554

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
             G GL  W K +R +E TD+VLW+VFG  H+PR EDWPVMPVER GF L P GFF
Sbjct  555  GGAGLPEWTKNDRSIENTDVVLWHVFGTNHIPRTEDWPVMPVERTGFHLKPTGFF  609



>ref|WP_006520181.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
 gb|EKU99059.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
Length=647

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N  G  T YKL+PG N LPLA  +A  +RRA ++  +LWVTPY+ +E +P G +PNQ+P
Sbjct  510  TNAMGYPTAYKLMPGENTLPLARPDASVIRRATYMTKHLWVTPYSPDEKYPAGNYPNQHP  569

Query  552  RVGE-GLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              G+ GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV  IGFML P  FF+
Sbjct  570  --GDVGLPEWTQADRSVEDTDVVVWYTFAHSHSPRAEDWPVMPVATIGFMLKPLNFFD  625



>ref|WP_026159538.1| hypothetical protein [actinobacterium SCGC AAA023-J06]
Length=637

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G   GYKL+PG    PLA  ++   +RA F+  +LWVTP   +E +P G++P Q+  
Sbjct  504  NHVGHSIGYKLIPGHTTYPLAHRDSVLGKRAGFMYSHLWVTPNVESERYPAGDYPFQH-E  562

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
             G GL  W K NR LE TDIVLW+VFG  H+PR EDWPVMPVER GF L P GFF
Sbjct  563  GGAGLPEWTKNNRSLENTDIVLWHVFGTNHIPRTEDWPVMPVERTGFHLKPTGFF  617



>ref|WP_012935344.1| tyramine oxidase [Conexibacter woesei]
 gb|ADB52293.1| Primary-amine oxidase [Conexibacter woesei DSM 14684]
Length=643

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+   YKLVPG N +P A   +  LRRA F++H+LWVT +A  E +P GE+P Q+  
Sbjct  508  NAVGEAVAYKLVPGDNTVPFAAPGSALLRRAGFVEHHLWVTRHAAAERYPAGEYPYQH-S  566

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL +WV+ +RPL + D+VLWY     HVPR EDWPVMPV RIGF L P GFF+
Sbjct  567  GGEGLPAWVQADRPLVDRDVVLWYTMNHHHVPRPEDWPVMPVARIGFELKPWGFFD  622



>gb|AIA11119.1| Copper amine oxidase, enzyme domain protein, partial [uncultured 
bacterium]
Length=158

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+  GYK +PG N  P A   A + +RA F+ +++WVTP+  +E +  G++PNQ+  
Sbjct  17   NHVGEPVGYKFLPGDNSFPYASPNAWWRKRAGFVNYHVWVTPFDESEKYAAGDYPNQS-G  75

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL  W + +RP+ +TD+VLWY FG TH+PR ED+PVMP   IGF+L P GFF+
Sbjct  76   GGDGLIRWTEADRPVADTDVVLWYTFGHTHIPRPEDYPVMPAAYIGFLLKPVGFFD  131



>ref|WP_041858942.1| hypothetical protein, partial [Candidatus Solibacter usitatus]
Length=616

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G  TGY L+PG N +P A  ++   RRAAFL  ++WVTPY  +EM+ GG++PNQ+ R
Sbjct  492  NALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASEMYAGGDYPNQS-R  550

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
             G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF L+P GFF
Sbjct  551  GGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGFRLVPWGFF  605



>gb|ABJ81915.1| Amine oxidase (copper-containing) [Candidatus Solibacter usitatus 
Ellin6076]
Length=634

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G  TGY L+PG N +P A  ++   RRAAFL  ++WVTPY  +EM+ GG++PNQ+ R
Sbjct  510  NALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASEMYAGGDYPNQS-R  568

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
             G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF L+P GFF
Sbjct  569  GGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGFRLVPWGFF  623



>ref|WP_035742293.1| tyramine oxidase, partial [Arthrobacter sp. MA-N2]
Length=280

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -2

Query  708  GYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGLAS  529
             Y+L+P       AG E+   +RA F ++NLWVT Y R E F  GEFPNQ+    +GL  
Sbjct  147  AYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAAGEFPNQSTGADDGLHI  206

Query  528  WVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML PHGFFN
Sbjct  207  WTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEPHGFFN  255



>emb|CEG30995.1| Primary amine oxidase precursor [Bacillus simplex]
Length=650

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            NR G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+  +E F  G +PNQ+  
Sbjct  510  NRLGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPDEQFASGRYPNQHAG  569

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F+L P GFFN
Sbjct  570  -GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISFILKPTGFFN  624



>ref|WP_012873420.1| tyramine oxidase [Sphaerobacter thermophilus]
 gb|ACZ40385.1| Primary-amine oxidase [Sphaerobacter thermophilus DSM 20745]
Length=646

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
            +N+ G+   Y+L+P  N LP+A   A  ++RA F+  ++WVTPY   E +  G++PNQ+P
Sbjct  507  LNKVGEPVAYRLMPHGNVLPMAHPTASVMQRAGFMTKHVWVTPYRPEEKYAAGDYPNQHP  566

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
              G GL +W  QNRP+ +TD+V+WY  G  HV RLEDWPVMPV+ +GF+L P GFF+ 
Sbjct  567  G-GAGLPAWTAQNRPIVDTDVVVWYTLGSHHVVRLEDWPVMPVQYVGFLLQPFGFFDA  623



>ref|WP_009633550.1| Cu2+-containing amine oxidase [Synechocystis sp. PCC 7509]
Length=645

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ   YK++PG N LP    E+  ++RA +L  +LWVTPY + E +P G +PNQ+  
Sbjct  514  NSLGQPVAYKIMPGENILPFLHPESFVIKRAGYLNKHLWVTPYNKAENYPAGAYPNQHAG  573

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
             G+GL  W K +R +E TD+V+WY FG  H+PR EDWPVMP   IGFML P GFF+ 
Sbjct  574  -GDGLPEWTKADRHIENTDVVVWYTFGHNHIPRPEDWPVMPTSYIGFMLKPVGFFDA  629



>ref|WP_036480875.1| tyramine oxidase [Myxosarcina sp. GI1]
Length=634

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
            +N  GQ  GYKL+PG N LP A  E+  ++RA F+  +LWVTPY  +E++  G++PNQ+P
Sbjct  501  LNSLGQPVGYKLMPGDNILPFAHPESSVIKRAGFMNKHLWVTPYQPDELYGAGDYPNQHP  560

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  379
               EGL  W + +R ++ TD+V+WY FG  HV R EDWPVMPV  I F L P GFF+ 
Sbjct  561  G-NEGLTKWTQSDRSVDNTDVVVWYTFGQHHVTRPEDWPVMPVAYIDFKLKPIGFFDA  617



>ref|WP_024819190.1| tyramine oxidase [Arthrobacter sp. 31Y]
Length=648

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N   +   Y+L+P +     AG E+   +RA F ++NLWVT Y R E F  GE+PNQ  
Sbjct  505  TNLVNEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYNRTERFAAGEYPNQAT  564

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
               +GL  W +QNR + +TD+V+WY FG+ HV RLEDWPVMP + IGFML PHGFFN
Sbjct  565  GADDGLHIWTEQNRNIVDTDLVIWYTFGMHHVVRLEDWPVMPRQNIGFMLEPHGFFN  621



>ref|WP_043457655.1| tyramine oxidase [Arthrobacter sp. 31Y]
Length=644

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             N   +   Y+L+P +     AG E+   +RA F ++NLWVT Y R E F  GE+PNQ  
Sbjct  501  TNLVNEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYNRTERFAAGEYPNQAT  560

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
               +GL  W +QNR + +TD+V+WY FG+ HV RLEDWPVMP + IGFML PHGFFN
Sbjct  561  GADDGLHIWTEQNRNIVDTDLVIWYTFGMHHVVRLEDWPVMPRQNIGFMLEPHGFFN  617



>ref|WP_035741463.1| tyramine oxidase, partial [Arthrobacter sp. MA-N2]
Length=345

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -2

Query  708  GYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGLAS  529
             Y+L+P       AG E+   +RA F ++NLWVT Y R E F  GEFPNQ+    +GL  
Sbjct  212  AYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAAGEFPNQSTGADDGLHI  271

Query  528  WVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML PHGFFN
Sbjct  272  WTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEPHGFFN  320



>ref|WP_042206338.1| tyramine oxidase [Paenibacillus durus]
 gb|AIQ12487.1| tyramine oxidase [Paenibacillus durus]
Length=648

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G   GYKL PG N  P A   +  ++RA FLKH+LW TPY   E +  G++PNQ+  
Sbjct  504  NPVGDPVGYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPKEKYASGDYPNQHAG  563

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF L P GFF+
Sbjct  564  -GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGFSLKPVGFFD  618



>ref|WP_028930454.1| tyramine oxidase [Pseudonocardia asaccharolytica]
Length=644

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+  GY L P  N +PL   EA  +RRA F+ H+LWVTP+A  E    GE+PNQ+ +
Sbjct  514  NAVGEPPGYALKPRDNVVPLVQPEASVMRRAGFMAHHLWVTPHAERERHAAGEYPNQH-Q  572

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL  W   +RP+ +TD+V+WY FG  HV RLEDWPVMP +  GF L P GFF+
Sbjct  573  GGEGLLRWTAADRPVADTDLVVWYTFGSHHVARLEDWPVMPAQYAGFSLQPTGFFD  628



>ref|WP_029018078.1| hypothetical protein [actinobacterium SCGC AAA028-N15]
Length=632

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N      GYKL+PG    PLA  E+   ++AAF+  +LWVT    +E +P G++P Q+P 
Sbjct  503  NHMDHPVGYKLIPGHTTFPLALPESTIGKKAAFMYKHLWVTKNNESEKYPAGDYPFQHPG  562

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
             G GL  W K NR +E+ D+VLWYVFG  H+PR EDWPVMPVER GF L P GFF
Sbjct  563  -GAGLPEWTKANRNIEDEDVVLWYVFGTNHIPRTEDWPVMPVERTGFHLKPSGFF  616



>ref|WP_040597665.1| tyramine oxidase [Patulibacter medicamentivorans]
Length=641

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E +P GE+P Q+P 
Sbjct  500  NAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAERYPAGEYPYQHPG  559

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GFML P GFF+
Sbjct  560  -GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGFMLKPWGFFD  614



>gb|EHN12772.1| Monoamine oxidase [Patulibacter medicamentivorans]
Length=632

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E +P GE+P Q+P 
Sbjct  491  NAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAERYPAGEYPYQHPG  550

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GFML P GFF+
Sbjct  551  -GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGFMLKPWGFFD  605



>ref|WP_036725089.1| tyramine oxidase [Paenibacillus forsythiae]
Length=648

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G    YKL PG N  P A   +  ++RA FLKH+LW TPY   E +  G +PNQ+  
Sbjct  504  NHVGDPVSYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPEEKYASGSYPNQHAG  563

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF L P GFF+
Sbjct  564  -GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGFSLKPVGFFD  618



>ref|WP_020471082.1| hypothetical protein [Zavarzinella formosa]
Length=631

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+  GYK +PG N  PLA   A + +RA F+ +++WV+PY   E F  G++PNQ+  
Sbjct  498  NHVGEPAGYKFLPGDNSFPLASPNAWWRKRARFVDYHVWVSPYDETENFAAGDYPNQSSG  557

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
             G+GL  +  Q+RP+E TD+V WY FG TH+PR ED+PVMP   IGF+L P+GFF
Sbjct  558  -GDGLLKYTDQDRPIENTDVVFWYTFGHTHIPRPEDYPVMPTAYIGFLLKPNGFF  611



>ref|WP_003805961.1| copper-containing amine oxidase, partial [Arthrobacter globiformis]
 dbj|GAB16038.1| copper-containing amine oxidase, partial [Arthrobacter globiformis 
NBRC 12137]
Length=367

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N   +   Y+L+P +     AG E+   +RA F ++NLWVT Y R E F  GE+PNQ   
Sbjct  237  NIVDEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAAGEYPNQATG  296

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML PHGFFN
Sbjct  297  ADDGLHIWTQKDRNIVDQDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEPHGFFN  352



>ref|WP_037078438.1| tyramine oxidase [Pseudonocardia spinosispora]
Length=628

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N+ G    YKLVPG+    +   E+  L+RA  L+H LWVTP+ R+E +P GEF NQ+  
Sbjct  499  NKVGAPVAYKLVPGAAVPAMLDPESPVLKRAQVLRHTLWVTPFDRDERWPCGEFVNQS-G  557

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              EGL  W + +R +E TD+VLWYVFG+ HVPR+EDWP+MP + + F L P GFF+
Sbjct  558  TDEGLPVWTEADRSIENTDVVLWYVFGIHHVPRVEDWPIMPADTVSFWLKPTGFFD  613



>ref|WP_035743334.1| tyramine oxidase [Arthrobacter sp. MA-N2]
Length=646

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N   +   Y+L+P       AG E+   +RA F ++NLWVT Y R E F  GEFPNQ+  
Sbjct  506  NIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERFAAGEFPNQSTG  565

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML PHGFFN
Sbjct  566  ADDGLHIWTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFMLEPHGFFN  621



>ref|WP_034315126.1| tyramine oxidase [Bacillus simplex]
Length=650

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+   E F  G +PNQ+  
Sbjct  510  NILGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPEEQFASGRYPNQHAG  569

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F+L P GFFN
Sbjct  570  -GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISFILKPTGFFN  624



>ref|WP_019310622.1| tyramine oxidase [Kocuria rhizophila]
 gb|KIC69986.1| histamine oxidase [Kocuria rhizophila]
Length=644

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T   NR G   GYKL P      LA  ++   RRAAF    LWVTPY  +E +P G+FPN
Sbjct  498  TEHTNRLGHPVGYKLHPEGLPTMLASEDSSIHRRAAFATKALWVTPYEESERYPTGDFPN  557

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            Q+   G GL  W  Q+R ++ TDIV+W+ FG+TH PR+EDWP+MPV+ +GF L P GFF+
Sbjct  558  QHAGNG-GLPEWTAQDRSVDGTDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRPEGFFD  616



>ref|WP_034299865.1| hypothetical protein [Bacillus sp. 37MA]
Length=152

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+  G++LVPG N       E+  ++RA F+K++L VT + R++M+  G++PNQ   
Sbjct  18   NFVGEPVGFELVPGENARIFLHDESSIVKRAGFIKNHLHVTKFDRDQMYASGKYPNQGEW  77

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G  L +WVK+NR +E  DIV+WY   V HV R EDWPVMP   IGFML PHGF++
Sbjct  78   NGSTLNNWVKENRNIENEDIVVWYNMAVHHVVRPEDWPVMPTHYIGFMLKPHGFYD  133



>ref|WP_009075996.1| tyramine oxidase [Streptomyces sp. AA4]
 gb|EFL06694.1| tyramine oxidase [Streptomyces sp. AA4]
Length=636

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            + TG+  GY+L+PG+N LPLA + ++  RRA F   +LWVT Y  ++ +  G++PNQ P 
Sbjct  508  HHTGRPVGYQLMPGTNILPLAQSGSQTSRRAGFAYRHLWVTAYDPDQRYASGDYPNQRPG  567

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
              +GLA +V+ +RPL +TD+V+WY FG  HVPR EDWPVMPV + GF L P  FF
Sbjct  568  -DDGLAEYVRADRPLVDTDVVVWYTFGANHVPRPEDWPVMPVSKAGFHLRPVAFF  621



>ref|WP_033288818.1| tyramine oxidase [Amycolatopsis jejuensis]
Length=623

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP G+ P 
Sbjct  488  TEHTNRLGAPTAYQLVPRPSATLMAQPESSVHKRATFATNHLWVTPYAPDERFPAGDRPG  547

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             +P  G GL++W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GF L P+GFF+
Sbjct  548  AHPG-GAGLSAWTAGDRSISDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFTLRPYGFFD  606



>ref|WP_028063099.1| tyramine oxidase [Solirubrobacter soli]
Length=643

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
            V+  G    YKLVPG N  P+   +++F  RA F + ++WVT Y   E F  G++PNQ+P
Sbjct  509  VSALGDPVAYKLVPGENVAPMYAPDSRFANRAGFTREHVWVTAYDPAERFAAGDYPNQHP  568

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  385
              G+G+A +V+ +RP E TD+VLWY FG  HV R EDWPVMPV  IGF L P GFF
Sbjct  569  G-GDGVARYVEADRPTENTDVVLWYTFGAHHVVRPEDWPVMPVTHIGFKLKPAGFF  623



>ref|WP_037709969.1| tyramine oxidase [Streptomyces mirabilis]
Length=666

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -2

Query  720  GQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGE  541
            G+  GY L+PG N +P+   EA F  RA F   +LWVT Y   E +  G++PNQ+P  GE
Sbjct  531  GEPVGYTLMPGGNTVPMYPPEALFAPRAGFTASHLWVTAYDPAERYAAGDYPNQHPG-GE  589

Query  540  GLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            GL ++   +RPLE+TD+V+WY FG  HV R EDWPVMPV  IGFML P GFF+
Sbjct  590  GLPAYAAADRPLEDTDVVVWYTFGAHHVVRPEDWPVMPVSTIGFMLKPSGFFD  642



>ref|WP_034290510.1| tyramine oxidase [Bacillus sp. 72]
Length=644

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G+  G++LVPG N +P    E+  ++RA F+K++L VT + R++M+  G++PNQ   
Sbjct  510  NFVGEPVGFELVPGENAIPYLHDESSIVKRAGFIKNHLHVTKFDRDQMYASGKYPNQGEW  569

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G  L +WVK+NR +E  DIV+WY   V HV R EDWPVMP   IGFML PHGF++
Sbjct  570  NGSTLNNWVKENRNIENEDIVVWYNMAVHHVVRPEDWPVMPTHYIGFMLKPHGFYD  625



>ref|WP_026556508.1| tyramine oxidase [Arthrobacter sp. 35W]
Length=645

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N   +   Y+L+P       AG E+   +RA F ++NLWVT Y R+E F  GEFPNQ   
Sbjct  506  NIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRSERFAAGEFPNQATG  565

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              +GL  W +++R + + D+V+WY FG+ HV RLEDWP+MP + IGFML PHGFF+
Sbjct  566  ADDGLHIWTQKDRNIVDQDLVVWYTFGMHHVVRLEDWPIMPRQNIGFMLEPHGFFD  621



>ref|WP_026556533.1| tyramine oxidase [Arthrobacter sp. 35W]
Length=645

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N   +   Y+L+P       AG E+   +RA F ++NLWVT Y R+E F  GEFPNQ   
Sbjct  506  NIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRSERFAAGEFPNQATG  565

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              +GL  W +++R + + D+V+WY FG+ HV RLEDWP+MP + IGFML PHGFF+
Sbjct  566  ADDGLHIWTQKDRNIVDQDLVVWYTFGMHHVVRLEDWPIMPRQNIGFMLEPHGFFD  621



>ref|WP_017651781.1| tyramine oxidase [Microchaete sp. PCC 7126]
Length=657

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = -2

Query  729  NRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPR  550
            N  G  TGY L+PGSN + L    A   ++A F  H++WVT Y  NE++ GG +PNQ  +
Sbjct  532  NSLGAATGYMLMPGSNSIFLPVEGANIRQKAGFATHHVWVTKYQPNELYAGGNYPNQT-Q  590

Query  549  VGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             G+GL  ++  N+ L   DIV+WY  GVTHVP+ EDWPVMP  R+GF L+P GFFN
Sbjct  591  PGQGLPQYIADNQSLTNQDIVMWYTMGVTHVPKPEDWPVMPTHRVGFKLVPRGFFN  646



>ref|WP_015320499.1| Cu2+-containing amine oxidase [Natronococcus occultus]
 ref|YP_007308838.1| Cu2+-containing amine oxidase [Natronococcus occultus SP4]
 gb|AGB37048.1| Cu2+-containing amine oxidase [Natronococcus occultus SP4]
Length=681

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
             NR  Q  GYKLVPG N    A  ++  + RA ++ ++LW TP+  +E FP GE+PNQNP
Sbjct  528  TNRLDQPVGYKLVPGENVEAAAQQQSSVMERAGYIAYHLWATPHRDDERFPAGEYPNQNP  587

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
              G+GL  W +Q+R L+  DIVLWY  GV HV R EDWPV+PV    F L P  FF+
Sbjct  588  G-GDGLPKWTQQDRSLDGEDIVLWYTLGVNHVDRPEDWPVLPVHPASFKLEPVNFFS  643



>ref|WP_043836428.1| tyramine oxidase [Amycolatopsis orientalis]
Length=623

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP G+ PN
Sbjct  488  TEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPAGDRPN  547

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P+GF +
Sbjct  548  AHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRPYGFCD  606



>ref|WP_037715216.1| tyramine oxidase [Streptomyces sp. AA4]
Length=623

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP G+ PN
Sbjct  488  TEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPAGDRPN  547

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P+GF +
Sbjct  548  AHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRPYGFCD  606



>ref|WP_037817779.1| tyramine oxidase [Streptomyces sp. NRRL F-3213]
Length=623

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP G+ PN
Sbjct  488  TEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPAGDRPN  547

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P+GF +
Sbjct  548  AHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRPYGFCD  606



>gb|EFL10175.1| tyramine oxidase [Streptomyces sp. AA4]
Length=656

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = -2

Query  741  TRXVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPN  562
            T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP G+ PN
Sbjct  521  TEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPAGDRPN  580

Query  561  QNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P+GF +
Sbjct  581  AHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRPYGFCD  639



>ref|WP_027416719.1| tyramine oxidase [Aneurinibacillus terranovensis]
Length=650

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNP  553
            +N  GQ  GYK++PG NCLP A  ++  ++RA F+K++L VT + R+EM+  G++PNQ+ 
Sbjct  510  LNAVGQPVGYKIMPGENCLPFAYDDSSLIKRAGFIKNHLHVTKFDRDEMYASGKYPNQH-  568

Query  552  RVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
            + G+GL  + + NR +E  DIV+WY  G  H+ R EDWPVMP   I F L P GFF+
Sbjct  569  KGGDGLTKYAQANRNIENEDIVVWYTMGHHHITRPEDWPVMPTAYINFQLKPVGFFD  625



>gb|EMP12147.1| primary amine oxidase [Gordonia sp. NB4-1Y]
Length=644

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  732  VNRTGQLTGYKLVPGSNCLPLAGTEAKFL-RRAAFLKHNLWVTPYARNEMFPGGEFPNQN  556
             N+ G   GYKL+PG     L   E   + +RA F   N+WVTPY  +EM   G+ PNQ+
Sbjct  496  ANKWGMPVGYKLIPGWASDTLIAQEPSLMVKRAGFATKNMWVTPYQPDEMHSAGDHPNQD  555

Query  555  PRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  382
             R G GL +W + NRP+E TD+VLW+  GVTH+PR EDWPVMP E   FML+P+ FF+
Sbjct  556  -RSGAGLPTWTEANRPVENTDVVLWHTVGVTHIPRSEDWPVMPTEVASFMLVPNNFFD  612



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210