BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024O03

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621089.1|  PREDICTED: uncharacterized GPI-anchored prot...    270   7e-86   Nicotiana tomentosiformis
ref|XP_009793934.1|  PREDICTED: uncharacterized GPI-anchored prot...    269   2e-85   Nicotiana sylvestris
ref|XP_006341566.1|  PREDICTED: uncharacterized GPI-anchored prot...    261   2e-82   Solanum tuberosum [potatoes]
ref|XP_006365405.1|  PREDICTED: uncharacterized GPI-anchored prot...    250   3e-78   Solanum tuberosum [potatoes]
ref|XP_010318632.1|  PREDICTED: uncharacterized GPI-anchored prot...    250   4e-78   Solanum lycopersicum
ref|XP_010322619.1|  PREDICTED: uncharacterized GPI-anchored prot...    249   7e-78   Solanum lycopersicum
ref|XP_007036756.1|  Uncharacterized protein isoform 1                  241   1e-74   
gb|KDP41131.1|  hypothetical protein JCGZ_03622                         239   7e-74   Jatropha curcas
emb|CDO98373.1|  unnamed protein product                                237   7e-73   Coffea canephora [robusta coffee]
ref|XP_009780115.1|  PREDICTED: uncharacterized GPI-anchored prot...    236   8e-73   Nicotiana sylvestris
emb|CAN82280.1|  hypothetical protein VITISV_044064                     234   8e-72   Vitis vinifera
gb|KHG14842.1|  hypothetical protein F383_16641                         233   1e-71   Gossypium arboreum [tree cotton]
gb|KJB77261.1|  hypothetical protein B456_012G128400                    233   2e-71   Gossypium raimondii
ref|XP_004299540.1|  PREDICTED: uncharacterized GPI-anchored prot...    233   2e-71   Fragaria vesca subsp. vesca
ref|XP_009611061.1|  PREDICTED: uncharacterized GPI-anchored prot...    233   2e-71   Nicotiana tomentosiformis
ref|XP_002317884.2|  hypothetical protein POPTR_0012s04630g             232   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_003634199.1|  PREDICTED: uncharacterized GPI-anchored prot...    231   5e-71   Vitis vinifera
gb|EYU24115.1|  hypothetical protein MIMGU_mgv1a009301mg                231   1e-70   Erythranthe guttata [common monkey flower]
gb|KDO62890.1|  hypothetical protein CISIN_1g038515mg                   230   1e-70   Citrus sinensis [apfelsine]
emb|CBI15549.3|  unnamed protein product                                232   2e-70   Vitis vinifera
ref|XP_006451658.1|  hypothetical protein CICLE_v10008811mg             231   2e-70   Citrus clementina [clementine]
ref|XP_011039109.1|  PREDICTED: uncharacterized GPI-anchored prot...    229   4e-70   Populus euphratica
ref|XP_011000468.1|  PREDICTED: uncharacterized GPI-anchored prot...    232   4e-70   Populus euphratica
ref|XP_002322090.1|  hypothetical protein POPTR_0015s04320g             229   6e-70   Populus trichocarpa [western balsam poplar]
gb|ABK95654.1|  unknown                                                 229   6e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002533130.1|  conserved hypothetical protein                     224   6e-68   Ricinus communis
ref|XP_003637786.1|  GPI-anchored protein, putative                     223   1e-67   
gb|AFK39957.1|  unknown                                                 219   4e-66   Lotus japonicus
ref|XP_009356061.1|  PREDICTED: uncharacterized GPI-anchored prot...    219   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_008393412.1|  PREDICTED: uncharacterized GPI-anchored prot...    219   5e-66   Malus domestica [apple tree]
ref|XP_003631077.1|  GPI-anchored protein, putative                     218   8e-66   Medicago truncatula
ref|XP_008374829.1|  PREDICTED: uncharacterized GPI-anchored prot...    218   2e-65   Malus domestica [apple tree]
ref|XP_009360091.1|  PREDICTED: uncharacterized GPI-anchored prot...    216   5e-65   
ref|XP_004512737.1|  PREDICTED: uncharacterized GPI-anchored prot...    216   6e-65   Cicer arietinum [garbanzo]
ref|XP_010097582.1|  hypothetical protein L484_017392                   216   8e-65   Morus notabilis
ref|XP_004160422.1|  PREDICTED: uncharacterized GPI-anchored prot...    214   3e-64   
ref|XP_004503298.1|  PREDICTED: uncharacterized GPI-anchored prot...    213   9e-64   Cicer arietinum [garbanzo]
ref|XP_011084420.1|  PREDICTED: uncharacterized GPI-anchored prot...    212   2e-63   Sesamum indicum [beniseed]
ref|XP_008240173.1|  PREDICTED: uncharacterized GPI-anchored prot...    211   4e-63   Prunus mume [ume]
ref|XP_008453468.1|  PREDICTED: uncharacterized GPI-anchored prot...    209   2e-62   Cucumis melo [Oriental melon]
ref|XP_010274672.1|  PREDICTED: uncharacterized GPI-anchored prot...    208   7e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010260827.1|  PREDICTED: uncharacterized GPI-anchored prot...    207   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010678117.1|  PREDICTED: uncharacterized GPI-anchored prot...    207   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160509.1|  hypothetical protein PHAVU_002G327800g             203   5e-60   Phaseolus vulgaris [French bean]
gb|KGN63863.1|  hypothetical protein Csa_1G024950                       195   9e-59   Cucumis sativus [cucumbers]
ref|XP_010032707.1|  PREDICTED: uncharacterized GPI-anchored prot...    199   4e-58   Eucalyptus grandis [rose gum]
ref|XP_003528967.1|  PREDICTED: uncharacterized GPI-anchored prot...    196   4e-57   Glycine max [soybeans]
gb|KFK39131.1|  hypothetical protein AALP_AA3G204900                    196   5e-57   Arabis alpina [alpine rockcress]
ref|XP_003534147.1|  PREDICTED: uncharacterized GPI-anchored prot...    196   7e-57   Glycine max [soybeans]
gb|KHN44610.1|  Putative GPI-anchored protein                           195   8e-57   Glycine soja [wild soybean]
ref|XP_010549074.1|  PREDICTED: uncharacterized GPI-anchored prot...    195   9e-57   Tarenaya hassleriana [spider flower]
ref|XP_002883104.1|  hypothetical protein ARALYDRAFT_898158             194   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_007152699.1|  hypothetical protein PHAVU_004G151900g             194   3e-56   Phaseolus vulgaris [French bean]
ref|XP_006297874.1|  hypothetical protein CARUB_v10013914mg             195   3e-56   
gb|ACU18006.1|  unknown                                                 194   3e-56   Glycine max [soybeans]
ref|XP_010487719.1|  PREDICTED: uncharacterized GPI-anchored prot...    193   4e-56   Camelina sativa [gold-of-pleasure]
ref|NP_566596.1|  uncharacterized protein                               193   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525199.1|  PREDICTED: uncharacterized GPI-anchored prot...    193   8e-56   
gb|ACU18611.1|  unknown                                                 193   1e-55   Glycine max [soybeans]
gb|KHN00170.1|  Putative GPI-anchored protein                           192   1e-55   Glycine soja [wild soybean]
ref|XP_010465880.1|  PREDICTED: uncharacterized GPI-anchored prot...    192   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009145938.1|  PREDICTED: uncharacterized GPI-anchored prot...    191   3e-55   Brassica rapa
ref|XP_010506313.1|  PREDICTED: uncharacterized GPI-anchored prot...    191   4e-55   Camelina sativa [gold-of-pleasure]
gb|KHN21661.1|  Putative GPI-anchored protein                           190   7e-55   Glycine soja [wild soybean]
gb|EPS70389.1|  hypothetical protein M569_04371                         181   1e-51   Genlisea aurea
ref|XP_009135567.1|  PREDICTED: uncharacterized GPI-anchored prot...    181   1e-51   Brassica rapa
emb|CDY51932.1|  BnaAnng11090D                                          181   2e-51   Brassica napus [oilseed rape]
ref|XP_006406660.1|  hypothetical protein EUTSA_v10021078mg             178   3e-50   Eutrema salsugineum [saltwater cress]
emb|CDX75958.1|  BnaC03g40410D                                          176   3e-49   
ref|XP_007209408.1|  hypothetical protein PRUPE_ppa009266mg             167   2e-46   
gb|KCW83996.1|  hypothetical protein EUGRSUZ_B00868                     166   8e-46   Eucalyptus grandis [rose gum]
ref|XP_007036757.1|  Uncharacterized protein isoform 2                  160   3e-44   
emb|CDY49619.1|  BnaCnng17710D                                          155   2e-41   Brassica napus [oilseed rape]
emb|CDX92191.1|  BnaA05g22160D                                          154   3e-41   
ref|XP_010277906.1|  PREDICTED: uncharacterized GPI-anchored prot...    144   2e-37   Nelumbo nucifera [Indian lotus]
emb|CBI18008.3|  unnamed protein product                                142   3e-37   Vitis vinifera
ref|XP_007043448.1|  Uncharacterized protein TCM_007897                 142   7e-37   Theobroma cacao [chocolate]
ref|XP_002276552.1|  PREDICTED: uncharacterized GPI-anchored prot...    142   8e-37   
ref|XP_002326107.1|  hypothetical protein POPTR_0019s14080g             142   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011047484.1|  PREDICTED: uncharacterized GPI-anchored prot...    141   2e-36   Populus euphratica
ref|XP_002518003.1|  conserved hypothetical protein                     140   6e-36   Ricinus communis
gb|KJB50064.1|  hypothetical protein B456_008G151300                    140   8e-36   Gossypium raimondii
ref|XP_010268888.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004293470.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   2e-35   Fragaria vesca subsp. vesca
ref|XP_008448226.1|  PREDICTED: uncharacterized GPI-anchored prot...    138   3e-35   Cucumis melo [Oriental melon]
ref|XP_010095855.1|  hypothetical protein L484_022212                   138   4e-35   Morus notabilis
ref|XP_009777833.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   5e-35   Nicotiana sylvestris
gb|KDO55798.1|  hypothetical protein CISIN_1g020738mg                   137   9e-35   Citrus sinensis [apfelsine]
ref|XP_008230199.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   9e-35   Prunus mume [ume]
gb|KDP24204.1|  hypothetical protein JCGZ_25861                         137   9e-35   Jatropha curcas
ref|XP_011048474.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   1e-34   Populus euphratica
ref|XP_007215670.1|  hypothetical protein PRUPE_ppa008626mg             136   2e-34   Prunus persica
ref|XP_004139964.1|  PREDICTED: uncharacterized GPI-anchored prot...    136   2e-34   Cucumis sativus [cucumbers]
gb|EYU24846.1|  hypothetical protein MIMGU_mgv1a013501mg                134   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_009596251.1|  PREDICTED: uncharacterized GPI-anchored prot...    136   2e-34   Nicotiana tomentosiformis
ref|XP_002319388.2|  hypothetical protein POPTR_0013s14490g             136   2e-34   
ref|XP_004243303.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   3e-34   Solanum lycopersicum
ref|XP_006366939.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   4e-34   Solanum tuberosum [potatoes]
ref|XP_006447405.1|  hypothetical protein CICLE_v10015940mg             135   4e-34   Citrus clementina [clementine]
ref|XP_009417269.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010689311.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   8e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010035649.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   8e-34   Eucalyptus grandis [rose gum]
ref|XP_006412993.1|  hypothetical protein EUTSA_v10025835mg             134   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011100330.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   1e-33   Sesamum indicum [beniseed]
ref|XP_007149909.1|  hypothetical protein PHAVU_005G109200g             134   1e-33   Phaseolus vulgaris [French bean]
ref|XP_008455363.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   1e-33   Cucumis melo [Oriental melon]
ref|XP_004136804.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   2e-33   Cucumis sativus [cucumbers]
ref|XP_006849743.1|  hypothetical protein AMTR_s00024p00248910          132   4e-33   Amborella trichopoda
emb|CDP11898.1|  unnamed protein product                                132   5e-33   Coffea canephora [robusta coffee]
gb|KHG17779.1|  hypothetical protein F383_20781                         132   5e-33   Gossypium arboreum [tree cotton]
ref|XP_010438502.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006284191.1|  hypothetical protein CARUB_v10005339mg             131   8e-33   Capsella rubella
ref|XP_006841867.1|  hypothetical protein AMTR_s00003p00271650          132   8e-33   Amborella trichopoda
ref|XP_010448030.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010433261.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002867466.1|  hypothetical protein ARALYDRAFT_491965             131   1e-32   Arabidopsis lyrata subsp. lyrata
gb|KHG07118.1|  hypothetical protein F383_33082                         131   1e-32   Gossypium arboreum [tree cotton]
gb|AAM65702.1|  unknown                                                 130   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29337.1|  hypothetical protein AALP_AA7G120700                    130   1e-32   Arabis alpina [alpine rockcress]
ref|NP_567797.1|  uncharacterized protein                               130   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144190.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   2e-32   Brassica rapa
ref|XP_008379580.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   3e-32   Malus domestica [apple tree]
gb|KJB31741.1|  hypothetical protein B456_005G206400                    130   4e-32   Gossypium raimondii
emb|CDY19004.1|  BnaC01g20640D                                          129   6e-32   Brassica napus [oilseed rape]
ref|XP_010540855.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_009403933.1|  PREDICTED: uncharacterized GPI-anchored prot...    128   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003560098.1|  PREDICTED: uncharacterized GPI-anchored prot...    128   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_008782391.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   4e-31   Phoenix dactylifera
ref|XP_010051489.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   8e-31   Eucalyptus grandis [rose gum]
ref|XP_008341934.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   9e-31   Malus domestica [apple tree]
ref|XP_003526297.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Glycine max [soybeans]
ref|XP_007132620.1|  hypothetical protein PHAVU_011G110300g             126   1e-30   Phaseolus vulgaris [French bean]
ref|XP_010904780.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Elaeis guineensis
ref|XP_008800404.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Phoenix dactylifera
ref|XP_008813347.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Phoenix dactylifera
gb|KEH37810.1|  transmembrane protein, putative                         125   1e-30   Medicago truncatula
ref|XP_009353209.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   2e-30   Pyrus x bretschneideri [bai li]
gb|EPS66167.1|  hypothetical protein M569_08604                         124   3e-30   Genlisea aurea
ref|XP_009380337.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936812.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   8e-30   Elaeis guineensis
ref|XP_010924042.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   9e-30   
ref|XP_004507229.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   1e-29   Cicer arietinum [garbanzo]
ref|XP_009350468.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_003540881.1|  PREDICTED: uncharacterized GPI-anchored prot...    122   2e-29   Glycine max [soybeans]
ref|XP_009400645.1|  PREDICTED: uncharacterized GPI-anchored prot...    122   2e-29   
ref|XP_009418751.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003597088.1|  GPI-anchored protein, putative                     122   3e-29   Medicago truncatula
ref|XP_006592832.1|  PREDICTED: uncharacterized GPI-anchored prot...    120   9e-29   Glycine max [soybeans]
ref|XP_009412443.1|  PREDICTED: uncharacterized GPI-anchored prot...    120   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ04317.1|  hypothetical protein OsI_26458                          120   2e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001059970.1|  Os07g0557700                                       120   2e-28   
ref|XP_009410258.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   4e-28   
ref|XP_008810973.1|  PREDICTED: uncharacterized GPI-anchored prot...    118   1e-27   Phoenix dactylifera
ref|XP_004958008.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   1e-27   Setaria italica
ref|XP_008670487.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   5e-27   
ref|XP_009390209.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA63100.1|  TPA: hypothetical protein ZEAMMB73_460549              115   9e-27   
ref|XP_008653219.1|  PREDICTED: uncharacterized GPI-anchored prot...    116   1e-26   Zea mays [maize]
ref|XP_002463014.1|  hypothetical protein SORBIDRAFT_02g036230          115   2e-26   Sorghum bicolor [broomcorn]
ref|XP_007036758.1|  Uncharacterized protein isoform 3                  108   9e-25   
gb|KJB77262.1|  hypothetical protein B456_012G128400                    105   2e-23   Gossypium raimondii
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306    101   1e-21   
dbj|BAJ99254.1|  predicted protein                                    99.4    5e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563886.1|  PREDICTED: uncharacterized GPI-anchored prot...  95.9    9e-20   Brachypodium distachyon [annual false brome]
ref|XP_008787927.1|  PREDICTED: uncharacterized GPI-anchored prot...  95.9    9e-20   Phoenix dactylifera
ref|NP_001142782.1|  uncharacterized protein LOC100275144             95.9    1e-19   Zea mays [maize]
gb|AFW86539.1|  hypothetical protein ZEAMMB73_536074                  92.8    9e-19   
dbj|BAJ91757.1|  predicted protein                                    89.7    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05878.1|  predicted protein                                    89.7    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570217.2|  PREDICTED: uncharacterized GPI-anchored prot...  89.4    2e-17   
ref|XP_002987778.1|  hypothetical protein SELMODRAFT_183423           88.2    5e-17   Selaginella moellendorffii
ref|XP_002993750.1|  hypothetical protein SELMODRAFT_431796           87.8    6e-17   
ref|XP_004953652.1|  PREDICTED: uncharacterized GPI-anchored prot...  85.9    4e-16   Setaria italica
ref|XP_006658688.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.4    2e-15   
ref|XP_004965364.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    4e-15   Setaria italica
ref|NP_001047896.1|  Os02g0710700                                     81.3    1e-14   
gb|EAY87253.1|  hypothetical protein OsI_08655                        81.3    1e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001144341.1|  uncharacterized protein LOC100277244 precursor   79.3    5e-14   
ref|XP_008677003.1|  PREDICTED: uncharacterized protein LOC100277...  79.7    5e-14   
gb|EMT29347.1|  hypothetical protein F775_23569                       72.8    1e-12   
gb|EMS66696.1|  hypothetical protein TRIUR3_31273                     73.9    1e-12   Triticum urartu
ref|NP_001144450.1|  uncharacterized protein LOC100277413 precursor   74.7    3e-12   
tpg|DAA41109.1|  TPA: hypothetical protein ZEAMMB73_853726            68.6    2e-11   
ref|XP_002454401.1|  hypothetical protein SORBIDRAFT_04g030180        71.6    3e-11   
gb|AFW73063.1|  hypothetical protein ZEAMMB73_382585                  70.9    6e-11   
gb|KDO55799.1|  hypothetical protein CISIN_1g020738mg                 64.7    4e-09   Citrus sinensis [apfelsine]
gb|AFW86538.1|  hypothetical protein ZEAMMB73_536074                  62.8    5e-09   
tpg|DAA35957.1|  TPA: hypothetical protein ZEAMMB73_447066            62.4    2e-08   
dbj|BAD45779.1|  hypothetical protein                                 63.5    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001183921.1|  uncharacterized protein LOC100502514             61.6    2e-08   
gb|EEC80671.1|  hypothetical protein OsI_23081                        62.8    3e-08   Oryza sativa Indica Group [Indian rice]
tpg|DAA35956.1|  TPA: hypothetical protein ZEAMMB73_447066            62.4    4e-08   
gb|EEE67402.1|  hypothetical protein OsJ_24716                        58.9    8e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AFG68066.1|  hypothetical protein 0_13494_01                       58.9    8e-08   Pinus taeda
gb|AEW07870.1|  hypothetical protein 0_13494_01                       57.4    3e-07   Pinus radiata
ref|XP_002438348.1|  hypothetical protein SORBIDRAFT_10g013280        55.5    2e-06   
ref|XP_008670488.1|  PREDICTED: uncharacterized GPI-anchored prot...  54.3    3e-05   Zea mays [maize]
gb|ACG30608.1|  hypothetical protein                                  50.4    5e-05   Zea mays [maize]
ref|XP_009373629.1|  PREDICTED: uncharacterized GPI-anchored prot...  52.0    9e-05   
ref|XP_006648977.1|  PREDICTED: uncharacterized GPI-anchored prot...  52.0    9e-05   Oryza brachyantha



>ref|XP_009621089.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nicotiana tomentosiformis]
Length=330

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVDSLEKALGN+GIELVKPN+TCDVVYCYCGIRLHPLSCPEAF++NS G+LVG +SVK+L
Sbjct  133  CVDSLEKALGNRGIELVKPNETCDVVYCYCGIRLHPLSCPEAFAVNSQGKLVGDKSVKKL  192

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC SS+     +  S  KCLNSLYLLS+    + S+S++R  KMRSRDCQLMGLTWLL
Sbjct  193  ERDCLSSNGYTGLAGCS--KCLNSLYLLSEGRVENKSRSEDRTRKMRSRDCQLMGLTWLL  250

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKNR+ YIHTVSAVLRALM+S + SDP SCTLNSDGMP AVDSSE  DQSS+  +Q S Y
Sbjct  251  NKNRSGYIHTVSAVLRALMLSKSSSDPQSCTLNSDGMPFAVDSSEINDQSSAVAVQASTY  310

Query  159  TYIIVPLLLLYI  124
             Y++ P LL+YI
Sbjct  311  PYVL-PFLLVYI  321



>ref|XP_009793934.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Nicotiana 
sylvestris]
Length=330

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVDSLEKALGN+GIELVKPN+TCD+VYCYCGIRLHPLSCPEAFS+NS G+LVG +SVK+L
Sbjct  133  CVDSLEKALGNRGIELVKPNETCDLVYCYCGIRLHPLSCPEAFSVNSQGKLVGDKSVKKL  192

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC SS+     +  S  KCLNSLYLLS+    + S+S++R  KMRSRDCQLMGLTWLL
Sbjct  193  ERDCLSSNGYTGLAGCS--KCLNSLYLLSEGRVENRSRSEDRTRKMRSRDCQLMGLTWLL  250

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKNR+ YIHTVSAVLRALM+S + SDP SCTLNSDGMP AVDSSE  DQSS+  +Q S Y
Sbjct  251  NKNRSGYIHTVSAVLRALMLSKSSSDPQSCTLNSDGMPFAVDSSEINDQSSAVVIQGSLY  310

Query  159  TYIIVPLLLLYIS  121
             Y++ P LL+YIS
Sbjct  311  PYVL-PFLLVYIS  322



>ref|XP_006341566.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum tuberosum]
Length=330

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVDS+EKALGN+GIELVKPN+TCDV YCYCGIRLHPLSCPEAFS++S G+LVG +SVKRL
Sbjct  133  CVDSIEKALGNRGIELVKPNKTCDVFYCYCGIRLHPLSCPEAFSVDSKGKLVGDKSVKRL  192

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S++     +  S  KCLNSLYLLS++   + S+ ++R  KMRSRDCQLMGLTWLL
Sbjct  193  ERDCLSNNGYTGLAGCS--KCLNSLYLLSEARVGNKSRLEDRTRKMRSRDCQLMGLTWLL  250

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKNR+ YIHTVS+VLRALM++   SDP SCTLNSDGMPLAVDSSE  D+S++  +Q S Y
Sbjct  251  NKNRSSYIHTVSSVLRALMLTEGSSDPQSCTLNSDGMPLAVDSSEINDESAAVAIQASLY  310

Query  159  TYIIVPLLLLYIS  121
             YI+ PL+L+YI+
Sbjct  311  PYIL-PLVLVYIN  322



>ref|XP_006365405.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum tuberosum]
Length=328

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVDS  KAL N+GIELVKPN+TCDVVYCYCGIRLHPLSCPE F++NS GELVG +SVKRL
Sbjct  136  CVDSFGKALENRGIELVKPNETCDVVYCYCGIRLHPLSCPENFAVNSRGELVGGESVKRL  195

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DCFSS+     +  S  KCLN+LYLLS S    TS +++R SK+ S  CQ+MGLTWLL
Sbjct  196  ERDCFSSNGYAGIAGCS--KCLNTLYLLSDSRLEDTSTTNDRSSKLHSMGCQMMGLTWLL  253

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKN + YIHTVSAVLRALMMS +GS+P SCTLNSDG+PLAVDSSE  DQSS+  LQ S Y
Sbjct  254  NKNTSGYIHTVSAVLRALMMSEDGSNPQSCTLNSDGLPLAVDSSEINDQSSATFLQASVY  313

Query  159  TYIIVPLLLLYIS  121
             Y+++  +L YI+
Sbjct  314  CYLLL-FVLAYIN  325



>ref|XP_010318632.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Solanum 
lycopersicum]
Length=330

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVDS+EKAL N+GIELVKPN+TCDV YCYCGIRLHPLSCPEAFS++S G+LVG +SVKRL
Sbjct  133  CVDSIEKALANRGIELVKPNKTCDVFYCYCGIRLHPLSCPEAFSVDSKGKLVGDKSVKRL  192

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S++     +  S  KCLNSLY LS++   + S+ ++R  KMRSRDCQLMGLTWLL
Sbjct  193  ERDCLSNNGYTGLAGCS--KCLNSLYQLSEARVGNKSRLEDRTRKMRSRDCQLMGLTWLL  250

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKNR+ YIHTVS+VLRALM++   SDP SCTLNSDGMPLAVDS+E  D+S++ ++Q S  
Sbjct  251  NKNRSSYIHTVSSVLRALMLTEGSSDPQSCTLNSDGMPLAVDSTEINDESAAVSIQASFN  310

Query  159  TYIIVPLLLLYIS  121
             YI+  L+L+YI+
Sbjct  311  PYILT-LVLVYIN  322



>ref|XP_010322619.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum lycopersicum]
Length=328

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV S  KAL N+GIELVKPN+TCDVVYCYCGIRLHPLSCPE F++NS GE+VG +SVKRL
Sbjct  136  CVVSFGKALENRGIELVKPNETCDVVYCYCGIRLHPLSCPEKFTLNSSGEIVGGESVKRL  195

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DCFSS+     +  S  KCLN+LYLLS S    TS +++R SK+RS  CQ+MGLTWLL
Sbjct  196  ERDCFSSNGYAGIAGCS--KCLNTLYLLSDSRLEDTSITNDRSSKLRSMGCQMMGLTWLL  253

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKN + YIHTVSAVLRALMMS +GS+P SCTLNSDG+PLAVDSSE  DQSS+ +LQ S Y
Sbjct  254  NKNTSGYIHTVSAVLRALMMSEDGSNPQSCTLNSDGLPLAVDSSEINDQSSATSLQASVY  313

Query  159  TYIIVPLLLLYIS  121
             Y+++  +L YI+
Sbjct  314  CYLLL-FVLAYIN  325



>ref|XP_007036756.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21257.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=341

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS++  G LVG ++V+RL
Sbjct  139  CVDDLGKALRQKGIELAKPNETCDVVYCYCGIRLHPLSCPEAFSVDQSGNLVGDENVERL  198

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS+N          +KCL SL+LL+K  T ++SKS++R +KMR++DCQLMGLTW
Sbjct  199  EKNCLSSSSNVNGFPGLGGCNKCLKSLHLLNKKNTLNSSKSEDRTTKMRNKDCQLMGLTW  258

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YI TVSAVLRA+MMS  GSDP SCTLNSDGMPLAVDSSE YDQSSS TL +S
Sbjct  259  LLAKNRTAYIRTVSAVLRAIMMSKAGSDPSSCTLNSDGMPLAVDSSEIYDQSSSVTLYLS  318

Query  165  HY  160
             +
Sbjct  319  QH  320



>gb|KDP41131.1| hypothetical protein JCGZ_03622 [Jatropha curcas]
Length=331

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  KGIELVKPN+TCDVVYCYCGIRLHPLSCPEAFSMN  G+LVG + VKRL
Sbjct  130  CVDDLGKALEEKGIELVKPNETCDVVYCYCGIRLHPLSCPEAFSMNQKGQLVGDKRVKRL  189

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DC SSS N          SKCLNSLYLL+  +  ++SKS++R +KM ++DCQLMGLTW
Sbjct  190  ERDCLSSSTNVNQFPGLGGCSKCLNSLYLLNNKKALNSSKSEDRTTKMHNKDCQLMGLTW  249

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTVSAVLRA+MM+ +GS+P SCTL+SDGMPLAVDSSE  + S S T Q  
Sbjct  250  LLAKNRTAYIHTVSAVLRAMMMNVDGSNPRSCTLSSDGMPLAVDSSEISNDSRSITNQAF  309

Query  165  HYTYIIVPLL  136
             Y  +++ LL
Sbjct  310  IYVSVVICLL  319



>emb|CDO98373.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVDSLEKALGNKG+ L KPN+TCD VYCYCGIRLHPLSCPEAF +NS G+LVG +SVK+L
Sbjct  154  CVDSLEKALGNKGVNLAKPNETCDFVYCYCGIRLHPLSCPEAFYVNSLGKLVGGESVKKL  213

Query  519  ETDCFsssangysslasc-SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWL  343
            E DC SSS+    +  +  SKCLN+LYLL++ +  + S  ++R SKM S+DC+LMGLTWL
Sbjct  214  EEDCSSSSSLNGYAGIAGCSKCLNTLYLLNEDKVGNASALEDRTSKMHSKDCELMGLTWL  273

Query  342  LNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            L+KNRA Y+HTVSAVLRALM+ST G+ P SCTLNSDGMPLAVDSSE  DQSSS  L 
Sbjct  274  LHKNRAAYLHTVSAVLRALMLSTEGTYPQSCTLNSDGMPLAVDSSEINDQSSSTLLH  330



>ref|XP_009780115.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nicotiana sylvestris]
Length=330

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+S  KAL N+GIELVKPN+TCD+VYCYCGIRLHPLSCPEAF +NS  ELVG + V RL
Sbjct  135  CVNSFGKALENRGIELVKPNETCDMVYCYCGIRLHPLSCPEAFFVNSRRELVGGERVNRL  194

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            ET+C SS+     +  S  KCLNSL+LLS S + +T+   +R SKM SRDCQ+MGLTWLL
Sbjct  195  ETECLSSNGYSGIAGCS--KCLNSLHLLSDSRSENTNIRKDRISKMHSRDCQMMGLTWLL  252

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKN + YIHTVSAVLRALMMS +GSDP SCTL+SDG+PLAVDSSE  DQSS+ +   S Y
Sbjct  253  NKNTSGYIHTVSAVLRALMMSKDGSDPQSCTLSSDGLPLAVDSSEINDQSSATSFLASVY  312

Query  159  TYIIVPLL  136
             Y+I  +L
Sbjct  313  WYLIAFVL  320



>emb|CAN82280.1| hypothetical protein VITISV_044064 [Vitis vinifera]
Length=328

 Score =   234 bits (596),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L ++G+ELVKPN+TCDVVYC+CGIRLHPLSCPEAFS++S G+LVG +SVK+L
Sbjct  128  CVDDLEKSLKSRGVELVKPNETCDVVYCFCGIRLHPLSCPEAFSVSSKGKLVGDESVKKL  187

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S++        S  KCLN+LYLL K +T ++SK + R  KM +RDC+LMGLTWLL
Sbjct  188  ERDCLSTNGFPGLGGCS--KCLNTLYLLGKDKTGNSSKLEARSRKMHNRDCELMGLTWLL  245

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
             KNR  YIHTVSAVLRA+MMST+GSDPLSCTLNSDGMPLAVDS+E 
Sbjct  246  AKNRTXYIHTVSAVLRAIMMSTDGSDPLSCTLNSDGMPLAVDSAEI  291



>gb|KHG14842.1| hypothetical protein F383_16641 [Gossypium arboreum]
Length=338

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  +G+EL KPN+TCD VYCYCGIRLHPL+CP+AFS++  G LVG  SV+RL
Sbjct  136  CVDDLGKALKQRGVELAKPNETCDAVYCYCGIRLHPLTCPDAFSVDQKGNLVGDDSVERL  195

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS+N          +KCL SL+LL+K    +TSKS+ER +KMR++DCQLMGLTW
Sbjct  196  ERNCLSSSSNVNGFPGLGGCNKCLKSLHLLNKKNALNTSKSEERTTKMRNKDCQLMGLTW  255

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YI TVSAVLRA+MMS +GS P SCTLNSDGMPL VDSSE YDQSSS T  +S
Sbjct  256  LLAKNRTSYIRTVSAVLRAMMMSKDGSSPSSCTLNSDGMPLPVDSSEIYDQSSSVTFNLS  315

Query  165  HY  160
             +
Sbjct  316  QH  317



>gb|KJB77261.1| hypothetical protein B456_012G128400 [Gossypium raimondii]
Length=338

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  +G+EL KPN+TCD VYCYCGIRLHPL+CP+AFS++  G LVG  SV+RL
Sbjct  136  CVDDLGKALKQRGVELAKPNETCDAVYCYCGIRLHPLTCPDAFSVDQKGNLVGDDSVERL  195

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS+N          +KCL SL+LL+K    +TSKS+ER +KMR +DCQLMGLTW
Sbjct  196  ERNCLSSSSNVNGFPGLGGCNKCLKSLHLLNKKNALNTSKSEERTTKMRKKDCQLMGLTW  255

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YI TVSAVLRA+MMS +GS P SCTLNSDGMPL VDSSE YDQSSS T  +S
Sbjct  256  LLAKNRTSYIRTVSAVLRAMMMSKDGSSPSSCTLNSDGMPLPVDSSEIYDQSSSVTFNLS  315

Query  165  HY  160
             +
Sbjct  316  QH  317



>ref|XP_004299540.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Fragaria 
vesca subsp. vesca]
Length=337

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 152/194 (78%), Gaps = 3/194 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL  KGIEL++PN+TCD+VYC CGIRLHPLSCPEAFS+N +G+L+G +SVK+L
Sbjct  140  CVQDLGKALSAKGIELMRPNETCDMVYCNCGIRLHPLSCPEAFSVNQNGKLIGDKSVKKL  199

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS N  +       SKCLNSL LL+K +T ++SK ++R +KM ++DCQLMGLTW
Sbjct  200  EKNCLSSSNNVNNFPGLGGCSKCLNSLKLLNKKKTSNSSKLEDRTTKMHNKDCQLMGLTW  259

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  Y+HTV++V RA+M+S +GSDP SCTLNSDGMPLAVDSSE  DQS S  L +S
Sbjct  260  LLAKNRTAYMHTVTSVFRAIMVSNDGSDPQSCTLNSDGMPLAVDSSEISDQSPSNILAVS  319

Query  165  HYTYIIVPLLLLYI  124
             +T+ +V L LLY+
Sbjct  320  -FTFCVVSLSLLYV  332



>ref|XP_009611061.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nicotiana tomentosiformis]
Length=331

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 147/193 (76%), Gaps = 3/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+S  KAL N+GIELVKPN+TCDVVYCYCGIRLHPLSCPEAF +NS  ELVG + V RL
Sbjct  136  CVNSFGKALENRGIELVKPNETCDVVYCYCGIRLHPLSCPEAFFVNSRRELVGGERVNRL  195

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            ET+C SS+     +  S  KCLNSLYLLS S+  +T+ + +R  KM SRDCQ+MGLTWLL
Sbjct  196  ETECLSSNGYSGLADCS--KCLNSLYLLSDSKLENTTITKDRSRKMHSRDCQMMGLTWLL  253

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            NKN + YIHTVSAVLRALM S +GSDP SCTL+SDG+PLAVDSSE  DQS + +     Y
Sbjct  254  NKNTSGYIHTVSAVLRALMTSKDGSDPQSCTLSSDGLPLAVDSSEINDQSYATSFLALVY  313

Query  159  TYIIVPLLLLYIS  121
             Y+I P +L  I+
Sbjct  314  CYLI-PFVLACIN  325



>ref|XP_002317884.2| hypothetical protein POPTR_0012s04630g [Populus trichocarpa]
 gb|EEE96104.2| hypothetical protein POPTR_0012s04630g [Populus trichocarpa]
Length=334

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K L  KGIELVKPN+TCDVVYCYCGIRLHPLSCPEAFS+N  G+LVG + VK+L
Sbjct  133  CVDGLSKGLKEKGIELVKPNETCDVVYCYCGIRLHPLSCPEAFSLNRKGKLVGDKRVKKL  192

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C S+S N          SKCLNSL+LL+  +T ++SKSD+R ++M S+DCQLMGLTW
Sbjct  193  ERNCLSNSNNVNGFPGLGGCSKCLNSLHLLNNKKTLNSSKSDDRTARMHSKDCQLMGLTW  252

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTV+AV+RA+M+ST+G DP SCTLNSDGMPLAVDSSE  + S S   Q+ 
Sbjct  253  LLAKNRTAYIHTVTAVIRAMMLSTDGFDPQSCTLNSDGMPLAVDSSEISNNSLSICHQVP  312

Query  165  HYTYIIVPLLL  133
             Y  +    LL
Sbjct  313  IYAAMAFICLL  323



>ref|XP_003634199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
Length=327

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ LEK+L ++G+ELVKPN+TCDVVYC+CGIRLHPLSCPEAFS++S G+LVG +SVK+L
Sbjct  127  CVNDLEKSLKSRGVELVKPNETCDVVYCFCGIRLHPLSCPEAFSVSSKGKLVGDESVKKL  186

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S++        S  KCLN+LYLL K +T ++SK + R  KM +RDC+LMGLTWLL
Sbjct  187  ERDCLSTNGFPGLGGCS--KCLNTLYLLGKDKTGNSSKLEARSRKMHNRDCELMGLTWLL  244

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
             KNR  YIHTVSAVLRA+MMST+GSDPLSCTLNSDGMPLAVDS+E 
Sbjct  245  AKNRTAYIHTVSAVLRAIMMSTDGSDPLSCTLNSDGMPLAVDSAEI  290



>gb|EYU24115.1| hypothetical protein MIMGU_mgv1a009301mg [Erythranthe guttata]
Length=346

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 149/195 (76%), Gaps = 11/195 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD+LEKALGN+GIEL +PN+TCDVVYCYCGIRLHP +CPEAF++N+ G+LVG  +V +L
Sbjct  151  CVDTLEKALGNRGIELKRPNETCDVVYCYCGIRLHPFTCPEAFTVNTRGKLVGGAAVVKL  210

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DCF+    G   LA CSKCLNSL LL+ +++     S ER SKM +RDC+LMGLTWLL
Sbjct  211  ERDCFNGGGGGGGGLAGCSKCLNSLSLLNANKS-GIKNSTERTSKMHNRDCELMGLTWLL  269

Query  339  NKNRARYIHTVSAVLRALMMSTN--GSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            NKNR  YI TVSAVLRALMM+T+   SDP  C+LNSDGMPLAVDSSE  +QSSS      
Sbjct  270  NKNRPAYIRTVSAVLRALMMNTDESSSDPSFCSLNSDGMPLAVDSSEINNQSSS------  323

Query  165  HYTYIIVPLLLLYIS  121
              T + VPL LLY+S
Sbjct  324  --TVLAVPLSLLYMS  336



>gb|KDO62890.1| hypothetical protein CISIN_1g038515mg, partial [Citrus sinensis]
Length=320

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KA+  +GI+L +PN+TCDVVYCYCGIRLHPL+CPEAFS+N  G+LVG+ +VKRL
Sbjct  120  CVDDLGKAMKQRGIDLPRPNETCDVVYCYCGIRLHPLTCPEAFSLNPRGKLVGNVNVKRL  179

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E  C SSS N          +KCLNSLY L+K +T +TSK+++R +KM ++DCQLMGLTW
Sbjct  180  ERHCLSSSNNVNGFPGLGGCNKCLNSLYQLNK-KTFNTSKAEDRTTKMHNKDCQLMGLTW  238

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTVSAV+RA+M+S +G +P SCTL+SDGMPLAVDSS+ Y+QSSS TL + 
Sbjct  239  LLEKNRTAYIHTVSAVIRAMMLSRDGFEPQSCTLSSDGMPLAVDSSDIYNQSSSITLAVP  298

Query  165  HYTYIIVPLLLLYIS  121
             Y    V L LL++S
Sbjct  299  FY-LSFVSLWLLFMS  312



>emb|CBI15549.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ LEK+L ++G+ELVKPN+TCDVVYC+CGIRLHPLSCPEAFS++S G+LVG +SVK+L
Sbjct  127  CVNDLEKSLKSRGVELVKPNETCDVVYCFCGIRLHPLSCPEAFSVSSKGKLVGDESVKKL  186

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S++        S  KCLN+LYLL K +T ++SK + R  KM +RDC+LMGLTWLL
Sbjct  187  ERDCLSTNGFPGLGGCS--KCLNTLYLLGKDKTGNSSKLEARSRKMHNRDCELMGLTWLL  244

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
             KNR  YIHTVSAVLRA+MMST+GSDPLSCTLNSDGMPLAVDS+E 
Sbjct  245  AKNRTAYIHTVSAVLRAIMMSTDGSDPLSCTLNSDGMPLAVDSAEI  290



>ref|XP_006451658.1| hypothetical protein CICLE_v10008811mg [Citrus clementina]
 ref|XP_006490745.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Citrus sinensis]
 gb|ESR64898.1| hypothetical protein CICLE_v10008811mg [Citrus clementina]
Length=347

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KA+  +GI+L +PN+TCDVVYCYCGIRLHPL+CPEAFS+N  G+LVG+ +VKRL
Sbjct  147  CVDDLGKAMKQRGIDLPRPNETCDVVYCYCGIRLHPLTCPEAFSLNPRGKLVGNVNVKRL  206

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E  C SSS N          +KCLNSLY L+K +T +TSK+++R +KM ++DCQLMGLTW
Sbjct  207  ERHCLSSSNNVNGFPGLGGCNKCLNSLYQLNK-KTFNTSKAEDRTTKMHNKDCQLMGLTW  265

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTVSAV+RA+M+S +G +P SCTL+SDGMPLAVDSS+ Y+QSSS TL + 
Sbjct  266  LLEKNRTAYIHTVSAVIRAMMLSRDGFEPQSCTLSSDGMPLAVDSSDIYNQSSSITLAVP  325

Query  165  HYTYIIVPLLLLYIS  121
             Y    V L LL++S
Sbjct  326  FY-LSFVSLWLLFMS  339



>ref|XP_011039109.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
Length=334

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD+L K L  KGIELVKPN+TCDVVYCYCGIRLHPLSCPEAFSMN  G+LVG + VK+L
Sbjct  133  CVDALSKGLKEKGIELVKPNETCDVVYCYCGIRLHPLSCPEAFSMNRKGKLVGDKRVKKL  192

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C S+S N          SKCLNSL+LL+  +T ++SK ++R  +M ++DCQLMGLTW
Sbjct  193  ERNCLSNSNNVNGFPGLGGCSKCLNSLHLLNNKKTLNSSKPEDRTGRMHNKDCQLMGLTW  252

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTV+AV+RA+M+ST+G DP SCTLNSDGMPLAVDSSE  + S S   Q+ 
Sbjct  253  LLAKNRTAYIHTVTAVIRAMMLSTDGFDPQSCTLNSDGMPLAVDSSEISNNSLSICHQVP  312

Query  165  HYTYIIVPLLL  133
             Y  +    LL
Sbjct  313  IYAAMAFICLL  323



>ref|XP_011000468.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Populus 
euphratica]
Length=418

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K L  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G+LVG + V++L
Sbjct  217  CVDGLSKGLKEKGIELFKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGKLVGDKRVEKL  276

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C S+S N          SKCLNSLYLL+  +  ++SKS++R ++M ++DCQLMGLTW
Sbjct  277  ERNCLSNSNNVNGFPGLGGCSKCLNSLYLLNNKKALNSSKSEDRATRMHNKDCQLMGLTW  336

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNRA YIHTV+AVLRA+MMS +GSDP SCTL+SDGMPLAVDSSE  + S S + Q  
Sbjct  337  LLAKNRAAYIHTVTAVLRAMMMSIDGSDPRSCTLSSDGMPLAVDSSEISNNSLSISHQAP  396

Query  165  HYTYIIV  145
             Y  + V
Sbjct  397  IYVTVAV  403



>ref|XP_002322090.1| hypothetical protein POPTR_0015s04320g [Populus trichocarpa]
 gb|EEF06217.1| hypothetical protein POPTR_0015s04320g [Populus trichocarpa]
Length=334

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K L  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G+LVG + V++L
Sbjct  133  CVDGLSKGLKEKGIELFKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGKLVGDKRVEKL  192

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C S S N          SKCLNSLYLL+  +  ++SKS++R +KM ++DCQLMGLTW
Sbjct  193  ERNCLSDSNNVNGFPGLGGCSKCLNSLYLLNNKKALNSSKSEDRTTKMHNKDCQLMGLTW  252

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTV+AVLRA+MMS +GSDP SCTL+SDGMPL VDSSE  + S S + Q  
Sbjct  253  LLAKNRTAYIHTVTAVLRAMMMSIDGSDPRSCTLSSDGMPLPVDSSEISNNSFSISHQAP  312

Query  165  HYTYIIVPLLL  133
             Y  I V  LL
Sbjct  313  IYVTIAVICLL  323



>gb|ABK95654.1| unknown [Populus trichocarpa]
Length=334

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 142/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K L  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G+LVG + V++L
Sbjct  133  CVDGLSKGLKEKGIELFKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGKLVGDKRVEKL  192

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C S S N          SKCLNSLYLL+  +  ++SKS++R +KM ++DCQLMGLTW
Sbjct  193  ERNCLSDSNNVNGFPGLGGCSKCLNSLYLLNNKKALNSSKSEDRTTKMHNKDCQLMGLTW  252

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTV+AVLRA+MMS +GSDP SCTL+SDGMPL VDSSE  + S S + Q  
Sbjct  253  LLAKNRTAYIHTVTAVLRAMMMSIDGSDPRSCTLSSDGMPLPVDSSEISNNSFSISHQAP  312

Query  165  HYTYIIVPLLL  133
             Y  I V  LL
Sbjct  313  IYVTIAVICLL  323



>ref|XP_002533130.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29257.1| conserved hypothetical protein [Ricinus communis]
Length=330

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 144/194 (74%), Gaps = 3/194 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  KG+ELV+PN+TCD+VYCYCGIRLHPLSC EAFS N  G+LVG + V +L
Sbjct  129  CVDDLGKALSQKGVELVRPNETCDLVYCYCGIRLHPLSCSEAFSTNQEGKLVGDKRVHKL  188

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DC SSS N          SKCLN+LYLL+  +T ++SKSD+R +KM ++DCQLMGLTW
Sbjct  189  ERDCLSSSTNVNHFPGLGGCSKCLNALYLLNNKKTLNSSKSDDRTTKMHNKDCQLMGLTW  248

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL  NR  YIHTVSAVLRA+MM+ + S+P SCTL SDGMPLAVDSSE  + S S T Q  
Sbjct  249  LLATNRTAYIHTVSAVLRAMMMNVDSSNPQSCTLGSDGMPLAVDSSEISNNSLSVTHQAP  308

Query  165  HYTYIIVPLLLLYI  124
             Y  +++ + LL+I
Sbjct  309  IYLSVVL-ICLLHI  321



>ref|XP_003637786.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|KEH16704.1| transmembrane protein, putative [Medicago truncatula]
Length=336

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEKAL  +GIEL+KPN++CD+VYCYCGIRLHP +CP+AFS+   GELVG  SV+RL
Sbjct  136  CVDGLEKALKVRGIELIKPNESCDLVYCYCGIRLHPFNCPDAFSVTKSGELVGDGSVRRL  195

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C S   NG         SKCLNSLYLL+K +T + SK ++R +K+ ++DC+LMGLTW
Sbjct  196  EKNCLSKKKNGNGFQGLGGCSKCLNSLYLLNK-KTSNLSKEEDRTTKIHNKDCELMGLTW  254

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LL+KNR  YIHTV+ VLRAL+++ +GS P SCTLNSDGMPLAVDSSEFYDQSSS
Sbjct  255  LLSKNRTAYIHTVTNVLRALLLNKDGSKPQSCTLNSDGMPLAVDSSEFYDQSSS  308



>gb|AFK39957.1| unknown [Lotus japonicus]
Length=335

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            C   L KAL  +GIELV+PN+TCDVVYCYCGIRLHPLSCPE+FS+   G LVG ++VKRL
Sbjct  135  CESDLGKALKVRGIELVQPNETCDVVYCYCGIRLHPLSCPESFSVTPSGNLVGDENVKRL  194

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS+N          SKCL+SLYLL K +T ++SK ++R +K+ ++DC+LMGLTW
Sbjct  195  ERNCLSSSSNVNDLPGLGGCSKCLHSLYLLKKKKTSNSSKLEDRTTKIHNKDCELMGLTW  254

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            LLNKNR  Y+HTV+ VLRALM+ST+GSDP SCTLNSDGMPLAVDSSE YDQSSS  LQ
Sbjct  255  LLNKNRTAYMHTVTVVLRALMLSTDGSDPQSCTLNSDGMPLAVDSSEMYDQSSSAKLQ  312



>ref|XP_009356061.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=330

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L +AL  +GI+L+KPN+TCDVVYCYCGIRLHPLSCPEAF  N  G+LVG   VK+L
Sbjct  129  CVEDLGQALKTRGIDLIKPNETCDVVYCYCGIRLHPLSCPEAFWENERGKLVGGAKVKKL  188

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S   NG+  L  CSKCL+SLY L+K +  ++SK  +R +KM ++DCQLMGLTWLL
Sbjct  189  ERDCLSGGNNGFPGLGGCSKCLHSLYNLNKKKASNSSKLGDRTTKMHNKDCQLMGLTWLL  248

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
             KNR  YIHTV++V RA M+ST+GSDP SCTLNSDGMPLAVDSS+  +QSSS  L  S +
Sbjct  249  AKNRTAYIHTVTSVFRAFMVSTDGSDPRSCTLNSDGMPLAVDSSQISEQSSSNILAASVF  308

Query  159  TYIIVPLLLLYI  124
             YI++ L LL++
Sbjct  309  FYIVMSLSLLFM  320



>ref|XP_008393412.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=333

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL N+GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS N  G+LVG + VK+L
Sbjct  130  CVQDLGKALKNRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSENERGKLVGDEKVKKL  189

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DC SS ANG         SKCL+SLY L+K +T ++SK  +R +KM ++DCQLMGLTW
Sbjct  190  ERDCLSSGANGNWFPGLGGCSKCLHSLYNLNKKKTSNSSKLGDRTTKMHNKDCQLMGLTW  249

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTV++V RA+M+ST+GSDP SCTLNSDGMPLAVDSSE  DQSSS  L  S
Sbjct  250  LLAKNRTAYIHTVTSVFRAIMLSTDGSDPRSCTLNSDGMPLAVDSSEISDQSSSSILAAS  309

Query  165  HYTYIIVPLLLLYI  124
               YI++ L L ++
Sbjct  310  VSFYIVMSLSLFFM  323



>ref|XP_003631077.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|ABE80139.1| hypothetical protein MtrDRAFT_AC139526g8v2 [Medicago truncatula]
 gb|AET05553.1| transmembrane protein, putative [Medicago truncatula]
Length=335

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 149/196 (76%), Gaps = 5/196 (3%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSH-GELVGHQSVKR  523
            C   L KAL  +GIEL +PN+TCDVVYCYCGIRLHPLSC E+F + +H G LVG +SVKR
Sbjct  137  CESDLGKALKVRGIELFQPNETCDVVYCYCGIRLHPLSCSESFKLTAHNGNLVGDESVKR  196

Query  522  LETDCFsssangysslasc---SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            LE +C SSS+N  +   +    SKCL+SLY L K +T ++SKS +R +K+ ++DC+LMGL
Sbjct  197  LERNCLSSSSNHVNGFPALGGCSKCLHSLYSLRK-KTSNSSKSGDRTTKIHNKDCELMGL  255

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            TWLL KNR  YIHTV+ VLRALM+S +GSDP SCTLNSDGMPLAVDSSE YDQSSS  L+
Sbjct  256  TWLLAKNRTTYIHTVTWVLRALMLSPDGSDPQSCTLNSDGMPLAVDSSEMYDQSSSINLK  315

Query  171  ISHYTYIIVPLLLLYI  124
            +  +T ++  L + +I
Sbjct  316  VPIFTSLLFLLAMHFI  331



>ref|XP_008374829.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
 ref|XP_008374831.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=330

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L +AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAF  N  G+LVG   VK+L
Sbjct  129  CVEDLGQALKTRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFWENERGKLVGGAKVKKL  188

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC S   NG+  L  CSKCL+SLY L+K +   +SK ++R +KM S+DCQLMGLTWLL
Sbjct  189  ERDCLSGGGNGFPGLGGCSKCLHSLYNLNKKKASDSSKLEDRTTKMHSKDCQLMGLTWLL  248

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
             KNR  YIHTV++V RA M+S +GSDP SCTLNSDGMPLAVDSS+  DQSSS  L  S +
Sbjct  249  AKNRTAYIHTVTSVFRAFMVSADGSDPRSCTLNSDGMPLAVDSSQISDQSSSNILAASVF  308

Query  159  TYIIVPLLLLYI  124
             Y+++ L LL++
Sbjct  309  FYLVMSLSLLFM  320



>ref|XP_009360091.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Pyrus 
x bretschneideri]
Length=330

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL N+GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS N  G+LVG + VK+L
Sbjct  130  CVQDLGKALKNRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSENERGKLVGDEKVKKL  189

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E  C SS ANG        KCL+SLY L+K +T ++SK  +R +KM ++DCQLMGLTWLL
Sbjct  190  ERVCLSSGANGNGLGGCS-KCLHSLYNLNKKKTSNSSKLGDRTTKMHNKDCQLMGLTWLL  248

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
             KNR  YIHTV++V RA+M+STNGSDP SCTLNSDGMPLAVDSSE  DQSSS  L  S  
Sbjct  249  AKNRTAYIHTVTSVFRAIMVSTNGSDPRSCTLNSDGMPLAVDSSEISDQSSSSILAASVS  308

Query  159  TYIIVPLLLLYI  124
             Y+++ L L ++
Sbjct  309  FYLVMSLSLFFM  320



>ref|XP_004512737.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cicer arietinum]
Length=328

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 137/178 (77%), Gaps = 3/178 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ LEKAL  +GIE++KPN++CD+VYCYCGIRLHP SC +AFS+   GELVG +SV+ L
Sbjct  128  CVNGLEKALKLRGIEMIKPNESCDLVYCYCGIRLHPFSCSDAFSVTKSGELVGDESVRML  187

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C  SS            SKCLN+LYLL+K +T ++SK ++R +K+ ++DC+LMGLTW
Sbjct  188  EKNCLISSKTFKGFSGLEGCSKCLNNLYLLNK-KTSNSSKIEDRTTKIHNKDCELMGLTW  246

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            LL+KNR  YIHTVS VLRAL+ STNGS P SCTLNSDGMPLAVDSSE Y  SSS  LQ
Sbjct  247  LLSKNRTAYIHTVSDVLRALLWSTNGSKPKSCTLNSDGMPLAVDSSEIYYHSSSLNLQ  304



>ref|XP_010097582.1| hypothetical protein L484_017392 [Morus notabilis]
 gb|EXB69114.1| hypothetical protein L484_017392 [Morus notabilis]
Length=333

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  ++KAL  +GIEL +PN+TCDVVYCYCGIRLHPLSCPEAFS++  G++V  + V+RL
Sbjct  129  CVADVDKALRGRGIELKRPNETCDVVYCYCGIRLHPLSCPEAFSVSQEGKVVRDKRVRRL  188

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETR-STSKSDERGSKMRSRDCQLMGLT  349
            E DC S   N          SKCLNSL+ L+ ++   +TSKSD+R +KM ++DC+LMGLT
Sbjct  189  ERDCLSKPGNVNGFPGLGGCSKCLNSLHQLNNNKKALNTSKSDDRTTKMHNKDCELMGLT  248

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSD-PLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            WLL KNR  Y+HTVSAV+RA+M++T+GSD P SC L+SDGMPLAVDS+E  DQS+S  L 
Sbjct  249  WLLAKNRTAYMHTVSAVIRAIMLNTDGSDHPRSCALSSDGMPLAVDSAEISDQSASSVLG  308

Query  171  ISHYTYIIVPLLLLYI  124
             +H +  IV + LLY+
Sbjct  309  PAHVSLCIVLISLLYM  324



>ref|XP_004160422.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
Length=334

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV +L++AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G L G+++VKRL
Sbjct  135  CVSNLDQALNQRGIELMKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNRNVKRL  194

Query  519  ETDCFsssangysslasc-SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWL  343
            E +C SS            SKCL SLY L+K ET ++SK + R +KM  ++CQLMGLTWL
Sbjct  195  ERNCLSSGNVNGFPGLGGCSKCLKSLYQLNKKETLNSSKPENRTTKMHHKECQLMGLTWL  254

Query  342  LNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISH  163
            L KNR  YI TV++VLRA MMS +GSDP SCTLNSDGMPLAVDS+E    S +   Q   
Sbjct  255  LAKNRTAYIRTVTSVLRAKMMSEDGSDPRSCTLNSDGMPLAVDSAEMSGSSVTIPTQTLL  314

Query  162  Y  160
            Y
Sbjct  315  Y  315



>ref|XP_004503298.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cicer arietinum]
Length=343

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 146/195 (75%), Gaps = 8/195 (4%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            C  +L KAL  +GIEL +PN+TCDVVYCYCGIRLHPLSC E+F +   G LVG ++VK L
Sbjct  142  CEGNLGKALKLRGIELFQPNETCDVVYCYCGIRLHPLSCAESFKLTKSGNLVGDENVKML  201

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            E +C SSS+NG +        SKCL+SLYLL K +T ++SK+ +R +K+ ++DC+LMGLT
Sbjct  202  ERNCLSSSSNGVNGFPGLGGCSKCLHSLYLLRK-KTSNSSKTLDRTTKIHNKDCELMGLT  260

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQI  169
            WLL KNR  YIHTVS VLRALM++++GSDP SCTLNSDGMPLAVDSSE +DQSSS  LQ 
Sbjct  261  WLLAKNRTAYIHTVSLVLRALMLNSDGSDPQSCTLNSDGMPLAVDSSEMFDQSSSINLQP  320

Query  168  SHYTYIIVPLLLLYI  124
                 I + LL LY 
Sbjct  321  P----IFLSLLFLYF  331



>ref|XP_011084420.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Sesamum 
indicum]
Length=342

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 150/193 (78%), Gaps = 4/193 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD+LEKALGN+GI+L +PN+TCDVVYCYCGIRLHP SCPEAF +NS G+LVG ++VK+L
Sbjct  144  CVDTLEKALGNRGIQLGRPNETCDVVYCYCGIRLHPFSCPEAFWVNSRGKLVGGEAVKKL  203

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DCF +   G   L  CSKCLNSL+LL+  +    +++ ER S+M ++DC+LMGLTWLL
Sbjct  204  ERDCF-NGGGGGGGLGGCSKCLNSLHLLNGDKAGRNNQT-ERTSRMHNQDCELMGLTWLL  261

Query  339  NKNRARYIHTVSAVLRALMMST-NGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISH  163
            NK+R+ YIHTVSAVLRALMM+T   SDP  C+LNSDGMPLAVDSSE   QSSS  + +  
Sbjct  262  NKDRSAYIHTVSAVLRALMMNTEEASDPTFCSLNSDGMPLAVDSSEINSQSSSTIVAMRL  321

Query  162  YTYIIVPLLLLYI  124
            + Y + PL  LY+
Sbjct  322  HQYFL-PLSTLYM  333



>ref|XP_008240173.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Prunus 
mume]
Length=338

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 128/161 (80%), Gaps = 2/161 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L +AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N  G+LVG  SVKRL
Sbjct  141  CVQDLGEALKTRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSVNQRGKLVGDASVKRL  200

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E +C SSS        S  KCL SL+LL+K +T ++SK ++R +KM ++DCQLMGLTWLL
Sbjct  201  ERNCLSSSGFPGLGGCS--KCLKSLHLLNKKKTFNSSKLEDRTTKMHNKDCQLMGLTWLL  258

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAV  217
             KNR  YIHTV++V RA+M+S +GSDP SCTLNSDGMPLAV
Sbjct  259  AKNRTAYIHTVTSVFRAIMLSADGSDPQSCTLNSDGMPLAV  299



>ref|XP_008453468.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Cucumis 
melo]
Length=334

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 139/189 (74%), Gaps = 5/189 (3%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV +L++AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G L G+++VKRL
Sbjct  135  CVSNLDQALNQRGIELMKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNRNVKRL  194

Query  519  ETDCFsssangysslasc-SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWL  343
            E +C SS            SKCL SLY L+  ET ++SK + R +KM  ++CQLMGLTWL
Sbjct  195  ERNCLSSGNVNGFPGLGGCSKCLKSLYQLNNKETLNSSKPENRTTKMHHKECQLMGLTWL  254

Query  342  LNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISH  163
            L KNR  YI TV++VLRA MM  +GSDP SCTLNSDGMPLAVDS+E     SS ++ I  
Sbjct  255  LAKNRTAYIRTVTSVLRAKMMRKDGSDPRSCTLNSDGMPLAVDSAEI----SSSSVPIPT  310

Query  162  YTYIIVPLL  136
            +T + + L+
Sbjct  311  HTLLYLGLV  319



>ref|XP_010274672.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=330

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV +LE A   KGIEL +PN+TCD+VYCYCGIRL P SCPEAFS++  G+LV   +VK+L
Sbjct  132  CVGNLENAFKGKGIELFRPNETCDLVYCYCGIRLRPWSCPEAFSVSKEGKLVAGNTVKKL  191

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKS-DERGSKMRSRDCQLMGLTWL  343
            E DCF+ +     S  S  KCLN LY L++ +  ++SK   +R SKM +RDC+LMGLTWL
Sbjct  192  EKDCFNVNGYTSLSGCS--KCLNRLYQLNEEKAGNSSKPVIDRKSKMHNRDCELMGLTWL  249

Query  342  LNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTL  175
            L+KNR  YI TVSAVLR LMM+T GSDP SCTLNSDGMPLAVDSSE  D SS+  L
Sbjct  250  LSKNRTAYISTVSAVLRVLMMNTEGSDPRSCTLNSDGMPLAVDSSELDDPSSANIL  305



>ref|XP_010260827.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=334

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 136/192 (71%), Gaps = 4/192 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV SLE AL  KGIEL +PN TCD+VYCYCGIRL P SCP AFS++  G L+G  +VK+L
Sbjct  134  CVGSLENALKGKGIELFRPNATCDLVYCYCGIRLRPWSCPNAFSVSKEGNLLGGDTVKKL  193

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMRSRDCQLMGLTWL  343
            E DC S +     S  S  KCLN LY L++  + ++SKS+ +R +KMR+RDC  MGLTWL
Sbjct  194  EKDCLSINGYTNLSGCS--KCLNRLYQLNEHNSGNSSKSESDRIAKMRNRDCGFMGLTWL  251

Query  342  LNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISH  163
            L+KNR  YI TVSAVLRALMMSTNGSDP SC+L  DGMPL VDSSE   QSS+ T+    
Sbjct  252  LSKNRTAYIPTVSAVLRALMMSTNGSDPQSCSLKGDGMPLPVDSSELDGQSSA-TILPYP  310

Query  162  YTYIIVPLLLLY  127
               IIV L L +
Sbjct  311  LGLIIVSLSLFF  322



>ref|XP_010678117.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Beta 
vulgaris subsp. vulgaris]
Length=339

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEKA+ +KG+ LV+PN +CDVVYCYCGIRLH LSC +AF +   G LVG   V +L
Sbjct  136  CVDGLEKAMRDKGVNLVRPNSSCDVVYCYCGIRLHQLSCNQAFRVLEDGRLVGDDRVNKL  195

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETR--STSKSDERGSKMRSRDCQLMGL  352
            E DC   + +          SKCLNSLY L K      + +K + R S+MR+RDC+LMGL
Sbjct  196  ERDCLHKNGSRNHHSTLAHCSKCLNSLYTLKKGNKGKGNPTKLESRTSQMRNRDCELMGL  255

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            TWLLNK+R  YI TV++V+RALM++T GSDP SC+LNS+G+PLAVDS+EF  QSSS +LQ
Sbjct  256  TWLLNKDRDAYISTVTSVMRALMLNTEGSDPRSCSLNSNGLPLAVDSAEFDGQSSSVSLQ  315

Query  171  ISHYTYIIVPLLLL  130
               + Y++  LLL+
Sbjct  316  FPLHLYLVSILLLI  329



>ref|XP_007160509.1| hypothetical protein PHAVU_002G327800g [Phaseolus vulgaris]
 gb|ESW32503.1| hypothetical protein PHAVU_002G327800g [Phaseolus vulgaris]
Length=337

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 142/192 (74%), Gaps = 7/192 (4%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL  +GI LV+PN+TCDVVYCYCGIRLHPL+C E+FS+   G LV  +SVKRL
Sbjct  143  CVSDLGKALKVRGIHLVQPNETCDVVYCYCGIRLHPLTCTESFSVTPSGGLVVDESVKRL  202

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DC SSS N          SKCL+SLY L + ++ ++SKS++R SK+ ++DC+LMGLTW
Sbjct  203  EKDCLSSSTNVNKFPGLGGCSKCLHSLYSL-RKKSSNSSKSEDRTSKIHNKDCELMGLTW  261

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            L+ KNR  Y+HTVS VLRALM+ST GSDP SCTLNSDGMPLAVDSSE  D+S S  LQ S
Sbjct  262  LMAKNRTAYMHTVSGVLRALMLSTEGSDPQSCTLNSDGMPLAVDSSEMSDESCSSYLQAS  321

Query  165  HYTYIIVPLLLL  130
                I + LLLL
Sbjct  322  ----IFLSLLLL  329



>gb|KGN63863.1| hypothetical protein Csa_1G024950 [Cucumis sativus]
Length=184

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  651  VKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLETDCFsssangyssla  472
            +KPN+TCDVVYCYCGIRLHPLSCPEAFS+N +G L G+++VKRLE +C SS         
Sbjct  1    MKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNRNVKRLERNCLSSGNVNGFPGL  60

Query  471  sc-SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVL  295
               SKCL SLY L+K ET ++SK + R +KM  ++CQLMGLTWLL KNR  YI TV++VL
Sbjct  61   GGCSKCLKSLYQLNKKETLNSSKPENRTTKMHHKECQLMGLTWLLAKNRTAYIRTVTSVL  120

Query  294  RALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY  160
            RA MMS +GSDP SCTLNSDGMPLAVDS+E    S +   Q   Y
Sbjct  121  RAKMMSEDGSDPRSCTLNSDGMPLAVDSAEMSGSSVTIPTQTLLY  165



>ref|XP_010032707.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Eucalyptus 
grandis]
 gb|KCW83995.1| hypothetical protein EUGRSUZ_B00868 [Eucalyptus grandis]
Length=345

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 125/163 (77%), Gaps = 3/163 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KA   +G+ L +PN+TCDVVYCYCGIRLHPLSCP AFS+N  G+LVG +SV+RL
Sbjct  141  CVDGLGKAFRERGVALARPNETCDVVYCYCGIRLHPLSCPAAFSVNRRGKLVGDESVRRL  200

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC   S NG+  L  CSKCL  L+ L+++ + S+   +ER +KMR++DCQLMGLTWLL
Sbjct  201  ERDC--RSGNGFPGLGGCSKCLKGLHQLNRNTSDSSKLEEERTTKMRNKDCQLMGLTWLL  258

Query  339  NKNRARYIHTVSAVLRALMMSTNGSD-PLSCTLNSDGMPLAVD  214
             KNR  YIHTVSAVLRALMM+   S  P SCTLNSDGMPLAVD
Sbjct  259  AKNRTAYIHTVSAVLRALMMAEESSSHPQSCTLNSDGMPLAVD  301



>ref|XP_003528967.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
Length=342

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 130/164 (79%), Gaps = 3/164 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L KAL  +G+EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GELVG   V+RL
Sbjct  142  CVNELGKALVVRGVELTKPNETCDVVYCFCGIRLHHLTCPDSFSVGQSGELVGDAIVRRL  201

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS N          SKCLN+LYLL+K +T ++SK+++R +K+ ++DC+LMGLTW
Sbjct  202  EKNCLSSSTNVNGLPGLGGCSKCLNTLYLLNK-KTSNSSKAEDRTTKIHNKDCELMGLTW  260

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            LL KNR  Y+HTVSAVLRALM++T+GS P SC+LNSDGMPLAVD
Sbjct  261  LLAKNRTAYMHTVSAVLRALMLNTDGSYPQSCSLNSDGMPLAVD  304



>gb|KFK39131.1| hypothetical protein AALP_AA3G204900 [Arabis alpina]
Length=340

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 141/202 (70%), Gaps = 14/202 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLH LSC +AFS+N  G+LVG +SV RL
Sbjct  138  CVDGLGKSLKRRGIELSRPNETCDVVYCYCGIRLHHLSCSDAFSVNEQGKLVGDESVDRL  197

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S   +     +S S   KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  198  ETDCLSGGHDNAGRFSSLSGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTTKMHNKDCVL  257

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++ NG +P SC L SDGMPLAVDSSEF + SS+ 
Sbjct  258  MGLTWLLAKNRTAYFPTVTSVLRAVMLNQNG-EPRSCALGSDGMPLAVDSSEFSNGSST-  315

Query  180  TLQISHY-----TYIIVPLLLL  130
            + Q  H+      Y ++ L+LL
Sbjct  316  SFQYPHHLVHFLLYSVITLVLL  337



>ref|XP_003534147.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
 gb|KHN23729.1| Putative GPI-anchored protein [Glycine soja]
Length=343

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L KAL  +G+EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GELVG  SV RL
Sbjct  143  CVNELGKALELRGVELTKPNETCDVVYCFCGIRLHHLTCPDSFSVGQSGELVGDASVTRL  202

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SS+ +          SKCLN+LY L+K +T ++SK+++R +K+ ++DC+LMGLTW
Sbjct  203  EKNCLSSTTDANGLPGLGGCSKCLNTLYWLNK-KTSNSSKAEDRTTKIHNKDCELMGLTW  261

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            LL KNR  Y+HTVSAVLRALM++T+GS P SC+LNSDGMPLAVD
Sbjct  262  LLAKNRTAYMHTVSAVLRALMLNTDGSYPQSCSLNSDGMPLAVD  305



>gb|KHN44610.1| Putative GPI-anchored protein [Glycine soja]
Length=343

 Score =   195 bits (496),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 130/164 (79%), Gaps = 3/164 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L KAL  +G+EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GELVG   V+RL
Sbjct  143  CVNELGKALVVRGVELTKPNETCDVVYCFCGIRLHHLTCPDSFSVGQSGELVGDAIVRRL  202

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS N          SKCLN+LYLL+K +T ++SK+++R +K+ ++DC+LMGLTW
Sbjct  203  EKNCLSSSTNVNGLPGLGGCSKCLNTLYLLNK-KTSNSSKAEDRTTKIHNKDCELMGLTW  261

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            LL KNR  Y+HTVSAVLRALM++T+GS P SC+LNSDGMPLAVD
Sbjct  262  LLAKNRTAYMHTVSAVLRALMLNTDGSYPQSCSLNSDGMPLAVD  305



>ref|XP_010549074.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Tarenaya 
hassleriana]
Length=337

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 137/201 (68%), Gaps = 12/201 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KA+  +GIEL +PN+TCDVV CYCGIRLHPLSCPEAF +N  G+LVG+  V+RL
Sbjct  132  CVDGLGKAMRRRGIELARPNETCDVVSCYCGIRLHPLSCPEAFEVNEEGKLVGNDHVERL  191

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRST----SKSDE-RGSKMRSRDCQL  361
            E DC SS  N          +KCLNSLY L+  +  S+    SK DE R +KM ++DC+L
Sbjct  192  EKDCLSSDDNVDEFPGLGGCNKCLNSLYKLNPKKEPSSASNPSKEDETRTAKMHNKDCEL  251

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSD----PLSCTLNSDGMPLAVDSSEFYDQ  193
            MGLTWLL KNR  YI TV++VLRA+M++  GSD    P SC L+SDGMPLAVDSSEF D 
Sbjct  252  MGLTWLLAKNRKAYIGTVTSVLRAIMLN-GGSDTSAGPRSCALSSDGMPLAVDSSEFSDH  310

Query  192  SSSFTLQISHYTYIIVPLLLL  130
            SS+    +    +  +  +LL
Sbjct  311  SSTAAFPLHVLFFFSLSAVLL  331



>ref|XP_002883104.1| hypothetical protein ARALYDRAFT_898158 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59363.1| hypothetical protein ARALYDRAFT_898158 [Arabidopsis lyrata subsp. 
lyrata]
Length=330

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 138/199 (69%), Gaps = 11/199 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G LVG + V RL
Sbjct  134  CVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLVGDERVDRL  193

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N     +     +KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  194  ETDCLSGSHNNADRFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTAKMHNKDCVL  253

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++ +G  P SC L SDGMPLAVDSSEF + S + 
Sbjct  254  MGLTWLLAKNRTAYFPTVTSVLRAVMLNHDGV-PRSCALGSDGMPLAVDSSEFSNGSPT-  311

Query  180  TLQISHY--TYIIVPLLLL  130
            +LQ  H+   Y ++ L+LL
Sbjct  312  SLQYWHHFLLYSVITLVLL  330



>ref|XP_007152699.1| hypothetical protein PHAVU_004G151900g [Phaseolus vulgaris]
 gb|ESW24693.1| hypothetical protein PHAVU_004G151900g [Phaseolus vulgaris]
Length=332

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 127/164 (77%), Gaps = 3/164 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L KAL  +GIEL KPN TCDVVYC+CGIRLH L+CP+AFS++ +GELVG   V+RL
Sbjct  134  CVNELGKALEVRGIELTKPNDTCDVVYCFCGIRLHHLTCPDAFSVSQNGELVGDAGVRRL  193

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS +          SKCLN+LYLL+K  + S SK+++R +K+ ++DC+LMGLTW
Sbjct  194  EKNCLSSSTDVNGLPGLGGCSKCLNTLYLLNKKSSNS-SKAEDRTTKIHNKDCELMGLTW  252

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            LL KNR  Y+HTVS VLRALM++T+ S P SC+LNSDGMPLAVD
Sbjct  253  LLAKNRTAYMHTVSGVLRALMLNTDASYPHSCSLNSDGMPLAVD  296



>ref|XP_006297874.1| hypothetical protein CARUB_v10013914mg, partial [Capsella rubella]
 gb|EOA30772.1| hypothetical protein CARUB_v10013914mg, partial [Capsella rubella]
Length=387

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 139/202 (69%), Gaps = 14/202 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC +AF +N  G LVG + V RL
Sbjct  185  CVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSDAFRVNDEGRLVGDERVHRL  244

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N    ++     +KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  245  ETDCLSGSHNNADRVSPLLGCNKCLNSLYKLNPKNTSGTRNPSKEDRNRTAKMHNKDCVL  304

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++  G +P SC L SDGMPLAVDSSEF + S++ 
Sbjct  305  MGLTWLLAKNRTAYFPTVTSVLRAVMLN-QGGEPRSCALGSDGMPLAVDSSEFSNGSAT-  362

Query  180  TLQISH-----YTYIIVPLLLL  130
            +LQ  H       Y ++ LLLL
Sbjct  363  SLQYPHNLVNFLLYSVITLLLL  384



>gb|ACU18006.1| unknown [Glycine max]
Length=342

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV+ L KAL  +G+EL KPN+TCDVVYC+CGIRLH L+CP++FS+   GELVG   V+RL
Sbjct  142  CVNELGKALVVRGVELTKPNETCDVVYCFCGIRLHHLACPDSFSVGQSGELVGDAIVRRL  201

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS N          SKCLN+LYLL+K +T ++SK+++R +K+ ++DC+LMGLTW
Sbjct  202  EKNCLSSSTNVNGLPGLGGCSKCLNTLYLLNK-KTSNSSKAEDRTTKIHNKDCELMGLTW  260

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            LL KNR  Y+HTV AVLRALM++T+GS P SC+LNSDGMPLAVD
Sbjct  261  LLAKNRTAYMHTVFAVLRALMLNTDGSYPQSCSLNSDGMPLAVD  304



>ref|XP_010487719.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=337

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 137/203 (67%), Gaps = 16/203 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G LVG + V RL
Sbjct  134  CVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLVGDERVTRL  193

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N     +     +KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  194  ETDCLSGSHNNADRFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTAKMHNKDCVL  253

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++  G +P SC + SDGMPLAVDSSEF   S++ 
Sbjct  254  MGLTWLLAKNRTAYFPTVTSVLRAVMLN-QGGEPRSCAIGSDGMPLAVDSSEFSSGSAT-  311

Query  180  TLQISH-------YTYIIVPLLL  133
            +LQ  H       Y+ II  +LL
Sbjct  312  SLQYPHCLVHFFLYSVIITLVLL  334



>ref|NP_566596.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02017.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96874.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15376.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE76040.1| uncharacterized protein AT3G18050 [Arabidopsis thaliana]
Length=335

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 138/202 (68%), Gaps = 14/202 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G LVG + V RL
Sbjct  133  CVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNDEGRLVGDERVDRL  192

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N     +     +KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  193  ETDCLSGSHNNADGFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTAKMHNKDCVL  252

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++ +G  P SC L SDGMPLAVDSSEF + S + 
Sbjct  253  MGLTWLLAKNRTAYFPTVTSVLRAVMLNHDGV-PRSCALGSDGMPLAVDSSEFSNGSPT-  310

Query  180  TLQISHY-----TYIIVPLLLL  130
            +LQ  H+      Y ++ L+L+
Sbjct  311  SLQYPHHLVHFLLYSVITLVLI  332



>ref|XP_003525199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Glycine 
max]
Length=360

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 127/163 (78%), Gaps = 3/163 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL  +GI+L +PN+TCD+VYCYCGIRLHPL+CPE+FS+   G LV +QSVKRL
Sbjct  147  CVSDLGKALKIRGIQLFQPNETCDLVYCYCGIRLHPLTCPESFSVTPSGTLVVNQSVKRL  206

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DCFSSS N          SKCL+SLY L +  + ++SKS++R +K+ ++DC+LMGLTW
Sbjct  207  ERDCFSSSTNVNKFPGLGGCSKCLHSLYSL-RKNSSNSSKSEDRTTKIHNKDCELMGLTW  265

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAV  217
            LL KNR  YIHTVS VLRALM+ST GSDP SCTLNSDGMPLAV
Sbjct  266  LLAKNRTAYIHTVSGVLRALMLSTEGSDPQSCTLNSDGMPLAV  308



>gb|ACU18611.1| unknown [Glycine max]
Length=360

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL  +GI+L +PN+TCD+VYCYCGIRLHPL+CPE+FS+   G LV +QSVKRL
Sbjct  147  CVSDLGKALKIRGIQLFQPNETCDLVYCYCGIRLHPLTCPESFSVTPSGTLVVNQSVKRL  206

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DCFSS  N          SKCL+SLY L +  + ++SKS++R +K+ ++DC+LMGLTW
Sbjct  207  EGDCFSSGTNVNKFPGLGGCSKCLHSLYSL-RKNSSNSSKSEDRTTKIHNKDCELMGLTW  265

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAV  217
            LL KNR  YIHTVS VLRALM+ST GSDP SCTLNSDGMPLAV
Sbjct  266  LLAKNRTAYIHTVSGVLRALMLSTEGSDPQSCTLNSDGMPLAV  308



>gb|KHN00170.1| Putative GPI-anchored protein [Glycine soja]
Length=327

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 138/193 (72%), Gaps = 6/193 (3%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL  +GI+L +PN+TCDVVYCYCGIRLHPL+CPE+FS+   G LV +QSVKRL
Sbjct  131  CVSDLGKALKVRGIQLFQPNETCDVVYCYCGIRLHPLTCPESFSVTPSGSLVVNQSVKRL  190

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
              DC SSS N          SKCL+SLY L K  + S+   ++R SK+ ++DC+LMGLTW
Sbjct  191  ARDCSSSSTNVNKFPGLGGCSKCLHSLYSLRKKSSNSSKSEEDRTSKIHNKDCELMGLTW  250

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQIS  166
            LL KNR  YIHTVS VLRALM+S  GSDP SCTLNSDGMPLAVDSSE  D+SS+  LQ  
Sbjct  251  LLAKNRTAYIHTVSGVLRALMLSREGSDPQSCTLNSDGMPLAVDSSEMSDESSATNLQAP  310

Query  165  HYTYIIVPLLLLY  127
                I + LL L+
Sbjct  311  ----IFLSLLFLH  319



>ref|XP_010465880.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=336

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 137/202 (68%), Gaps = 14/202 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G LVG + V RL
Sbjct  134  CVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLVGDERVTRL  193

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N    L+     +KCLNSLY L+    S TR  SK D  R +KM ++DC L
Sbjct  194  ETDCLSGSHNNADRLSPLLGCNKCLNSLYKLNPKKTSGTRHPSKEDRNRTAKMHNKDCVL  253

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++  G +P SC + SDGMPLAVDSSEF    ++ 
Sbjct  254  MGLTWLLAKNRTAYFPTVTSVLRAVMLN-QGGEPRSCAIGSDGMPLAVDSSEFSSGLAT-  311

Query  180  TLQISH-----YTYIIVPLLLL  130
            +LQ  H     + Y ++ L+LL
Sbjct  312  SLQYPHCLVHFFLYSVITLVLL  333



>ref|XP_009145938.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Brassica 
rapa]
Length=333

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 136/201 (68%), Gaps = 12/201 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L  +GIEL  PN+TC VV CYCGIRLH LSC EAFS+N  G LVG +SV RL
Sbjct  131  CVDGLEKSLRRRGIELASPNETCGVVDCYCGIRLHHLSCSEAFSVNGEGRLVGDESVDRL  190

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S   N     +  S   KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  191  ETDCLSVRNNNGDRFSPLSRCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTTKMHNKDCVL  250

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS-  184
            MGLTWLL KNR  Y  TV++VLRA+M++ NG +P SC L  DGMPLAVDSSEF + SS+ 
Sbjct  251  MGLTWLLAKNRTAYFPTVTSVLRAVMLNQNG-EPRSCALGGDGMPLAVDSSEFSNGSSTL  309

Query  183  --FTLQISHY-TYIIVPLLLL  130
              +   + H+  Y ++ L+LL
Sbjct  310  IQYPYHLVHFLLYSVITLVLL  330



>ref|XP_010506313.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=336

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 136/203 (67%), Gaps = 16/203 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G L G + V RL
Sbjct  133  CVDGLGKSLRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNEEGRLGGDERVTRL  192

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N     +     +KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  193  ETDCLSGSHNNADRFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTAKMHNKDCVL  252

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y  TV++VLRA+M++  G +P SC + SDGMPLAVDSSEF   S++ 
Sbjct  253  MGLTWLLAKNRTAYFPTVTSVLRAVMLN-QGGEPRSCAIGSDGMPLAVDSSEFSSGSAT-  310

Query  180  TLQISH-------YTYIIVPLLL  133
            +LQ  H       Y+ II  +LL
Sbjct  311  SLQYPHCLVHFFLYSVIITLVLL  333



>gb|KHN21661.1| Putative GPI-anchored protein [Glycine soja]
Length=342

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L KAL  + I+L +PN+TCD+VYCYCGIRLHPL+CPE+FS+   G LV +QSVKRL
Sbjct  147  CVSDLGKALKIREIQLFQPNETCDLVYCYCGIRLHPLTCPESFSVTPSGTLVVNQSVKRL  206

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E DCFSSS N          SKCL+SLY L +  + ++SKS++R +K+ ++DC+LMGLTW
Sbjct  207  ERDCFSSSTNVNKFPGLGGCSKCLHSLYSL-RKNSSNSSKSEDRTTKIHNKDCELMGLTW  265

Query  345  LLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAV  217
            LL KNR  YIHTVS VLRALM+ST GSDP SCTLNSDGMPLAV
Sbjct  266  LLAKNRTAYIHTVSGVLRALMLSTEGSDPQSCTLNSDGMPLAV  308



>gb|EPS70389.1| hypothetical protein M569_04371 [Genlisea aurea]
Length=327

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 128/177 (72%), Gaps = 13/177 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNS-HGELVGHQSVKR  523
            CV++LEKALG++ I L +PN+TCDVVYCYCGIRLHP SCPEAF ++S  GEL G  +VK+
Sbjct  134  CVETLEKALGDRDILLRRPNETCDVVYCYCGIRLHPFSCPEAFRVSSPGGELQGGAAVKK  193

Query  522  LETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWL  343
            +E+ C   S+     LA CS+CLNSLY L++ +     K   R +KM SRDC+LMGLTWL
Sbjct  194  MESAC---SSAAAGGLAGCSQCLNSLYSLNEKK-----KGTNRTAKMHSRDCELMGLTWL  245

Query  342  LNKNRARYIHTVSAVLRALMMSTNGS----DPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LNKNR  YI +V+ VLRA+M+   G     +P +CTLNSDG+P AVDSSE   +SSS
Sbjct  246  LNKNRTDYIRSVTGVLRAIMIGGGGGDDSYNPTACTLNSDGIPQAVDSSEIDGRSSS  302



>ref|XP_009135567.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Brassica rapa]
Length=338

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 137/202 (68%), Gaps = 13/202 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L  +GIEL + N+TCDV YCYCGIRLH LSC EAFS+N  G LVG +SV RL
Sbjct  135  CVDGLEKSLRRRGIELQRQNETCDVAYCYCGIRLHHLSCSEAFSVNEEGRLVGDESVDRL  194

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            E DC S        L+  S   KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  195  ENDCLSGRHAIGDRLSHLSSCNKCLNSLYKLNPKKTSGTRNQSKEDRSRTTKMHNKDCVL  254

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y H+V++VLRA+M+S NG +P SC L  DGMPLAVDSSEF + SSS 
Sbjct  255  MGLTWLLAKNRTAYFHSVTSVLRAVMLSQNG-EPRSCALGGDGMPLAVDSSEFSNDSSSA  313

Query  180  TLQISHYT-----YIIVPLLLL  130
             L+  ++      Y ++ LLLL
Sbjct  314  LLKYPYHMVHFILYSVITLLLL  335



>emb|CDY51932.1| BnaAnng11090D [Brassica napus]
Length=338

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 137/202 (68%), Gaps = 13/202 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L  +GIEL + N+TCDV YCYCGIRLH LSC EAFS+N  G LVG +SV RL
Sbjct  135  CVDGLEKSLRRRGIELQRQNETCDVAYCYCGIRLHHLSCSEAFSVNEEGRLVGDESVDRL  194

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            E DC S        L+  S   KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  195  ENDCLSGRHANGDRLSHLSSCNKCLNSLYKLNPKKTSGTRNQSKEDRSRTTKMHNKDCVL  254

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y H+V++VLRA+M+S NG +P SC L  DGMPLAVDSSEF + SSS 
Sbjct  255  MGLTWLLAKNRTAYFHSVTSVLRAVMLSQNG-EPRSCALGGDGMPLAVDSSEFSNDSSSA  313

Query  180  TLQISHY-----TYIIVPLLLL  130
             L+  ++      Y ++ LLLL
Sbjct  314  LLKYPYHLVHFILYSVITLLLL  335



>ref|XP_006406660.1| hypothetical protein EUTSA_v10021078mg [Eutrema salsugineum]
 gb|ESQ48113.1| hypothetical protein EUTSA_v10021078mg [Eutrema salsugineum]
Length=340

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 120/169 (71%), Gaps = 8/169 (5%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L K+L  +GIEL +PN+TCDVVYCYCGIRLH LSC +AF ++  G LVG +SV RL
Sbjct  138  CVDGLGKSLRRRGIELARPNETCDVVYCYCGIRLHHLSCSDAFRVDEQGRLVGDESVDRL  197

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S S N     +  S   KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  198  ETDCLSGSHNNADRFSPLSACNKCLNSLYKLNPKKTSATRNPSKEDRNRTTKMHNKDCVL  257

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            MGLTWLL KNR  Y  TV++VLRA+M++ +G +P SC L SDGMPLAVD
Sbjct  258  MGLTWLLAKNRTAYFPTVTSVLRAVMLNHDG-EPRSCALGSDGMPLAVD  305



>emb|CDX75958.1| BnaC03g40410D [Brassica napus]
Length=338

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 134/199 (67%), Gaps = 12/199 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L  +GIEL + N+TCDV YCYCGIRLH LSC EAFS+N  G LVG +SV RL
Sbjct  132  CVDGLEKSLRRRGIELQRQNETCDVAYCYCGIRLHHLSCSEAFSVNEEGRLVGDESVDRL  191

Query  519  ETDCFsssangysslasc---SKCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            E DC S        L+     +KCL+SLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  192  ENDCLSGRHANGDRLSHLGRCNKCLHSLYKLNPKKTSGTRNQSKEDRNRTTKMHNKDCVL  251

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL KNR  Y H+V++VLRA+M+S N  +P SC L  DGMPLAVDSSEF + SSS 
Sbjct  252  MGLTWLLAKNRTAYFHSVTSVLRAVMLSQN--EPRSCALGGDGMPLAVDSSEFSNDSSSA  309

Query  180  TLQISHYTYIIVPLLLLYI  124
             L+   Y Y +V  +L  +
Sbjct  310  LLK---YPYHLVHFILYSV  325



>ref|XP_007209408.1| hypothetical protein PRUPE_ppa009266mg [Prunus persica]
 gb|EMJ10607.1| hypothetical protein PRUPE_ppa009266mg [Prunus persica]
Length=299

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 102/161 (63%), Gaps = 43/161 (27%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CV  L +AL  +GIEL+KPN+TCDVVYCYCGIRLHPLSCPEAFS+N              
Sbjct  143  CVQDLGEALKTRGIELIKPNETCDVVYCYCGIRLHPLSCPEAFSLN--------------  188

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
                                         K +T ++SK ++R +KM ++DCQLMGLTWLL
Sbjct  189  -----------------------------KKKTFNSSKLEDRTTKMHNKDCQLMGLTWLL  219

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAV  217
             KNR  YIHTV++V RA+M+S +GSDP SCTLNSDGMPLAV
Sbjct  220  AKNRTAYIHTVTSVFRAIMVSADGSDPQSCTLNSDGMPLAV  260



>gb|KCW83996.1| hypothetical protein EUGRSUZ_B00868 [Eucalyptus grandis]
Length=303

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KA   +G+ L +PN+TCDVVYCYCGIRLHPLSCP AFS+N  G+LVG +SV+RL
Sbjct  141  CVDGLGKAFRERGVALARPNETCDVVYCYCGIRLHPLSCPAAFSVNRRGKLVGDESVRRL  200

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            E DC   S NG+  L  CSKCL  L+ L+++ + S+   +ER +KMR++DCQLMGLTWLL
Sbjct  201  ERDC--RSGNGFPGLGGCSKCLKGLHQLNRNTSDSSKLEEERTTKMRNKDCQLMGLTWLL  258

Query  339  NKNRARYIHTVSAVLRALM  283
             KNR  YIHTVSAVLR ++
Sbjct  259  AKNRTAYIHTVSAVLRLVI  277



>ref|XP_007036757.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY21258.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=270

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 5/135 (4%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS++  G LVG ++V+RL
Sbjct  139  CVDDLGKALRQKGIELAKPNETCDVVYCYCGIRLHPLSCPEAFSVDQSGNLVGDENVERL  198

Query  519  ETDCFsssangysslasc--SKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTW  346
            E +C SSS+N          +KCL SL+L     T ++SKS++R +KMR++DCQLMGLTW
Sbjct  199  EKNCLSSSSNVNGFPGLGGCNKCLKSLHL---KNTLNSSKSEDRTTKMRNKDCQLMGLTW  255

Query  345  LLNKNRARYIHTVSA  301
            LL KNR  YI TVSA
Sbjct  256  LLAKNRTAYIRTVSA  270



>emb|CDY49619.1| BnaCnng17710D [Brassica napus]
Length=325

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 104/155 (67%), Gaps = 7/155 (5%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L  +GIEL  PN+TC VV CYCGIRLH LSC EAFS+N  G LVG +SV RL
Sbjct  131  CVDGLEKSLRRRGIELASPNETCGVVDCYCGIRLHHLSCSEAFSVNGEGMLVGDESVDRL  190

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S   N     +  S   KCL SLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  191  ETDCLSVRNNNGDRFSPLSRCNKCLKSLYKLNPKKTSGTRNPSKEDRNRTTKMHNKDCVL  250

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPL  256
            MGLTWLL KNR  Y  TV++VLRA+M+S N   PL
Sbjct  251  MGLTWLLAKNRTAYFPTVTSVLRAVMLSQNVPVPL  285



>emb|CDX92191.1| BnaA05g22160D [Brassica napus]
Length=325

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 105/155 (68%), Gaps = 7/155 (5%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD LEK+L  +GIEL  PN+TC VV CYCGIRLH LSC EAFS++  G LVG ++V RL
Sbjct  131  CVDGLEKSLRRRGIELASPNETCGVVDCYCGIRLHHLSCSEAFSVDGEGRLVGDENVDRL  190

Query  519  ETDCFsssangysslascS---KCLNSLYLLSK---SETRSTSKSDE-RGSKMRSRDCQL  361
            ETDC S   N     +  S   KCLNSLY L+    S TR+ SK D  R +KM ++DC L
Sbjct  191  ETDCLSVRNNNGDRFSPLSRCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTTKMHNKDCVL  250

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPL  256
            MGLTWLL KNR  Y  TV++VLRA+M++ N   PL
Sbjct  251  MGLTWLLAKNRTAYFPTVTSVLRAVMLNQNVPVPL  285



>ref|XP_010277906.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=322

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L ++ I + +PN TCD + C+CGIRLH    LSCP AF++ SH       +V
Sbjct  125  CVNSLQSSLQSRHINIPQPNSTCDAILCFCGIRLHQITSLSCPAAFNLTSHRNATPTAAV  184

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK-SDERGSKMRSRDCQLMGL  352
            K LE +C        SS + C+KCL +L  L       T + +DER SKM  RDCQLMGL
Sbjct  185  KNLERNC------RNSSYSGCTKCLGALEKLKGDWKNGTGEENDERASKMFGRDCQLMGL  238

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F  Q SS
Sbjct  239  TWLLARNKKAYIPTVSAVLRAMMYSAHPPHQSKCSPDQENMPLAVDSLQFGRQDSS  294



>emb|CBI18008.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 119/200 (60%), Gaps = 16/200 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L ++ I + +PN TCD + C+CGIRLH    LSCP AF+++S+       +V
Sbjct  88   CVNSLQSSLQSRNIHIPQPNATCDAILCFCGIRLHQITSLSCPAAFNISSYRNATPTAAV  147

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            K LE +C        SS + C+KCL +L  L       T +  +R SKM SRDCQLMGLT
Sbjct  148  KNLERNC------RNSSYSGCTKCLGALQKLKGDGKNGTEEGGDRASKMFSRDCQLMGLT  201

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYD-------QS  190
            WLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F          +
Sbjct  202  WLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFEKSSSSSSSTT  261

Query  189  SSFTLQISHYTYIIVPLLLL  130
             S    +  +++ I+PL++L
Sbjct  262  ISPFSSLPIFSFPILPLIML  281



>ref|XP_007043448.1| Uncharacterized protein TCM_007897 [Theobroma cacao]
 gb|EOX99279.1| Uncharacterized protein TCM_007897 [Theobroma cacao]
Length=323

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 121/195 (62%), Gaps = 9/195 (5%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ AL +K + + +PN +CD + C+CGIRLH    LSCP AF+++         +V
Sbjct  128  CVNSLQNALLSKRVRIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVSGFRNATPTAAV  187

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            K LE +C +SS  G +      + L   Y  + +E RSTS   ER SKM +RDCQLMGLT
Sbjct  188  KNLERNCRNSSYAGCTKCLGALQKLKGGYYKNGTEDRSTS---ERASKMFNRDCQLMGLT  244

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQI  169
            WLL +N+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F    SS +   
Sbjct  245  WLLARNKTAYIPTVSAVLRAIMYSAHPHE-SKCSPDQENMPLAVDSLQFEKAQSSASPHP  303

Query  168  S--HYTYIIVPLLLL  130
            S   +T+ ++PL++L
Sbjct  304  SWASFTFPVLPLIIL  318



>ref|XP_002276552.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
 ref|XP_010657383.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
 ref|XP_010657384.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Vitis 
vinifera]
Length=324

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 119/200 (60%), Gaps = 16/200 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L ++ I + +PN TCD + C+CGIRLH    LSCP AF+++S+       +V
Sbjct  126  CVNSLQSSLQSRNIHIPQPNATCDAILCFCGIRLHQITSLSCPAAFNISSYRNATPTAAV  185

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            K LE +C        SS + C+KCL +L  L       T +  +R SKM SRDCQLMGLT
Sbjct  186  KNLERNC------RNSSYSGCTKCLGALQKLKGDGKNGTEEGGDRASKMFSRDCQLMGLT  239

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYD-------QS  190
            WLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F          +
Sbjct  240  WLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFEKSSSSSSSTT  299

Query  189  SSFTLQISHYTYIIVPLLLL  130
             S    +  +++ I+PL++L
Sbjct  300  ISPFSSLPIFSFPILPLIML  319



>ref|XP_002326107.1| hypothetical protein POPTR_0019s14080g [Populus trichocarpa]
 gb|ABK95869.1| unknown [Populus trichocarpa]
 gb|EEF00489.1| hypothetical protein POPTR_0019s14080g [Populus trichocarpa]
Length=322

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 16/174 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL +K ++L +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  121  CVNSLQSALLSKNVKLAQPNASCDAILCFCGIRLHQISSLSCPAAFNVSSAFHNATPTAA  180

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL-SKSETRSTSKSDERGSKMRSRDCQLMG  355
            VK LE +C        S+ + C+KCL +L  L +K+ET+  S  DER SKM  RDCQLMG
Sbjct  181  VKNLEKNC------KNSTYSGCTKCLGALQKLKAKNETQDKSTRDERASKMFERDCQLMG  234

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPL---SCTLNSDGMPLAVDSSEF  202
            LTWLL +N+ +YI TVSAVLRA+M ST+   P+    C+ + + MPLAVDS +F
Sbjct  235  LTWLLARNKTQYIPTVSAVLRAIMYSTH--PPVHESKCSPDQENMPLAVDSLQF  286



>ref|XP_011047484.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
 ref|XP_011047485.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
Length=322

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 113/172 (66%), Gaps = 12/172 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL +K ++L +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  121  CVNSLQSALLSKNVKLAQPNASCDAILCFCGIRLHQISSLSCPAAFNVSSAFHNATPTAA  180

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL-SKSETRSTSKSDERGSKMRSRDCQLMG  355
            VK LE +C        S+ + C+KCL +L  L +K+ET+  S  DER SKM  RDCQLMG
Sbjct  181  VKNLEKNC------KNSTYSGCTKCLGALQKLKAKNETQDKSTRDERASKMFERDCQLMG  234

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLS-CTLNSDGMPLAVDSSEF  202
            LTWLL +N+  YI TVSAVLRA+M ST+     S C+ + + MPLAVDS +F
Sbjct  235  LTWLLARNKTEYIPTVSAVLRAIMYSTHPPVHKSKCSPDQENMPLAVDSLQF  286



>ref|XP_002518003.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44521.1| conserved hypothetical protein [Ricinus communis]
Length=318

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 125/198 (63%), Gaps = 12/198 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL ++ +++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  122  CVNSLQSALLSRNVKIPQPNASCDAILCFCGIRLHQITSLSCPAAFNVSSGFHNATPTAA  181

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKS-ETRSTSKSDERGSKMRSRDCQLMG  355
            VK LE +C        SS + C+KCL +L  L  S +T +    D+R +KM +RDCQLMG
Sbjct  182  VKNLEKNC------KNSSYSGCTKCLGALQKLKGSNKTVTGGGRDDRANKMFNRDCQLMG  235

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYD-QSSSFT  178
            LTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS  F + QS S +
Sbjct  236  LTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLHFGNAQSYSTS  295

Query  177  LQISHYTYIIVPLLLLYI  124
            L  S + + ++P+++L +
Sbjct  296  LSRSLFGFPVLPIIILVL  313



>gb|KJB50064.1| hypothetical protein B456_008G151300 [Gossypium raimondii]
Length=319

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 123/199 (62%), Gaps = 17/199 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ AL +K +++ +PN +CD + C+CGIRLH    LSCP AFS++         +V
Sbjct  124  CVNSLQNALLSKRVQIPQPNASCDPILCFCGIRLHQISSLSCPAAFSVSGFQNATPTAAV  183

Query  528  KRLETDCFsssangysslascSKCLNSLYLL----SKSETRSTSKSDERGSKMRSRDCQL  361
            K LE  C        SS A C+KCL +L  L    SK+ T+  S S ER SKM +RDCQL
Sbjct  184  KNLERSC------TNSSYAGCTKCLGALQRLKGGYSKNGTQDGSTS-ERASKMFNRDCQL  236

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL +N+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +     SS 
Sbjct  237  MGLTWLLARNKTAYIPTVSAVLRAIMYSAHPHE-SRCSPDQENMPLAVDSLQLEKAQSSA  295

Query  180  TLQIS--HYTYIIVPLLLL  130
            +   S   +T+ I+PL++L
Sbjct  296  SPPPSWQSFTFPILPLIIL  314



>ref|XP_010268888.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
 ref|XP_010268889.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Nelumbo nucifera]
Length=323

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 105/169 (62%), Gaps = 9/169 (5%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +  N+ I + +PN TCD + C+CGIRLH    LSCP AF++ S+       +V
Sbjct  122  CVNSLQSSFQNRNIHIPQPNSTCDAILCFCGIRLHQISSLSCPAAFNVTSYRNATPTAAV  181

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            K LE +C        SS A C+KCL +L  L       T ++ +R SKM  RDCQLMGLT
Sbjct  182  KNLEQNC------RNSSYAGCTKCLGALEKLKGDGKNGTGENSDRVSKMLGRDCQLMGLT  235

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            WLL +N+  YI TVSAVLRA++ S +     +C+ + + MPLAVDS +F
Sbjct  236  WLLARNKTAYIPTVSAVLRAILYSAHPPHQSTCSPDQENMPLAVDSLQF  284



>ref|XP_004293470.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 111/184 (60%), Gaps = 16/184 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L ++ I + +PN TCD + C+CGIRLH    LSCP AF++          +V
Sbjct  124  CVNSLQTSLLSRNIRIPQPNATCDAILCFCGIRLHQISSLSCPAAFNVTGFHNATPTAAV  183

Query  528  KRLETDCFsssangysslascSKCLNSLYLL------SKSETRSTSKS-DERGSKMRSRD  370
            K LE +C        SS   C+KCL +L  L       K+ T +  KS  ER SKM +RD
Sbjct  184  KNLEKNC------RNSSYTGCTKCLGALQKLKGGTTSGKNGTTTRDKSTSERASKMFNRD  237

Query  369  CQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQS  190
            CQLMGLTWLL KN+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS +F   S
Sbjct  238  CQLMGLTWLLAKNKTAYIPTVSAVLRAIMYSAHPPHESTCSPDQENMPLAVDSLQFETSS  297

Query  189  SSFT  178
            SS T
Sbjct  298  SSAT  301



>ref|XP_008448226.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis melo]
Length=303

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 117/202 (58%), Gaps = 17/202 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L  + I + +PN +CD V C+CGIRLH    LSCP AF+++         +V
Sbjct  108  CVESLQSSLVRRNIRIPQPNSSCDAVLCFCGIRLHQISSLSCPAAFNLSGFQNASPTTAV  167

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            + LET+C        +S + C+KCL +L  +  +  RST+    R  KM +RDCQLMGLT
Sbjct  168  RDLETNC------RNASYSGCTKCLGALQKVKGAGDRSTTA---RARKMFNRDCQLMGLT  218

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYD-----QSSS  184
            WLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F D      S  
Sbjct  219  WLLARNKTAYIPTVSAVLRAIMYSAHLPHNSMCSPDQENMPLAVDSLQFDDAHSISHSQP  278

Query  183  FTLQISHYTYIIVPLLLLYISK  118
                 S +  ++ P + L++ K
Sbjct  279  SIFMFSFFRLVLTPFVCLFLVK  300



>ref|XP_010095855.1| hypothetical protein L484_022212 [Morus notabilis]
 gb|EXB62323.1| hypothetical protein L484_022212 [Morus notabilis]
Length=325

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 117/194 (60%), Gaps = 12/194 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L ++ I + +PN +CD + C+CGIRLH    LSCP AF+++         +V
Sbjct  135  CVNSLQSSLLSRNIRIPQPNASCDAILCFCGIRLHQITSLSCPAAFNVSGFHNATPTAAV  194

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMRSRDCQLMGL  352
            + LE +C        SS + C++CL +L  L       T  S  ER SKM +RDCQLMGL
Sbjct  195  RNLERNC------RNSSYSGCTRCLGALQKLKGGFKNGTENSQSERASKMFNRDCQLMGL  248

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    +S +L 
Sbjct  249  TWLLARNKTAYIPTVSAVLRAIMYSAHPPHQSRCSPDQENMPLAVDSLQFEKAQASSSL-  307

Query  171  ISHYTYIIVPLLLL  130
             S + +  +PL++L
Sbjct  308  -STFLFPFLPLIIL  320



>ref|XP_009777833.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Nicotiana 
sylvestris]
Length=318

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 122/200 (61%), Gaps = 16/200 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV++L+ +L ++ I L +PN +CD V C+CGIRLH    LSCP AF++          +V
Sbjct  119  CVNTLQNSLQSRNIHLPQPNGSCDAVLCFCGIRLHQITSLSCPAAFNLTGSKNATPTAAV  178

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK----SDERGSKMRSRDCQL  361
            + LE +C        SS + C++CL +L  L+      T K    S +R SKM SRDCQL
Sbjct  179  RNLERNC------RNSSYSGCTRCLGALQKLNGDGKNRTHKMADTSGDRVSKMLSRDCQL  232

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQ-SSS  184
            MGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F  + SSS
Sbjct  233  MGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFEKRDSSS  292

Query  183  FTLQISHYT--YIIVPLLLL  130
             + ++S +T  +  +PL++L
Sbjct  293  PSNRVSRFTSLFPFLPLIIL  312



>gb|KDO55798.1| hypothetical protein CISIN_1g020738mg [Citrus sinensis]
Length=322

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 109/171 (64%), Gaps = 11/171 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL +K +++ +PN +CD + C+CGIRLH    LSCP AF++ +    +    +
Sbjct  124  CVNSLQSALVSKNVKIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVTAGFRNVTPTAA  183

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK-SDERGSKMRSRDCQLMG  355
            VK LE +C        SS + C+KCL +L +L       T++  D R SKM SRDCQLMG
Sbjct  184  VKNLEKNC------RNSSYSGCTKCLGALQMLKGGSKNGTAEHEDNRASKMFSRDCQLMG  237

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            LTWLL +N+  YI TVSAVLRA+M S++      C+ + + MPLAVDS +F
Sbjct  238  LTWLLARNKTAYIPTVSAVLRAIMYSSHPPHESKCSPDQENMPLAVDSLQF  288



>ref|XP_008230199.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Prunus 
mume]
Length=324

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 16/198 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAF--SMNSHGELVGHQ  535
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF  S+  H       
Sbjct  130  CVNSLQSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNVSLGFHNA-TPTA  188

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQ  364
            +VK LE +C        SS + C+KCL +L  L   SK+ T     + +R SKM +RDCQ
Sbjct  189  AVKNLEKNC------RNSSYSGCTKCLGALQKLKGGSKNGTAGDKSTSDRASKMFNRDCQ  242

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS +F D++ +
Sbjct  243  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESTCSPDQENMPLAVDSLQF-DKAQA  301

Query  183  FTLQISHYTYIIVPLLLL  130
                 S   + I+PL++L
Sbjct  302  PASSPSILLFPILPLIIL  319



>gb|KDP24204.1| hypothetical protein JCGZ_25861 [Jatropha curcas]
Length=316

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 125/195 (64%), Gaps = 15/195 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL NK +++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  126  CVNSLQSALLNKNVKIPQPNASCDPILCFCGIRLHQISSLSCPAAFNVSSGFHNATPTAA  185

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            V+ LE +C        SS A C+KCL +L  L K+ET    + D+R SKM +RDCQLMGL
Sbjct  186  VRNLEKNC------KNSSYAGCTKCLGALQKL-KNET---GERDDRASKMFNRDCQLMGL  235

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYD-QSSSFTL  175
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F   +S S +L
Sbjct  236  TWLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFEKAESGSSSL  295

Query  174  QISHYTYIIVPLLLL  130
              S + Y ++P+++L
Sbjct  296  SWSAFGYRVLPIIIL  310



>ref|XP_011048474.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Populus euphratica]
Length=318

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 127/202 (63%), Gaps = 20/202 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL  K ++L +PN +CD + C+CGIRLH    +SCP AF+++S         +
Sbjct  121  CVNSLQSALLTKNVKLPQPNASCDAILCFCGIRLHHISSISCPAAFNVSSGFHNATPTAA  180

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL-SKSETRSTSKSDERGSKMRSRDCQLMG  355
            V  LE +C        SS A C+KCL +L  L +K+ T+  S  DER SKM +RDCQLMG
Sbjct  181  VTNLEKNC------KNSSYAGCTKCLGALQKLKAKNGTQEKSTRDERASKMFNRDCQLMG  234

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPL---SCTLNSDGMPLAVDSSEFYDQSSS  184
            LTWLL +N+  YI TVSAVLRA+M ST+   P+    C+ + + MPLAVDS +F    SS
Sbjct  235  LTWLLARNKTEYIPTVSAVLRAIMYSTH--PPVLESKCSPDQENMPLAVDSLQFEKTQSS  292

Query  183  FTLQISH----YTYIIVPLLLL  130
             + + +     + ++++PL++L
Sbjct  293  SSSRSTSSWPGFCFLVLPLMIL  314



>ref|XP_007215670.1| hypothetical protein PRUPE_ppa008626mg [Prunus persica]
 gb|EMJ16869.1| hypothetical protein PRUPE_ppa008626mg [Prunus persica]
Length=324

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 14/197 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN-SHGELVGHQS  532
            CV+SL+ +L  + I + +PN +CD V C+CGIRLH    LSCP AF+++          +
Sbjct  130  CVNSLQSSLVGRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNLSLGFHNATPTAA  189

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQL  361
            VK LE +C        SS + C+KCL +L  L   SK+ T     + +R SKM +RDCQL
Sbjct  190  VKNLEKNC------RNSSYSGCTKCLGALQKLKGGSKNGTAGDKSTSDRASKMFNRDCQL  243

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS +F D+  + 
Sbjct  244  MGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESTCSPDQENMPLAVDSLQF-DKGQAP  302

Query  180  TLQISHYTYIIVPLLLL  130
                S   + I+PL++L
Sbjct  303  ASSPSILLFPILPLIIL  319



>ref|XP_004139964.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
 ref|XP_004154532.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
 gb|KGN46678.1| hypothetical protein Csa_6G121950 [Cucumis sativus]
Length=304

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 117/203 (58%), Gaps = 18/203 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L  + I + +PN +CD V C+CGIRLH    LSCP AF+++         +V
Sbjct  108  CVESLQSSLVRRNIRIPQPNSSCDAVLCFCGIRLHQISSLSCPAAFNLSGFQNASPTAAV  167

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            + LET+C        +S + C+KCL +L  +  +  RST+    R  KM +RDCQLMGLT
Sbjct  168  RDLETNC------RNASYSGCTKCLGALQKVKGAGDRSTTA---RARKMFNRDCQLMGLT  218

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSS------  187
            WLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F D  S      
Sbjct  219  WLLARNKTAYIPTVSAVLRAIMYSAHPPHNSMCSPDQENMPLAVDSLQFDDAHSISHSQP  278

Query  186  SFTLQISHYTYIIVPLLLLYISK  118
            S     S    ++ P + L++ K
Sbjct  279  SSIFIFSFLRLLLTPFVCLFLVK  301



>gb|EYU24846.1| hypothetical protein MIMGU_mgv1a013501mg [Erythranthe guttata]
Length=218

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 123/212 (58%), Gaps = 27/212 (13%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++  +        +
Sbjct  9    CVNSLQSSLTSRNIHIPQPNASCDAVLCFCGIRLHQITSLSCPAAFNVTGNTRNATPTAA  68

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL---SKSETRS---TSKSDERGSKMRSRD  370
            V+ LE +C        SS A C+KCL +L  L    K+ T+     S   +R SKM SRD
Sbjct  69   VRNLERNC------RNSSYAGCTKCLGALQKLKVDGKNGTKGGIEQSDGGDRASKMLSRD  122

Query  369  CQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF--YD  196
            CQLMGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS +F  YD
Sbjct  123  CQLMGLTWLLARNKTAYIPTVSAVLRAVMYSAHPPHESTCSPDQENMPLAVDSLQFDKYD  182

Query  195  QSSS---------FTLQISHYTYIIVPLLLLY  127
             SSS           L I  Y ++I PL + +
Sbjct  183  SSSSALTTSFIPFLPLIILSYLFLIGPLYISW  214



>ref|XP_009596251.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Nicotiana 
tomentosiformis]
Length=318

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 122/200 (61%), Gaps = 16/200 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV++L+ +L ++ I L +PN +CD V C+CGIRLH    LSCP AF++          +V
Sbjct  119  CVNTLQSSLQSRNIHLPQPNTSCDAVLCFCGIRLHQITSLSCPAAFNLTGSKNATPTAAV  178

Query  528  KRLETDCFsssangysslascSKCLNSLYLL-SKSETRSTSKSD---ERGSKMRSRDCQL  361
            + LE +C        SS + C++CL +L  L S  + R+   +D   +R SKM SRDCQL
Sbjct  179  RNLERNC------RNSSYSGCTRCLGALQKLNSDGKNRTHKMADTGGDRVSKMLSRDCQL  232

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYD-QSSS  184
            MGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SSS
Sbjct  233  MGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFEKTDSSS  292

Query  183  FTLQISHYT--YIIVPLLLL  130
             ++ +S +   +  +PL++L
Sbjct  293  PSIGVSRFASLFPFLPLIIL  312



>ref|XP_002319388.2| hypothetical protein POPTR_0013s14490g [Populus trichocarpa]
 gb|EEE95311.2| hypothetical protein POPTR_0013s14490g [Populus trichocarpa]
Length=316

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 127/201 (63%), Gaps = 20/201 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL +K ++L +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  121  CVNSLQSALLSKNVKLPQPNASCDAILCFCGIRLHHISSLSCPAAFNVSSGFHNATPTAA  180

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            V  LE +C        SS A C+KCL +L   +K+ T+  S  DER SKM +RDCQLMGL
Sbjct  181  VTNLEKNC------KNSSYAGCTKCLGALQK-AKNGTQDRSTRDERASKMFNRDCQLMGL  233

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPL---SCTLNSDGMPLAVDSSEFYDQSSSF  181
            TWLL +N+  YI TVSAVLRA+M ST+   P+    C+ + + MPLAVDS +F    SS 
Sbjct  234  TWLLARNKTEYIPTVSAVLRAIMYSTH--PPVLESKCSPDQENMPLAVDSLQFEKTQSSS  291

Query  180  TLQISH----YTYIIVPLLLL  130
            + + +     + ++++PL++L
Sbjct  292  SSRSTSSWPGFCFLVLPLMIL  312



>ref|XP_004243303.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Solanum 
lycopersicum]
Length=318

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 123/202 (61%), Gaps = 19/202 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV++L+ +L ++ I L +PN TCD V C+CGIRLH    LSCP AF++          +V
Sbjct  122  CVNTLQNSLQSRNIHLPQPNGTCDAVLCFCGIRLHQITSLSCPAAFNLTGSKNATPTAAV  181

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRS-TSKSD----ERGSKMRSRDCQ  364
            + LE +C        SS + C++CL +L+ L+    ++ T K D    +R SKM SRDCQ
Sbjct  182  RNLEKNC------RNSSYSGCTRCLGALHKLNGDGGKNRTHKWDVTGGDRVSKMLSRDCQ  235

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF--YDQS  190
            LMGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F   D S
Sbjct  236  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFDKTDSS  295

Query  189  SSFTLQISHYT--YIIVPLLLL  130
            S F + +S +   +  +PL++L
Sbjct  296  SPF-VGVSGFVILFTFLPLIIL  316



>ref|XP_006366939.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Solanum tuberosum]
Length=318

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 122/201 (61%), Gaps = 17/201 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV++L+ +L ++ I L +PN TCD V C+CGIRLH    LSCP AF++          +V
Sbjct  122  CVNTLQNSLQSRNIHLPQPNGTCDAVLCFCGIRLHQITSLSCPAAFNLTGSKNATPTAAV  181

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRS-TSKSD----ERGSKMRSRDCQ  364
            + LE +C        SS + C++CL +L  L+    ++ T K D    +R SKM SRDCQ
Sbjct  182  RNLERNC------RNSSYSGCTRCLGALQKLNGDGGKNRTHKMDVTGGDRVSKMLSRDCQ  235

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF-YDQSS  187
            LMGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F  + SS
Sbjct  236  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESKCSPDQENMPLAVDSLQFEKNDSS  295

Query  186  SFTLQISHYT--YIIVPLLLL  130
            S  + +S +   +  +PL++L
Sbjct  296  SPFVGVSGFAILFTFLPLIIL  316



>ref|XP_006447405.1| hypothetical protein CICLE_v10015940mg [Citrus clementina]
 ref|XP_006469818.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Citrus sinensis]
 gb|ESR60645.1| hypothetical protein CICLE_v10015940mg [Citrus clementina]
Length=322

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 108/171 (63%), Gaps = 11/171 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL +K +++ +PN +CD + C+CGIRLH    LSCP AF++ +    +    +
Sbjct  124  CVNSLQSALVSKNVKIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVTAGFRNVTPTAA  183

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK-SDERGSKMRSRDCQLMG  355
            VK LE +C        SS + C+KCL +L  L       T++  D R SKM SRDCQLMG
Sbjct  184  VKNLEKNC------RNSSYSGCTKCLGALQKLKGGSKNGTAEHEDNRASKMFSRDCQLMG  237

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            LTWLL +N+  YI TVSAVLRA+M S++      C+ + + MPLAVDS +F
Sbjct  238  LTWLLARNKTAYIPTVSAVLRAIMYSSHPPHESKCSPDQENMPLAVDSLQF  288



>ref|XP_009417269.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=348

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 111/195 (57%), Gaps = 21/195 (11%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSM----NSHGELVG  541
            CVDSL+ AL  + I L +PN TCD V CYCGIRLH    L CP AF++    N+   +  
Sbjct  134  CVDSLQSALERRDIRLPRPNATCDTVLCYCGIRLHQIGSLRCPTAFNVSGGANAARNVTP  193

Query  540  HQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQL  361
              SV++LE DC        +S A C++CL+SL  L ++       + +R +KM  RDCQL
Sbjct  194  TASVRQLERDC------RNASYAGCNRCLHSLEKLKETGGGVGGDNGDRATKMLGRDCQL  247

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMS--------TNGSDPLSCTLNSDGMPLAVDSSE  205
            MGLTWLL +N+  YI TVSAVLRA++ S        + G     C+ + + MPLAVDS +
Sbjct  248  MGLTWLLARNKTAYIPTVSAVLRAVLYSAHPPQADGSGGGSGYKCSPDQENMPLAVDSLQ  307

Query  204  FYDQSSSFTLQISHY  160
            F  Q  S     + Y
Sbjct  308  FPHQPDSAAAAATTY  322



>ref|XP_010689311.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Beta 
vulgaris subsp. vulgaris]
Length=327

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 115/204 (56%), Gaps = 20/204 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN-SHGELVGHQS  532
            CV+SL+ +L  + I L +PN TCD V C+CGIRLH    LSCP AF++  S+       +
Sbjct  128  CVNSLQNSLSKRNITLPQPNNTCDTVLCFCGIRLHQIASLSCPAAFNLTLSYRNATPTAN  187

Query  531  VKRLETDCFsssangysslascSKCLNSL--YLLSKSETRSTSKSDERGSKMRSRDCQLM  358
            V+ LE +C        SS A C+KCL SL                  R SKM +RDCQLM
Sbjct  188  VRNLEKNC------RNSSYAGCTKCLGSLEKLKGGGKNGTKGDHGSSRVSKMFNRDCQLM  241

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSS---  187
            GLTWLL +N+  YI TVSAVLRA+M ST+      C+ + + MPLAVDS +FY  +S   
Sbjct  242  GLTWLLARNKTAYIPTVSAVLRAIMYSTHPPHQSKCSPDQENMPLAVDSLQFYRANSSAS  301

Query  186  -----SFTLQISHYTYIIVPLLLL  130
                 SF+L +  + + I+  L L
Sbjct  302  STPLISFSLLLYAFFFNIIMFLFL  325



>ref|XP_010035649.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Eucalyptus grandis]
 gb|KCW47091.1| hypothetical protein EUGRSUZ_K00897 [Eucalyptus grandis]
Length=313

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 106/177 (60%), Gaps = 11/177 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSH-GELVGHQS  532
            CVDSL+ AL +K + L +PN +CD V C+CGIRLH    LSCP AF+++S         +
Sbjct  121  CVDSLQSALESKNVRLQQPNASCDAVLCFCGIRLHQIGSLSCPAAFNVSSGLHNATPTAA  180

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK-SDERGSKMRSRDCQLMG  355
            V+ LE +C        SS A C+KCL SL  L     + T + S ER  KM  RDCQLMG
Sbjct  181  VRNLEKNC------RNSSYAGCTKCLGSLQKLKGGYKKGTDQESSERARKMFDRDCQLMG  234

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LTWLL +N+  YI TVSAVLRALM S       +C+ + + MPLAVDS +     SS
Sbjct  235  LTWLLARNKTAYIPTVSAVLRALMYSARPPHESTCSPDHENMPLAVDSLQLEKAQSS  291



>ref|XP_006412993.1| hypothetical protein EUTSA_v10025835mg [Eutrema salsugineum]
 gb|ESQ54446.1| hypothetical protein EUTSA_v10025835mg [Eutrema salsugineum]
Length=301

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 117/193 (61%), Gaps = 14/193 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K +++ +PN TCD + C+CGIRLH    LSCP AF+++S         +
Sbjct  113  CVNTLQSALLTKHVKIPQPNSTCDAILCFCGIRLHQISSLSCPAAFNVSSGFRNATPTAA  172

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            VK LE +C        SS + C++CL +L  L K +  S   + ER SKM S+DCQLMGL
Sbjct  173  VKNLEKEC------RNSSYSGCTRCLGALQKL-KVKGGSKKTTTERASKMMSKDCQLMGL  225

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F     S +  
Sbjct  226  TWLLARNKTAYIPTVSAVLRAIMYSAHPPHLNKCSPDQENMPLAVDSLQF---QKSLSAS  282

Query  171  ISHYTYIIVPLLL  133
              +  + ++PL+L
Sbjct  283  SRYSVFPVLPLIL  295



>ref|XP_011100330.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Sesamum 
indicum]
Length=273

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 112/183 (61%), Gaps = 17/183 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSM-NSHGELVGHQS  532
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++  ++       +
Sbjct  80   CVNSLQTSLTSRNIHIPQPNASCDAVLCFCGIRLHQITSLSCPAAFTITGNYRNATPTAA  139

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERG-----SKMRSRDC  367
            V+ LE +C        SS A C+KCL +L  L       T + D+ G     SKM SRDC
Sbjct  140  VRNLEHNC------KNSSYAGCTKCLGALQKLKVEGKNGTKEKDDEGLSDRASKMLSRDC  193

Query  366  QLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF--YDQ  193
            QLMGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS +F  YD 
Sbjct  194  QLMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHESTCSPDQENMPLAVDSLQFEKYDP  253

Query  192  SSS  184
            SS+
Sbjct  254  SSA  256



>ref|XP_007149909.1| hypothetical protein PHAVU_005G109200g [Phaseolus vulgaris]
 gb|ESW21903.1| hypothetical protein PHAVU_005G109200g [Phaseolus vulgaris]
Length=303

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 123/202 (61%), Gaps = 22/202 (11%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQS-  532
            CV+SL+ +L N+ I + +PN TCD + C+CGIRLH    LSCP AF++ +   + G Q+ 
Sbjct  114  CVNSLQDSLRNRSIRIPQPNGTCDAILCFCGIRLHQITSLSCPNAFNITAVQNVSGTQNA  173

Query  531  -----VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDC  367
                 V+ LE +C        +S A C++CL +L  +  S  +  S   ER  KM  RDC
Sbjct  174  TPTAVVRNLEKNC------RNASYAGCTQCLGALQKIKGS--KKESDESERAKKMFDRDC  225

Query  366  QLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF-YDQS  190
            QLM LTWLL +N+  YI TVSAVLRA+M S +  +   C+ + D MPLAVDS +F  +Q 
Sbjct  226  QLMALTWLLGRNKTAYIPTVSAVLRAVMYSAHPHES-KCSPDQDNMPLAVDSLQFETNQG  284

Query  189  SSFTLQISHYTYIIVPLLLLYI  124
            SS  L+I    +I++ ++L+++
Sbjct  285  SSTPLRI---FWIMLLMVLVFL  303



>ref|XP_008455363.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis melo]
Length=322

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 120/197 (61%), Gaps = 18/197 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-----LV  544
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF+++  G        
Sbjct  129  CVNSLQTSLLSRNIRIPQPNASCDAVLCFCGIRLHQISSLSCPAAFNVSGGGNGGYRNAT  188

Query  543  GHQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQ  364
               +V+ LE +C        SS + C+KCL +L  ++ ++   TS  ++R SKM +RDCQ
Sbjct  189  PTAAVRNLEKNC------RNSSYSGCTKCLGALQKVTGTKKNGTS--NDRASKMFNRDCQ  240

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M + +     +C+ + + MPLAVDS +     SS
Sbjct  241  LMGLTWLLARNKTTYIPTVSAVLRAIMYTAHPPHESTCSPDQENMPLAVDSLQMEKAQSS  300

Query  183  FTLQISHYTYIIVPLLL  133
                IS +   I+PLL+
Sbjct  301  SPPSISLFP--IIPLLI  315



>ref|XP_004136804.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cucumis sativus]
 gb|KGN43572.1| hypothetical protein Csa_7G046110 [Cucumis sativus]
Length=322

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 120/197 (61%), Gaps = 19/197 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-----LV  544
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF+++  G        
Sbjct  129  CVNSLQTSLLSRNIRIPQPNASCDAVLCFCGIRLHQISSLSCPAAFNVSGGGNGAYRNAT  188

Query  543  GHQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQ  364
               +V+ LE +C        SS + C+KCL +L  ++ ++  S   S++R SKM +RDCQ
Sbjct  189  PTAAVRNLEKNC------RNSSYSGCTKCLGALQKVTGTKKNS---SNDRASKMFNRDCQ  239

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M + +     +C+ + + MPLAVDS +     SS
Sbjct  240  LMGLTWLLARNKTTYIPTVSAVLRAIMYTAHPPHQSTCSPDQENMPLAVDSLQMEKAQSS  299

Query  183  FTLQISHYTYIIVPLLL  133
                IS +   I+PLL+
Sbjct  300  SPPSISLFP--IIPLLI  314



>ref|XP_006849743.1| hypothetical protein AMTR_s00024p00248910 [Amborella trichopoda]
 gb|ERN11324.1| hypothetical protein AMTR_s00024p00248910 [Amborella trichopoda]
Length=324

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 118/203 (58%), Gaps = 26/203 (13%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH--PLSCPEAFSMNSHGELVGHQSVK  526
            CVD  E  L  KG+E+  P+++CD V CYCGIRLH  P SCPE F     G+L G   + 
Sbjct  129  CVDEFEGLLRAKGVEVKGPDESCDAVICYCGIRLHNGPGSCPELF--QEGGQLTGLPVLG  186

Query  525  RLETDCFsssangysslascSKCLNSLYLLS---KSETRSTSKSDERGSKMRSRDCQLMG  355
             +E +C          ++ CS CL SLY L    + E+ S + SDER  +M+SRDC+LMG
Sbjct  187  EMEEEC------RRPGVSGCSSCLRSLYQLKGSEERESESEASSDERKRRMKSRDCELMG  240

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS---  184
            LTWLL KN+  Y  TV+AV RA M S++G +PLSC    +  PLAVDS +  DQ+SS   
Sbjct  241  LTWLLAKNKTAYFPTVTAVFRAFMASSDGQEPLSCR---EEQPLAVDSVQL-DQASSSPS  296

Query  183  ------FTLQISHYTYIIVPLLL  133
                  F+L +   +Y    LLL
Sbjct  297  SHQYTLFSLSLKPISYWAFVLLL  319



>emb|CDP11898.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 105/173 (61%), Gaps = 13/173 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++          +V
Sbjct  132  CVNSLQSSLLSRNIHIPQPNGSCDPVLCFCGIRLHQITSLSCPAAFNLTGSRNATPTAAV  191

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD----ERGSKMRSRDCQL  361
            K LE +C +SS  G +      KCL +L  L+      T K D    +R SKM SRDCQL
Sbjct  192  KNLEKNCHNSSYAGCT------KCLGALQKLNGEVKNGTQKMDVEDGDRASKMLSRDCQL  245

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            MGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAV+S +F
Sbjct  246  MGLTWLLARNKTAYIPTVSAVLRAVMYSAHPPHDAKCSPDQENMPLAVNSLQF  298



>gb|KHG17779.1| hypothetical protein F383_20781 [Gossypium arboreum]
Length=325

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 124/205 (60%), Gaps = 23/205 (11%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQ--  535
            CV+SL+ AL +K +++ +PN +CD + C+CGIRLH    LSCP AF+  +   + G +  
Sbjct  124  CVNSLQNALLSKRVQIPQPNASCDPILCFCGIRLHQISSLSCPAAFNGPAAFNVSGFRNA  183

Query  534  ----SVKRLETDCFsssangysslascSKCLNSLYLL----SKSETRSTSKSDERGSKMR  379
                +VK LE  C        SS A C+KCL +L  L    SK+ T+  S S ER SKM 
Sbjct  184  TPTAAVKNLERSC------TNSSYAGCTKCLGALQRLKGGHSKNGTQDRSTS-ERASKMF  236

Query  378  SRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFY  199
            +RDCQLMGLTWLL +N+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +  
Sbjct  237  NRDCQLMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPHE-SRCSPDQENMPLAVDSLQLE  295

Query  198  DQSSSFTLQIS--HYTYIIVPLLLL  130
               SS +   S   +T+  +PL++L
Sbjct  296  KAQSSASPPPSWQSFTFPTLPLIIL  320



>ref|XP_010438502.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X1 [Camelina sativa]
 ref|XP_010438503.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X2 [Camelina sativa]
Length=305

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQTALLTKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           ++ S C   L  L K + R  +K  + ERGSKM S+DCQLM
Sbjct  174  VKNLEKEC---------RNSTYSGCTRCLGALQKLKVRGGNKKTTTERGSKMMSKDCQLM  224

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SS
Sbjct  225  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQRSLSS  282



>ref|XP_006284191.1| hypothetical protein CARUB_v10005339mg [Capsella rubella]
 gb|EOA17089.1| hypothetical protein CARUB_v10005339mg [Capsella rubella]
Length=304

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQSALLTKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           +S S C   L  L K + R  +K  + ERGSKM S+DCQLM
Sbjct  174  VKNLEKEC---------RNSSYSGCTRCLGALQKLKVRGGNKKTTTERGSKMMSKDCQLM  224

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SS
Sbjct  225  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQRSLSS  282



>ref|XP_006841867.1| hypothetical protein AMTR_s00003p00271650 [Amborella trichopoda]
 gb|ERN03542.1| hypothetical protein AMTR_s00003p00271650 [Amborella trichopoda]
Length=327

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 111/188 (59%), Gaps = 19/188 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG----ELVG  541
            CVD+L+ +L  + I + +PN+TCD V C+CGIRLH    LSCP+AF++ S G        
Sbjct  121  CVDTLQTSLIKRDIRIPQPNETCDAVLCFCGIRLHQMSSLSCPKAFNLTSLGSGFRNATP  180

Query  540  HQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD--ERGSKMRSRDC  367
              +VK LET C           +S   C N L  L K +   +   +  ER  +M +RDC
Sbjct  181  TAAVKDLETSC---------RNSSYDGCTNCLKALDKVKGSDSGPKEGGERAKRMFNRDC  231

Query  366  QLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF-YDQS  190
            QLMGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAV+S +F   ++
Sbjct  232  QLMGLTWLLARNKTTYIPTVSAVLRAIMYSAHPPHQSTCSPDQENMPLAVNSLQFQMSEA  291

Query  189  SSFTLQIS  166
            SS + QI+
Sbjct  292  SSASKQIA  299



>ref|XP_010448030.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Camelina sativa]
Length=305

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  115  CVNTLQTALLTKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  174

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           ++ S C   L  L K + R  +K  + ERGSKM S+DCQLM
Sbjct  175  VKNLEKEC---------RNSTYSGCTRCLGALQKLKVRGGNKKTTTERGSKMMSKDCQLM  225

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SS
Sbjct  226  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQRSLSS  283



>ref|XP_010433261.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Camelina 
sativa]
Length=304

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQTALLTKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           ++ S C   L  L K + R  +K  + ERGSKM S+DCQLM
Sbjct  174  VKNLEKEC---------RNSTYSGCTRCLGALQKLKVRGGNKRTTTERGSKMMSKDCQLM  224

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SS
Sbjct  225  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQRSLSS  282



>ref|XP_002867466.1| hypothetical protein ARALYDRAFT_491965 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43725.1| hypothetical protein ARALYDRAFT_491965 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 115/198 (58%), Gaps = 20/198 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQSALLIKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           +S S C   L  L K   R  +K  + ERGSKM S+DC+LM
Sbjct  174  VKNLEKEC---------RNSSYSGCTRCLGALQKLNVRGGNKKTTTERGSKMMSKDCKLM  224

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFT  178
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SS  
Sbjct  225  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFERSLSS--  282

Query  177  LQISHYTYIIVPLLLLYI  124
               S + + ++P L L +
Sbjct  283  ---SSHLFGVLPFLPLVL  297



>gb|KHG07118.1| hypothetical protein F383_33082 [Gossypium arboreum]
Length=325

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 123/201 (61%), Gaps = 19/201 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CV+SL+ AL +K + + +PN +CD + C+CGIRLH    LSCP AF+++ H        +
Sbjct  128  CVNSLQDALLSKRVRIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVSGHHRNATPTAA  187

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL----SKSETRSTSKSDERGSKMRSRDCQ  364
            VK LE +C        S+ A C+KCL +L  L    +K+ T+  S +D R SKM +RDCQ
Sbjct  188  VKNLEKNC------RNSTYAGCTKCLGALQKLKGGYNKNGTQDKSTTD-RASKMFNRDCQ  240

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F    SS
Sbjct  241  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPHE-SKCSPDQENMPLAVDSLQFEKAQSS  299

Query  183  FTLQI---SHYTYIIVPLLLL  130
                    + +T+ ++P ++L
Sbjct  300  SPKSPPSWASFTFPVLPPVIL  320



>gb|AAM65702.1| unknown [Arabidopsis thaliana]
Length=304

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 105/172 (61%), Gaps = 15/172 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQSALLTKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           +S S C   L  L K + R  +K  + ERG+KM S+DCQLM
Sbjct  174  VKNLEKEC---------RNSSYSGCTRCLGALQKLKVRGGNKKTTTERGTKMMSKDCQLM  224

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F
Sbjct  225  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQF  276



>gb|KFK29337.1| hypothetical protein AALP_AA7G120700 [Arabis alpina]
Length=302

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 114/190 (60%), Gaps = 14/190 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K +++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  111  CVNTLQSALLTKHVKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFRNATPTAA  170

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            VK LE +C        SS + C++CL +L  L K +      + ER SKM SRDCQLMGL
Sbjct  171  VKNLEKEC------RNSSYSGCTRCLGALQKL-KVKGGYKKTTTERASKMMSRDCQLMGL  223

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F    SS +L 
Sbjct  224  TWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQKSLSSSSL-  282

Query  171  ISHYTYIIVP  142
               Y +  +P
Sbjct  283  --FYRFPFLP  290



>ref|NP_567797.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SUC9.1|UGPI7_ARATH RecName: Full=Uncharacterized GPI-anchored protein At4g28100; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB36779.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79612.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43037.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 dbj|BAD43484.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEE85441.1| uncharacterized protein AT4G28100 [Arabidopsis thaliana]
Length=304

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 105/172 (61%), Gaps = 15/172 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +PN +CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQSALLTKQIKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNVSSGFKNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK--SDERGSKMRSRDCQLM  358
            VK LE +C           +S S C   L  L K + R  +K  + ERG+KM S+DCQLM
Sbjct  174  VKNLEKEC---------RNSSYSGCTRCLGALQKLKVRGGNKKTTTERGTKMMSKDCQLM  224

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            GLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F
Sbjct  225  GLTWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQF  276



>ref|XP_009144190.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Brassica 
rapa]
Length=302

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 117/195 (60%), Gaps = 18/195 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +P+  CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQSALLTKHIKIPQPSPNCDAILCFCGIRLHQISSLSCPAAFNVSSGFRNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            VK LE +C        SS + C++CL +L  L K +  S   + ER SKM S+DCQLMGL
Sbjct  174  VKNLEKEC------RNSSYSGCTRCLGALQKL-KVKGGSKKTTTERASKMMSKDCQLMGL  226

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F       +L 
Sbjct  227  TWLLARNKTTYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQR-----SLA  281

Query  171  ISHY--TYIIVPLLL  133
             S Y   + ++PLLL
Sbjct  282  ASSYFSVFPVLPLLL  296



>ref|XP_008379580.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=330

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 116/197 (59%), Gaps = 15/197 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG--ELVGHQ  535
            CV+SL+ +L N+ I + +PN +CD V C+CGIRLH    LSCP AF++ S G        
Sbjct  135  CVNSLQSSLVNRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNV-SQGFHNATPTA  193

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQ  364
            +++ LE +C        SS + C+KCL ++  L   SK+ T     + ER +KM +RDCQ
Sbjct  194  ALRNLEKNC------RNSSYSGCTKCLGAVQKLKGGSKNGTAGDRSTSERANKMFNRDCQ  247

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +       
Sbjct  248  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHENMCSPDQENMPLAVDSLQIEKGQGF  307

Query  183  FTLQISHYTYIIVPLLL  133
             T   S   + I+PL++
Sbjct  308  ATSSPSILLFPILPLII  324



>gb|KJB31741.1| hypothetical protein B456_005G206400 [Gossypium raimondii]
Length=325

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 123/201 (61%), Gaps = 19/201 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CV+SL+ +L +K + + +PN +CD + C+CGIRLH    LSCP AF+++ H        +
Sbjct  128  CVNSLQDSLLSKRVRIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVSGHHRNATPTAA  187

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL----SKSETRSTSKSDERGSKMRSRDCQ  364
            VK LE +C        S+ A C+KCL +L  L    +K+ T+  S +D R SKM +RDCQ
Sbjct  188  VKNLEKNC------RNSTYAGCTKCLGALQKLKGGYNKNGTQDKSTTD-RASKMFNRDCQ  240

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F    SS
Sbjct  241  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPHE-SKCSPDQENMPLAVDSLQFEKAQSS  299

Query  183  FTLQI---SHYTYIIVPLLLL  130
                    + +T+ ++P ++L
Sbjct  300  SPKSPPSWASFTFPVLPPIIL  320



>emb|CDY19004.1| BnaC01g20640D [Brassica napus]
Length=302

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 118/196 (60%), Gaps = 20/196 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV++L+ AL  K I++ +P+  CD + C+CGIRLH    LSCP AF+++S         +
Sbjct  114  CVNTLQSALLTKHIKIPQPSPNCDAILCFCGIRLHQISSLSCPAAFNVSSGFRNATPTAA  173

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            VK LE +C        SS + C++CL +L  L K +  S   + ER SKM S+DCQLMGL
Sbjct  174  VKNLEKEC------RNSSYSGCTRCLGALQKL-KVKGGSKKTTTERASKMMSKDCQLMGL  226

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF---YDQSSSF  181
            TWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +F      SS F
Sbjct  227  TWLLARNKTAYIPTVSAVLRAIMYSPHPPHLNKCSPDQENMPLAVDSLQFQRSLAASSRF  286

Query  180  TLQISHYTYIIVPLLL  133
            ++      + ++PL+L
Sbjct  287  SV------FPVLPLIL  296



>ref|XP_010540855.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Tarenaya 
hassleriana]
Length=290

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 102/165 (62%), Gaps = 15/165 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CV+SL+ AL  K +++ +PN +CD + C+CGIRLH    LSCP AF+ N+        +V
Sbjct  110  CVNSLQSALLTKQVKIPQPNSSCDAILCFCGIRLHQISSLSCPAAFNHNA----TPTAAV  165

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            K LE +C        SS A C++CL +L  +     +  S   ERG KM SRDCQLMGLT
Sbjct  166  KNLEKEC------RNSSYAGCTRCLGALQKVKGGYKKGGSGETERGRKMMSRDCQLMGLT  219

Query  348  WLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVD  214
            WLL +N+  YI TVSAVLRA+M S +     SC+ + + MPLAVD
Sbjct  220  WLLARNKTAYIPTVSAVLRAVMYSAHPHS--SCSPDQENMPLAVD  262



>ref|XP_009403933.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 106/183 (58%), Gaps = 13/183 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMN-SHGELV-GHQSVK  526
            C+  +E+AL + G++L + N TCD  YCYCG+RL  L+C  AF  + + G  V    + +
Sbjct  141  CIGGVERALRDHGVDLPRVNGTCDAAYCYCGVRLRRLACAGAFVADAAEGRWVPAGDAGR  200

Query  525  RLETDCFsssangysslascSKCLNSLYLLSKSETR---STSKSDERGSKMRSRDCQLMG  355
            RLE DC           A C++CL SL  L   E R   + +K D++    + R+CQLMG
Sbjct  201  RLERDC------SRFGFAGCTRCLRSLNQLKSEEKRGIGNATKWDKKAGPTQDRECQLMG  254

Query  354  LTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            +TWLL+KNR  ++   ++VLR LM +    G DP SCTL+ D MPLAV S +   +  S 
Sbjct  255  VTWLLSKNRTHFLPAATSVLRVLMAADGVGGPDPTSCTLSLDDMPLAVGSDQIDSRGGSS  314

Query  180  TLQ  172
            T++
Sbjct  315  TVR  317



>ref|XP_003560098.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Brachypodium 
distachyon]
Length=342

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 107/194 (55%), Gaps = 28/194 (14%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQSV  529
            CVDSL  AL  +G+ + +PN TCD+V C+CGIRLH    L CP AF++  +       +V
Sbjct  129  CVDSLGAALEKRGVAMPRPNATCDMVLCFCGIRLHQIGSLRCPAAFAVAKNATPTA--AV  186

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            K LE  C        +S A CS+C+ +L  +  + +R  +   ER  +M   DCQLMGLT
Sbjct  187  KDLEKSC------RDASYAGCSRCVQALQKVKGNVSREANGGGERARRMLGLDCQLMGLT  240

Query  348  WLLNKNRARYIHTVSAVLRALMMS-----------------TNGSDPLSCTLNSDGMPLA  220
            WLL KN+  YI TVSAVLRA++ S                 +N   P  C+ + + MPLA
Sbjct  241  WLLAKNKTAYIPTVSAVLRAMLYSAHPTESGSGHSSRVSGGSNAPPPPKCSPDQENMPLA  300

Query  219  VDSSEFYDQSSSFT  178
            VDS +F   SS+ +
Sbjct  301  VDSLQFEHASSTAS  314



>ref|XP_008782391.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
 ref|XP_008782392.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=333

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 107/186 (58%), Gaps = 11/186 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            C+  +E+AL ++G+ L + N TCD  YCYCGIRL  L+C    S      +    + +RL
Sbjct  136  CIGGVERALRDRGVRLPRVNGTCDAAYCYCGIRLRRLTCAGGASGAEGRWVPPGDAARRL  195

Query  519  ETDCFsssangysslascSKCLNSL-YLLSKSETRSTSKS-DERGSKMRSRDCQLMGLTW  346
              DC          LA CS+CL +L +L SK E      S  +R    R+R+CQLMG+TW
Sbjct  196  ARDC------SRPGLAGCSRCLRTLNHLKSKVEKGGNGTSVGKREGGTRNRECQLMGVTW  249

Query  345  LLNKNRARYIHTVSAVLRALMMS---TNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTL  175
            LL+KNR  Y+  V++VLRALM +      SDP SC+L  D MPLAVDS++   QS++  +
Sbjct  250  LLSKNRTHYLPAVTSVLRALMAADATGAASDPTSCSLPRDTMPLAVDSAQINGQSAASAV  309

Query  174  QISHYT  157
              S  T
Sbjct  310  VRSPLT  315



>ref|XP_010051489.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Eucalyptus grandis]
 gb|KCW89474.1| hypothetical protein EUGRSUZ_A01771 [Eucalyptus grandis]
Length=314

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 117/198 (59%), Gaps = 15/198 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CV+SL+ AL +K + L +PN +CD V C+CGIR+H    LSCP AF+++S    +    +
Sbjct  121  CVNSLQSALVSKNVHLPQPNASCDAVLCFCGIRVHQISSLSCPAAFNVSSASRNVTPTAA  180

Query  531  VKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQL  361
            V+ LE  C        SS A C+KCL +L  L    K+ T     S +R S+M  RDCQL
Sbjct  181  VRNLEKSC------RNSSYAGCTKCLGALQKLKGGYKNGTGGGGSSSDRTSRMLDRDCQL  234

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            MGLTWLL +N+  YI TVSA LRA+M S +  +   C+ + + MPLAVDS +F    SS 
Sbjct  235  MGLTWLLARNKTAYIPTVSAALRAIMYSWHPPEGAKCSPDQENMPLAVDSLQFERAQSSS  294

Query  180  TLQISHYTYIIVPLLLLY  127
               ++ +   I+P ++ +
Sbjct  295  APSLAWFP--ILPSIMWF  310



>ref|XP_008341934.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Malus domestica]
Length=326

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 118/200 (59%), Gaps = 18/200 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG--ELVGHQ  535
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++ S G        
Sbjct  131  CVNSLQSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNV-SRGFHNATPTA  189

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQ  364
            +V+ LE +C        SS + C+KCL +L  L   SK+ T     + ER +KM + DCQ
Sbjct  190  AVRNLEKNC------RNSSYSGCTKCLGALQKLKGGSKNGTAGERSTSERANKMFNLDCQ  243

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS +  +    
Sbjct  244  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPHHENTCSPDQENMPLAVDSLQIENGQG-  302

Query  183  FTLQISHYTYIIVPLLLLYI  124
                 S  + +++P+L L I
Sbjct  303  --FAASPPSILMLPILPLII  320



>ref|XP_003526297.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
Length=318

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 120/199 (60%), Gaps = 19/199 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN-SHGELVGHQS  532
            CV+SL+ +L ++ I + + N TCD + C+CGIRLH    L+C  AF+++ SH       +
Sbjct  129  CVNSLQDSLLSRNIRIPQSNATCDAILCFCGIRLHQITSLTCNAAFNVSLSHRNATPTAA  188

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLS--KSETRSTSKSDERGSKMRSRDCQLM  358
            V+ LE +C        SS A C+KCL +L  +   K+ET    K  +R  KM +RDCQLM
Sbjct  189  VRNLENNC------RNSSYAGCTKCLGALQKVKGYKNET----KGSDRVKKMFNRDCQLM  238

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFT  178
            GLTWLL KN+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F  +S    
Sbjct  239  GLTWLLAKNKTAYIPTVSAVLRAMMYSAHPHE-SKCSPDQENMPLAVDSLQF--ESGHAP  295

Query  177  LQISHYTYIIVPLLLLYIS  121
             + S +   I+PLL+L  S
Sbjct  296  SRPSKFCVTILPLLVLLFS  314



>ref|XP_007132620.1| hypothetical protein PHAVU_011G110300g [Phaseolus vulgaris]
 gb|ESW04614.1| hypothetical protein PHAVU_011G110300g [Phaseolus vulgaris]
Length=320

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 109/172 (63%), Gaps = 14/172 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN-SHGELVGHQS  532
            CV+SL+ +L  + I + +PN TCD + C+CGIRLH    L+C  AF+++ SH       +
Sbjct  129  CVNSLQDSLLTRNIRIPQPNATCDAILCFCGIRLHQITSLTCNAAFNVSLSHKNATPTAA  188

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLS--KSETRSTSKSDERGSKMRSRDCQLM  358
            V+ LE +C        SS A C+KCL SL  +   K+ET+ +  S ER  KM +RDCQLM
Sbjct  189  VRNLENNC------RNSSYAGCTKCLGSLQKVKGYKNETKGSGGS-ERIKKMFNRDCQLM  241

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            GLTWLL KN+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F
Sbjct  242  GLTWLLAKNKTAYIPTVSAVLRAMMYSAHPHE-SKCSPDQENMPLAVDSLQF  292



>ref|XP_010904780.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=334

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 116/208 (56%), Gaps = 25/208 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQS-  532
            CVDSL+ +L  + I L +PN TCD V C+CGIRLH    L CP AF+++         + 
Sbjct  132  CVDSLQSSLERRDIRLPRPNATCDTVLCFCGIRLHQIGSLRCPAAFNVSGGAGGAARNAT  191

Query  531  ----VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQ  364
                V+ LE +C        +S A C++CL+SL  L   E      + +R ++M  RDCQ
Sbjct  192  PTAAVRELERNC------RNASYAGCTRCLHSLEKLKGHE----GGAGDRAARMFGRDCQ  241

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMST-----NGSDPLSCTLNSDGMPLAVDSSEF-  202
            LMGLTWLL KN+  YI TVSAVLRA++ S      +G     C+ + + MPLAVDS +F 
Sbjct  242  LMGLTWLLAKNKTAYIPTVSAVLRAVLYSAHPPSHDGDGNYKCSPDQENMPLAVDSLQFQ  301

Query  201  -YDQSSSFTLQISHYTYIIVPLLLLYIS  121
              D S++ +       +  +P LL+ IS
Sbjct  302  KLDSSTASSPSALLLPFFSLPALLVLIS  329



>ref|XP_008800404.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=341

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 109/202 (54%), Gaps = 21/202 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CVDSL+ +L  + I L +PN TCD V C+CGIRLH    L CP AF+++          +
Sbjct  132  CVDSLQSSLARRDIHLPRPNATCDTVLCFCGIRLHQIGSLRCPAAFNVSGAARNATPTAA  191

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            V+ LE  C           AS + C   L  L K +   +  S +R +++  RDCQLMGL
Sbjct  192  VRELERSC---------RNASYAGCTRCLQSLEKLKGHGSGGSGDRTTRIFGRDCQLMGL  242

Query  351  TWLLNKNRARYIHTVSAVLRALMMST-----NGSDPLSCTLNSDGMPLAVDSSEFY---D  196
            TWLL KNR  YI TVSAVLRA++ S      +G     C+L+ + MPLAVDS  F    D
Sbjct  243  TWLLAKNRTAYIPTVSAVLRAVLYSVHPPSHDGDANYKCSLDQENMPLAVDSLLFRKLDD  302

Query  195  QSSSFTLQISHYTYIIVPLLLL  130
             S+S       +    +P+L+L
Sbjct  303  SSTSSCSAPVRFPLFSLPVLVL  324



>ref|XP_008813347.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=334

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 116/208 (56%), Gaps = 25/208 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQS-  532
            CVDSL+ +L  + I L +PN TCD V C+CGIRLH    L CP AF+++  G      + 
Sbjct  132  CVDSLQSSLEQRDIRLPRPNATCDTVLCFCGIRLHQIGSLRCPAAFNVSGGGGGAARNAT  191

Query  531  ----VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQ  364
                V+ LE +C        +S A C++CL SL  L   E      + +R +KM  RDCQ
Sbjct  192  PTAAVRELERNC------RNASYAGCTRCLRSLEKLKGHE----GGAGDRAAKMFGRDCQ  241

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMST-----NGSDPLSCTLNSDGMPLAVDSSEF-  202
            LMGLTWLL KN+  YI TVSAVLRA++ S      +G     C+ + + MPLAVDS +F 
Sbjct  242  LMGLTWLLAKNKTAYIPTVSAVLRAVLYSAHPPSHDGDGGYRCSPDQENMPLAVDSLQFQ  301

Query  201  -YDQSSSFTLQISHYTYIIVPLLLLYIS  121
              D S++ +       +  +P+LL+  S
Sbjct  302  KLDSSTASSPSALVIKFFSLPVLLVLFS  329



>gb|KEH37810.1| transmembrane protein, putative [Medicago truncatula]
Length=316

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 122/198 (62%), Gaps = 15/198 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN-SHGELVGHQ-  535
            CV+SL+ +L ++ I + +PN TCD + C+CGIRLH    LSC  AF+++ SH  +     
Sbjct  127  CVNSLQDSLMSRNIRIPQPNATCDAILCFCGIRLHQISSLSCSAAFNVSGSHKNIATPTV  186

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMG  355
            +V+ LE +C        +S   C+KCL++L  + KS   +T  + ER  KM +RDC+LMG
Sbjct  187  AVRNLENNC------RNASYQGCTKCLSALQKV-KSYKNATKGASERVKKMFNRDCELMG  239

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTL  175
            LTWLL KN+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F  +++  + 
Sbjct  240  LTWLLAKNKTTYIPTVSAVLRAMMYSAHPHES-KCSPDQENMPLAVDSLQF--ETAHASS  296

Query  174  QISHYTYIIVPLLLLYIS  121
              S     I+ L++L+ S
Sbjct  297  WPSKLWATILTLIMLFCS  314



>ref|XP_009353209.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=327

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 119/200 (60%), Gaps = 18/200 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG--ELVGHQ  535
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++ S G        
Sbjct  132  CVNSLQSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNV-SQGFHNATPTA  190

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQ  364
            +++ LE +C        SS + C+KCL ++  L   SK+ T     + ER ++M +RDCQ
Sbjct  191  ALRNLEKNC------RNSSYSGCTKCLGAVQKLKGGSKNGTAGGRSTSERANRMFNRDCQ  244

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            LMGLTWLL +N+  YI TVSAVLRA+M S +      C+ + + MPLAVDS +  ++   
Sbjct  245  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHENMCSPDQENMPLAVDSLQI-EKGQG  303

Query  183  FTLQISHYTYIIVPLLLLYI  124
            F    S  + ++ P+L L I
Sbjct  304  FA--ASSPSILLFPILPLII  321



>gb|EPS66167.1| hypothetical protein M569_08604, partial [Genlisea aurea]
Length=269

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 114/195 (58%), Gaps = 16/195 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++  +        +
Sbjct  83   CVNSLQSSLASRNIHIPQPNASCDTVLCFCGIRLHQIASLSCPAAFNLTGNSRNATPTAA  142

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            V+ LE +C        SS A C+KC+ +L  L  ++   +    +R S+M +RDCQLMGL
Sbjct  143  VRNLERNC------RNSSYAGCTKCMGALQKLKGAKDHGSG--GDRASRMLNRDCQLMGL  194

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLS---CTLNSDGMPLAVDSSEFYDQS-SS  184
            TWLL +N+  YI TVSAVLRA+M  T      S   C  + + MPLAVDS +   ++ +S
Sbjct  195  TWLLARNKTAYIPTVSAVLRAVMYRTRPPTHASSSTCAPDQENMPLAVDSVQLVKKATAS  254

Query  183  FTLQISHYTYIIVPL  139
              + I    + ++PL
Sbjct  255  VLIPILPLAFCLLPL  269



>ref|XP_009380337.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=340

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 104/182 (57%), Gaps = 13/182 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNS-HGELV-GHQSVK  526
            C+  +E+AL ++G+EL + N TCD  YC+CG+RL  L+C  AF  N+  G  V    + +
Sbjct  143  CIGGVERALRDRGVELPRVNGTCDAAYCFCGVRLRRLACAGAFVANATEGRWVPAGDAGR  202

Query  525  RLETDCFsssangysslascSKCLNSLYLLSKSETRS---TSKSDERGSKMRSRDCQLMG  355
            RLE +C           A C++CL +L  L   E R     + SD++ +    R+CQLMG
Sbjct  203  RLERNC------ARPGFAGCTRCLRALNQLKSKEKRGGGDANGSDKKATPAHDRECQLMG  256

Query  354  LTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSF  181
            +TWLL+KNR  ++   ++VLR LM +    GSDP SC+L+ D MPLAV S +        
Sbjct  257  VTWLLSKNRTLFLPATTSVLRVLMAADGAGGSDPTSCSLSLDDMPLAVGSDQIGGHGGCS  316

Query  180  TL  175
            T+
Sbjct  317  TV  318



>ref|XP_010936812.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=329

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 108/186 (58%), Gaps = 11/186 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            C+  +E+AL ++G+ L   N TCD  YCYCGIRL  L+C    S      +    + +RL
Sbjct  132  CIGGVERALRDRGVRLPSVNGTCDAAYCYCGIRLRRLTCAGGASGAEGRWVPPGDASRRL  191

Query  519  ETDCFsssangysslascSKCLNSL-YLLSKSETRS-TSKSDERGSKMRSRDCQLMGLTW  346
            E  C          LA CS+CL +L  L +K E     +   +RG+  R+++CQLMG+TW
Sbjct  192  ERYC------SRPGLAGCSRCLRTLNQLKNKVEGGGNVTNVGKRGAGTRNQECQLMGVTW  245

Query  345  LLNKNRARYIHTVSAVLRALMMS---TNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTL  175
            LL+KNR RY+  V++VLRALM +      SDP SC+L  D MPLAVDS++   Q++S  +
Sbjct  246  LLSKNRTRYLPAVTSVLRALMAADATGAASDPTSCSLPHDSMPLAVDSAQIDGQAASSAV  305

Query  174  QISHYT  157
              S  T
Sbjct  306  FQSPLT  311



>ref|XP_010924042.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Elaeis guineensis]
Length=339

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 117/201 (58%), Gaps = 19/201 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLS---CPEAFSMNSHGE-LVGHQS  532
            CVDSL+++L  + I L +PN TCD V C+CGIRLH +S   CP AF+++          +
Sbjct  134  CVDSLQRSLERRDIHLPRPNATCDTVLCFCGIRLHQISSLRCPAAFNVSGAARNATPTAA  193

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            V+ LE++C        +S A C++CL SL  L    + S+    +R +++  RDCQLMGL
Sbjct  194  VRELESNC------RNASYAGCTRCLRSLEKLKGHGSGSSGG--DRTTRLFGRDCQLMGL  245

Query  351  TWLLNKNRARYIHTVSAVLRALMMST-----NGSDPLSCTLNSDGMPLAVDSSEFYDQSS  187
            TWLL KNR  YI TVSAVLRA++ S      +G     C+ + + MPLAVDS +F    S
Sbjct  246  TWLLAKNRTAYIPTVSAVLRAVLYSVRPPSHDGDGNYKCSPDQENMPLAVDSLQFQKLES  305

Query  186  SFTLQISH--YTYIIVPLLLL  130
            S     S   +++  +P+L L
Sbjct  306  SSASSRSALVFSFFFLPVLAL  326



>ref|XP_004507229.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Cicer arietinum]
Length=316

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 119/196 (61%), Gaps = 15/196 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGH-QS  532
            CV+SL+++L  + + + +PN TCD + C+CGIRLH    LSCP AF+++ + +      +
Sbjct  127  CVNSLQESLLIRNVRIPQPNATCDAILCFCGIRLHQISSLSCPAAFNVSGNRKYAAPTAA  186

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            V+ LE +C        +S A C+KCL++L  +   +  +     ER  KM + DC+LMGL
Sbjct  187  VRNLENNC------RNASYAGCTKCLSALQKVKSYKNETKKGGSERLKKMFNIDCELMGL  240

Query  351  TWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF-YDQSSSFTL  175
            TWLL KN+  YI TVSAVLRA++ S +  +   C+ + + MPLAVDS +F    +SS+  
Sbjct  241  TWLLAKNKTTYIPTVSAVLRAMLYSAHPHES-KCSPDQENMPLAVDSLQFDSGHASSWP-  298

Query  174  QISHYTYIIVPLLLLY  127
              S     I+PL++++
Sbjct  299  --SKLWVTILPLIMMF  312



>ref|XP_009350468.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=337

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 106/171 (62%), Gaps = 15/171 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG--ELVGHQ  535
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    LSCP AF++ S G        
Sbjct  142  CVNSLQSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLSCPAAFNV-SRGFHNATPTA  200

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLL---SKSETRSTSKSDERGSKMRSRDCQ  364
            +V+ LE +C        SS + C+KCL +L  L   SK+ T     + ER +KM + DCQ
Sbjct  201  AVRNLEKNC------RNSSYSGCTKCLGALQKLKGGSKNGTAGDRSTSERANKMFNLDCQ  254

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDS  211
            LMGLTWLL +N+  YI TVSAVLRA+M S +     +C+ + + MPLAVDS
Sbjct  255  LMGLTWLLARNKTAYIPTVSAVLRAIMYSAHPPHENTCSPDQENMPLAVDS  305



>ref|XP_003540881.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100 [Glycine 
max]
Length=317

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 108/172 (63%), Gaps = 17/172 (10%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMN-SHGELVGHQS  532
            CV+SL+ +L ++ I + +PN TCD + C+CGIRLH    L+C  AF+++ SH       +
Sbjct  128  CVNSLQDSLLSRNIRIPQPNATCDAILCFCGIRLHQITSLTCNAAFNVSLSHRNATPTAA  187

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLS--KSETRSTSKSDERGSKMRSRDCQLM  358
            V+ LE +C        SS A C+KCL +L  +   K+ET    K  +R  KM +RDCQLM
Sbjct  188  VRNLENNC------RNSSYAGCTKCLGALQKVKGYKNET----KGSDRVKKMFNRDCQLM  237

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEF  202
            GLTWLL KN+  YI TVSAVLRA+M S +  +   C+ + + MPLAVDS +F
Sbjct  238  GLTWLLAKNKTAYIPTVSAVLRAMMYSAHPHE-SKCSPDQENMPLAVDSLQF  288



>ref|XP_009400645.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=304

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 96/175 (55%), Gaps = 8/175 (5%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            C  + E AL  +G+ L +PN+TCD+ YCYCG+RL  L CP  F  ++ G   G       
Sbjct  116  CASAAEVALRARGVLLPRPNETCDLTYCYCGVRLRRLHCPGPFVASAAG---GRWVPANE  172

Query  519  ETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLL  340
            +T     +      L  C++CL+SLY L   E    +   +  +  R R+CQLMGLTWLL
Sbjct  173  DTATLIQTECRLPELDGCTRCLHSLYQLRSEEAEGVTS--DVTAMDRQRECQLMGLTWLL  230

Query  339  NKNRARYIHTVSAVLRALMMSTNGSDPLSCTL---NSDGMPLAVDSSEFYDQSSS  184
            ++NRA Y+H  + VLRA M S  G DP SC++     D +PL VDS      SSS
Sbjct  231  DENRAHYLHVAALVLRAFMASPTGVDPTSCSVPGGTGDDIPLLVDSGWVGAGSSS  285



>ref|XP_009418751.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=348

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 104/179 (58%), Gaps = 30/179 (17%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG----ELVG  541
            CVDSL+ AL  +GI L +PN TCD V C+CGIRLH    L CP AF+++  G        
Sbjct  131  CVDSLQSALERRGIRLPRPNATCDTVLCFCGIRLHQIGSLRCPAAFNVSGVGVAARNATP  190

Query  540  HQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQL  361
              ++++LE DC      G +S A C++CL SL      E    + S ER ++M  RDCQL
Sbjct  191  TAALQQLEHDC------GNASYAGCTRCLRSL------EKLKGNGSGERATRMFDRDCQL  238

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLS---------CTLNSDGMPLAVDS  211
            MGLTWLL +NR  +I T SAVLRAL+     + PL+         C+ + D MPLAVDS
Sbjct  239  MGLTWLLARNRTAFIPTASAVLRALLYGA--AAPLAQEEEESQCRCSRDQDDMPLAVDS  295



>ref|XP_003597088.1| GPI-anchored protein, putative [Medicago truncatula]
 ref|XP_003606027.1| GPI-anchored protein, putative [Medicago truncatula]
 gb|AES67339.1| hypothetical protein MTR_2g089530 [Medicago truncatula]
 gb|AES88224.1| hypothetical protein MTR_4g051000 [Medicago truncatula]
Length=301

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 23/185 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLS---CPEAFSMNS----HGELVG  541
            CV+SL+ +L ++ I +  PN +CD + C+CGIRLH +S   CP AF+++     H     
Sbjct  103  CVNSLQDSLRDRNIIIPTPNASCDAILCFCGIRLHQISSLNCPNAFNVSVSTMVHNVSGS  162

Query  540  HQS-----VKRLETDCFsssangysslascSKCLNSLYLLSKSET-RSTSKSDERGSKMR  379
            H++     V+ LE +C           +S + C N L  L K +  +  +K  +R  KM 
Sbjct  163  HKATPTAAVRDLEKNC---------RNSSYAGCTNCLSALQKLKVHKKDTKESDRERKMY  213

Query  378  SRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFY  199
            +RDCQLM LTWLL KN+  YI TVSAVLRA+M S +  D + C+ + + MPLAVDS +F 
Sbjct  214  NRDCQLMALTWLLGKNKTLYIPTVSAVLRAVMYSAHPHD-IKCSPDQENMPLAVDSMQFD  272

Query  198  DQSSS  184
              SSS
Sbjct  273  HTSSS  277



>ref|XP_006592832.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Glycine max]
Length=305

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 117/204 (57%), Gaps = 24/204 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS---HGELVGH  538
            CV+SL+ +L N+ I + +PN TCD + C+CGIRLH    L+CP AF++ +   +    G 
Sbjct  111  CVNSLQDSLRNRSIRIPQPNATCDAILCFCGIRLHHITSLTCPNAFNVTTALRNASSGGT  170

Query  537  QS------VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMR  379
             +      V+ LE +C           AS + C   L  L K +  +  +S+ ER  KM 
Sbjct  171  HNATPTAIVRNLEKNC---------RNASYAGCTQCLIALQKIKGNNKKESESERAKKMF  221

Query  378  SRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFY  199
            +RDCQLM LTWLL +N+  YI TVSAVLRA+M S +  +  +C+ + + MPLAVDS   Y
Sbjct  222  NRDCQLMALTWLLGRNKTAYIPTVSAVLRAVMYSAHPHES-TCSPDQENMPLAVDSLR-Y  279

Query  198  DQSSSFTLQISHYTYIIVPLLLLY  127
            + S   +  +  +  ++V +L+L+
Sbjct  280  ETSKGSSSPLRLFWIVLVIVLILF  303



>ref|XP_009412443.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=345

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 105/193 (54%), Gaps = 23/193 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQ--  535
            CVDSL+ AL  + I L +PN TCD V C+CGIRLH    L CP AF+++           
Sbjct  134  CVDSLQSALERRDIRLPRPNATCDTVLCFCGIRLHQIGSLRCPAAFNVSGGAARSATPTL  193

Query  534  SVKRLETDCFsssangysslascSKCLNSL--YLLSKSETRSTSKSDERGSKMRSRDCQL  361
            +V++LE DC        +S A C++CL++L                 +R  +M  RDCQL
Sbjct  194  AVRQLEGDC------RNASYAGCTRCLHALEKVKGHGGGVGEYEGGGDRAKRMFGRDCQL  247

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPL-------SCTLNSDGMPLAVDSSEF  202
            MGLTWLL +N+  YI TVSAVLRA++ S +             C+ + + MPLAVDS +F
Sbjct  248  MGLTWLLARNKTAYIPTVSAVLRAVLYSAHPPQAGGGGGGGYKCSPDQENMPLAVDSLQF  307

Query  201  YDQSSS---FTLQ  172
              QS S   F+ Q
Sbjct  308  QHQSDSAAAFSFQ  320



>gb|EAZ04317.1| hypothetical protein OsI_26458 [Oryza sativa Indica Group]
Length=335

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 102/181 (56%), Gaps = 22/181 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQS-  532
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++   G      + 
Sbjct  124  CVDALGSALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGGGGAAAAKNAT  183

Query  531  ----VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQ  364
                VK LE  C        +S A CS+C+ SL  L  + +R  +  D R  +M  RDCQ
Sbjct  184  PTAAVKELEKSC------RNASYAGCSRCVQSLQKLKGNVSREVAGGD-RARRMLGRDCQ  236

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTN-------GSDPLSCTLNSDGMPLAVDSSE  205
            LMGLTWLL KN+  YI TVSAVLRA++ S         G  P  C+ + + MPLAVDS +
Sbjct  237  LMGLTWLLAKNKTVYIPTVSAVLRAMLYSARPTESAAAGGAPPRCSPDQENMPLAVDSLQ  296

Query  204  F  202
            F
Sbjct  297  F  297



>ref|NP_001059970.1| Os07g0557700 [Oryza sativa Japonica Group]
 dbj|BAC84026.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21884.1| Os07g0557700 [Oryza sativa Japonica Group]
Length=335

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 102/181 (56%), Gaps = 22/181 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQS-  532
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++   G      + 
Sbjct  124  CVDALGSALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGGGGAAAAKNAT  183

Query  531  ----VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQ  364
                VK LE  C        +S A CS+C+ SL  L  + +R  +  D R  +M  RDCQ
Sbjct  184  PTAAVKELEKSC------RNASYAGCSRCVQSLQKLKGNVSREVAGGD-RARRMLGRDCQ  236

Query  363  LMGLTWLLNKNRARYIHTVSAVLRALMMSTN-------GSDPLSCTLNSDGMPLAVDSSE  205
            LMGLTWLL KN+  YI TVSAVLRA++ S         G  P  C+ + + MPLAVDS +
Sbjct  237  LMGLTWLLAKNKTVYIPTVSAVLRAMLYSARPTESAAAGGAPPRCSPDQENMPLAVDSLQ  296

Query  204  F  202
            F
Sbjct  297  F  297



>ref|XP_009410258.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009410268.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 97/172 (56%), Gaps = 12/172 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEL--VGHQSVK  526
            C   +E+A+ ++G+ L + N TCD  YCYCG+RL  L+C   F  ++   L         
Sbjct  141  CAAGVERAMRDRGVALPRANATCDTAYCYCGVRLRRLACAGGFVADTAAGLWVPAGDGGH  200

Query  525  RLETDCFsssangysslascSKCLNSLYLL--SKSETRSTSKSDERGSKMRSRDCQLMGL  352
            RLE+DC          L  CS+CL SL  L   K +    S S+ + +    R+CQLMG+
Sbjct  201  RLESDC------AQPGLTGCSRCLRSLNQLKAKKQQGSEASGSERKEAATHGRECQLMGV  254

Query  351  TWLLNKNRARYIHTVSAVLRALMM--STNGSDPLSCTLNSDGMPLAVDSSEF  202
            TWLL++NR  Y+ + +A+LR LM   +   SDP SC+L+ D MPLAV S++ 
Sbjct  255  TWLLSRNRTLYLPSATAILRVLMAADAVGSSDPTSCSLSQDAMPLAVGSTQI  306



>ref|XP_008810973.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=384

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 92/161 (57%), Gaps = 17/161 (11%)
 Frame = -3

Query  666  KGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMN-SHGELV--GHQSVKRLETDCFsss  496
            +G+ L +PN TCDV YCYCGIRL PL CP +F+ + S G  V     + + LE DC    
Sbjct  194  QGVVLPRPNDTCDVAYCYCGIRLGPLRCPGSFAASASEGRWVIAREDTARSLERDC----  249

Query  495  angysslascSKCLNSLYLLSKSETR---STSKSDERGSKMRSRDCQLMGLTWLLNKNRA  325
                  L  C++CL +L+ L   E     + +    R  K R R+CQLMGLTWLL K+R 
Sbjct  250  --ALPGLGGCARCLKTLFQLKSEEEEGGGNVTGPGLREGKERDRECQLMGLTWLLAKDRT  307

Query  324  RYIHTVSAVLRALMMSTNGSDPLSCTLNSDG----MPLAVD  214
            RY+ T + VLRA MMS +  DP SC+L   G    +PL VD
Sbjct  308  RYLRTAAFVLRAFMMSPD-EDPTSCSLPGSGGDDDVPLYVD  347



>ref|XP_004958008.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Setaria italica]
Length=338

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 105/182 (58%), Gaps = 17/182 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGE-LVGHQS  532
            CVD+L  AL  +G+ L  PN+TCD V C+CGIRLH    L CP AF++ +  +      +
Sbjct  130  CVDALGAALEKRGVALPSPNRTCDTVLCFCGIRLHQIGSLRCPAAFAVGAAAKNATPTAA  189

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGL  352
            VK LE  C        +S + CS+C+ SL  L  + +R  +  D R  +M  RDCQLMGL
Sbjct  190  VKDLEKSC------RNASYSGCSRCVQSLQKLKGNVSREVTGGD-RARRMLGRDCQLMGL  242

Query  351  TWLLNKNRARYIHTVSAVLRALMM------STNGSDPLSCTLNSDGMPLAVDSSEFYDQS  190
            TWLL KN+  YI TVSAVLRA++       S +G     C+ + + MPLAVDS +F    
Sbjct  243  TWLLAKNKTAYIPTVSAVLRAMLYTAHPTESGSGGAAPRCSPDQENMPLAVDSLQFEHTG  302

Query  189  SS  184
            S+
Sbjct  303  ST  304



>ref|XP_008670487.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X1 [Zea mays]
 tpg|DAA41110.1| TPA: hypothetical protein ZEAMMB73_853726 [Zea mays]
Length=345

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 103/179 (58%), Gaps = 19/179 (11%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG---ELVGH  538
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  131  CVDALGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVKAGAAARNATPT  190

Query  537  QSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMRSRDCQL  361
             +VK LE  C        +S A CS+C+ SL  L  + +R  S +  +R  +M  RDCQL
Sbjct  191  AAVKALEKSC------RNASYAGCSRCVQSLQKLKGNVSREVSGAGGDRARRMLGRDCQL  244

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMM------STNGSDPLSCTLNSDGMPLAVDSSEF  202
            MGLTWLL KN+  YI TVSAVLRA++       S +G     C+ + + MPLAVDS +F
Sbjct  245  MGLTWLLAKNKTAYIPTVSAVLRAMLYTARPTESGSGGAAPRCSPDQENMPLAVDSLQF  303



>ref|XP_009390209.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Musa acuminata subsp. malaccensis]
Length=381

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 104/186 (56%), Gaps = 14/186 (8%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSH-GELV-GHQSVK  526
            C+  +E+AL ++G+EL + N TCD  YCYCG+RL  L+C  AF  +   G  V    + +
Sbjct  185  CIGGVERALRHRGVELPRVNATCDAAYCYCGVRLRRLACAGAFVADVKLGRWVPAGDAGR  244

Query  525  RLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKS----DERGSKMRSRDCQLM  358
            RL+ DC           A C++CL +L  L   E +  S +     +  +    R+CQLM
Sbjct  245  RLKKDC------SRPGFAGCTRCLRTLNQLKAKEKQGGSSNLSIPGKEAAAAHERECQLM  298

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
            GLTWLL+KNR  ++ T ++VL+ALM +    GS   SC+L+ D +PLAV S + +    S
Sbjct  299  GLTWLLSKNRTLFLPTATSVLQALMAAEDAGGSHAASCSLSLDEVPLAVRSHQIHGHGGS  358

Query  183  FTLQIS  166
            F +  S
Sbjct  359  FAVPPS  364



>tpg|DAA63100.1| TPA: hypothetical protein ZEAMMB73_460549 [Zea mays]
Length=338

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 109/195 (56%), Gaps = 21/195 (11%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGH---  538
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  128  CVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGAGAGAAAKNAT  187

Query  537  --QSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMRSRDC  367
               +VK LE  C        +S A CS+C+ SL  L  + +R  S +  +R  +M  RDC
Sbjct  188  PTAAVKGLEKSC------RNASYAGCSRCVQSLQKLKGNVSREVSGAGGDRARRMLGRDC  241

Query  366  QLMGLTWLLNKNRARYIHTVSAVLRALMMSTN-----GSDPLSCTLNSDGMPLAVDSSEF  202
            QLMGLTWLL KN+  YI TVSAVLRA++ +       G+ P  C+ + + MPLAVDS +F
Sbjct  242  QLMGLTWLLAKNKTAYIPTVSAVLRAMLYTARPTEAAGAAP-RCSPDQENMPLAVDSLQF  300

Query  201  YDQSSSFTLQISHYT  157
                S+     ++ T
Sbjct  301  ERAGSTTGSAAANAT  315



>ref|XP_008653219.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Zea mays]
Length=443

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 106/186 (57%), Gaps = 21/186 (11%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGEL-----V  544
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  233  CVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGAGAGAAAKNAT  292

Query  543  GHQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMRSRDC  367
               +VK LE  C        +S A CS+C+ SL  L  + +R  S +  +R  +M  RDC
Sbjct  293  PTAAVKGLEKSC------RNASYAGCSRCVQSLQKLKGNVSREVSGAGGDRARRMLGRDC  346

Query  366  QLMGLTWLLNKNRARYIHTVSAVLRALMMSTN-----GSDPLSCTLNSDGMPLAVDSSEF  202
            QLMGLTWLL KN+  YI TVSAVLRA++ +       G+ P  C+ + + MPLAVDS +F
Sbjct  347  QLMGLTWLLAKNKTAYIPTVSAVLRAMLYTARPTEAAGAAP-RCSPDQENMPLAVDSLQF  405

Query  201  YDQSSS  184
                S+
Sbjct  406  ERAGST  411



>ref|XP_002463014.1| hypothetical protein SORBIDRAFT_02g036230 [Sorghum bicolor]
 gb|EER99535.1| hypothetical protein SORBIDRAFT_02g036230 [Sorghum bicolor]
Length=343

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 103/181 (57%), Gaps = 21/181 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGH---  538
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  130  CVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGAGAAAKNATPT  189

Query  537  QSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSD-ERGSKMRSRDCQL  361
             +VK LE  C        +S A CS+C+ SL  L  + +R  S +  +R  +M  RDCQL
Sbjct  190  AAVKDLEKSC------RNASYAGCSRCVQSLQKLKGNVSREVSGAGGDRARRMLGRDCQL  243

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMM--------STNGSDPLSCTLNSDGMPLAVDSSE  205
            MGLTWLL KN+  YI TVSAVLRA++         S +G     C+ + + MPLAVDS +
Sbjct  244  MGLTWLLAKNKTAYIPTVSAVLRAMLYTAHPTESGSGSGGAAPRCSPDQENMPLAVDSLQ  303

Query  204  F  202
            F
Sbjct  304  F  304



>ref|XP_007036758.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21259.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=236

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  KGIEL KPN+TCDVVYCYCGIRLHPLSCPEAFS++  G LVG ++V+RL
Sbjct  139  CVDDLGKALRQKGIELAKPNETCDVVYCYCGIRLHPLSCPEAFSVDQSGNLVGDENVERL  198

Query  519  ETDCFsssangysslasc--SKCLNSLYLLS  433
            E +C SSS+N          +KCL SL+L+ 
Sbjct  199  EKNCLSSSSNVNGFPGLGGCNKCLKSLHLVG  229



>gb|KJB77262.1| hypothetical protein B456_012G128400 [Gossypium raimondii]
Length=241

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRL  520
            CVD L KAL  +G+EL KPN+TCD VYCYCGIRLHPL+CP+AFS++  G LVG  SV+RL
Sbjct  136  CVDDLGKALKQRGVELAKPNETCDAVYCYCGIRLHPLTCPDAFSVDQKGNLVGDDSVERL  195

Query  519  ETDCFsssangysslasc--SKCLNSLYLL  436
            E +C SSS+N          +KCL SL+LL
Sbjct  196  ERNCLSSSSNVNGFPGLGGCNKCLKSLHLL  225



>ref|XP_004137338.1| PREDICTED: uncharacterized protein LOC101219306 [Cucumis sativus]
Length=370

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -3

Query  390  SKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDS  211
            +KM  ++CQLMGLTWLL KNR  YI TV++VLRA MMS +GSDP SCTLNSDGMPLAVDS
Sbjct  275  TKMHHKECQLMGLTWLLAKNRTAYIRTVTSVLRAKMMSEDGSDPRSCTLNSDGMPLAVDS  334

Query  210  SEFYDQSSSFTLQ  172
            +E    S +   Q
Sbjct  335  AEMSGSSVTIPTQ  347



>dbj|BAJ99254.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 89/181 (49%), Gaps = 25/181 (14%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQ-----TCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQ  535
            C  + E+AL + G  L +        TCDV +CYCGIRL    C           L   +
Sbjct  150  CAGAAERALRSAGATLPQTQAGSNGTTCDVPFCYCGIRLRRPVC----------ALPAGR  199

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLLSK-SETRSTSKSDERGSKMRSRDCQLM  358
            + +RLE DC          LA CS+CL +L LL    E   TS     G K R RDCQLM
Sbjct  200  AARRLERDC------ARPGLAGCSRCLRALNLLDAIGEKNGTSAKASHGGKPRERDCQLM  253

Query  357  GLTWLLNKNRARYIHTVSAVLRALMMSTNGS---DPLSCTLNSDGMPLAVDSSEFYDQSS  187
            GLTWLL +N  R+    +AVL+ALM +        P +C+L  + +P AV SSE    + 
Sbjct  254  GLTWLLQRNATRHRVAATAVLQALMAAEEAGATITPATCSLPVNDLPFAVASSEINGATG  313

Query  186  S  184
            +
Sbjct  314  A  314



>ref|XP_003563886.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Brachypodium distachyon]
Length=352

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 91/182 (50%), Gaps = 35/182 (19%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP--------NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELV  544
            C  + ++AL   G  L  P          +CDV +CYCGIRL    C           + 
Sbjct  162  CAGAADRALRASGATLPLPPPQVNGNGTSSCDVAFCYCGIRLRRPVC----------AVP  211

Query  543  GHQSVKRLETDCFsssangysslascSKCLNSLYLL-----SKSETRSTSKSDERGSKMR  379
              ++ +RLE DC          LA+CS+CL +L LL      K+ T S SK D R    R
Sbjct  212  SGRAARRLERDC------ARPGLAACSRCLRALNLLIAGGDHKNATSSKSKQDGRS---R  262

Query  378  SRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNG---SDPLSCTLNSDGMPLAVDSS  208
             RDCQLMGLTWLL +N  R+    +AVL+ALM +      S   +C+L  D MPLAV SS
Sbjct  263  QRDCQLMGLTWLLQRNATRHRVAATAVLQALMAADEAGTTSPTATCSLPVDDMPLAVASS  322

Query  207  EF  202
            E 
Sbjct  323  EI  324



>ref|XP_008787927.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Phoenix dactylifera]
Length=333

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 102/189 (54%), Gaps = 14/189 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGE---LVGHQSV  529
            CV  +E+AL ++G+ L + N TCD  +C CGIRL  L+C       S  E   +    + 
Sbjct  135  CVGGVERALRDRGVRLPRVNGTCDAAFCCCGIRLRRLTCAGGAFAASGAEGRWIPLGDAG  194

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRST--SKSDERGSKMRSRDCQLMG  355
            +RLE DC          LA CS+CL +L  +   E      +K+ +     R R+CQLMG
Sbjct  195  RRLERDC------SRPGLAGCSRCLRTLDQMKGKEVGGGNLTKASKGEDVTRDRECQLMG  248

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSDPL---SCTLNSDGMPLAVDSSEFYDQSSS  184
            LTWLL+KNR  Y++ V++ LRALM +          SC+L  D MPLAVDS++   +++S
Sbjct  249  LTWLLSKNRTHYLNAVTSALRALMAADAAGATADHSSCSLPHDSMPLAVDSAQIDGKAAS  308

Query  183  FTLQISHYT  157
              +  S  T
Sbjct  309  CAILRSPLT  317



>ref|NP_001142782.1| uncharacterized protein LOC100275144 [Zea mays]
 gb|ACG26591.1| hypothetical protein [Zea mays]
Length=352

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 98/199 (49%), Gaps = 34/199 (17%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPN-----------QTCDVVYCYCGIRLHPLSCPEAFSMNSHG  553
            C  + ++AL   G+ L +P+             CDV +CYCG+RL   +C         G
Sbjct  163  CAGAADRALRAAGVALPRPHWGESTGTGNGTAACDVAFCYCGVRLRRPAC-----AAPQG  217

Query  552  ELVGHQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSR  373
             +      +RLE DC         +L   + C   L  LSK   RS + S  +  +    
Sbjct  218  RMA-----RRLERDC---------ALPGLAGCSRCLRALSKLGGRSNATSSAKAKQEHRE  263

Query  372  DCQLMGLTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCTLNSDG-MPLAVDSSEF  202
            DC LMGLTWLLN+N  RY    +AV++ALM +       P +C+L +D  +P+AV SS+ 
Sbjct  264  DCHLMGLTWLLNRNPTRYREAATAVIQALMAADEAGAGHPATCSLPADDELPVAVASSQI  323

Query  201  YDQSSSFTLQISHYTYIIV  145
             + ++S ++  +H + ++V
Sbjct  324  -NGATSASMSSAHGSLLLV  341



>gb|AFW86539.1| hypothetical protein ZEAMMB73_536074 [Zea mays]
Length=352

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 34/193 (18%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPN-----------QTCDVVYCYCGIRLHPLSCPEAFSMNSHG  553
            C  + ++AL   G+ L +P+             CDV +CYCG+RL   +C         G
Sbjct  163  CAGAADRALRAAGVALPRPHWGESTGTGNGTAACDVAFCYCGVRLRRPAC-----AAPQG  217

Query  552  ELVGHQSVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSR  373
             +      +RLE DC         +L   + C   L  LSK   RS + S  +  +    
Sbjct  218  RMA-----RRLERDC---------ALPGLAGCSRCLRALSKLGGRSNATSSAKAKQEHRE  263

Query  372  DCQLMGLTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCTLNSDG-MPLAVDSSEF  202
            DC LMGLTWLLN+N  RY    +AV++ALM +       P +C+L +D  +P+AV SS+ 
Sbjct  264  DCHLMGLTWLLNRNPTRYREAATAVIQALMAADEAGAGHPATCSLPADDELPVAVASSQI  323

Query  201  YDQSSSFTLQISH  163
             + ++S ++  +H
Sbjct  324  -NGATSASMSSAH  335



>dbj|BAJ91757.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 89/175 (51%), Gaps = 21/175 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC-PEAFSMNSHGELVGHQS  532
            C  + ++AL ++G  L +P   N TCDV +CYCG+RL  L+C P+   +          +
Sbjct  145  CAGAADRALRSEGAALPRPPGANGTCDVAFCYCGVRLRRLTCGPQPTGVGQWAP--AESA  202

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDE-RGSKMRSRDCQLMG  355
             +RL+ DC          +  CSKCL++L  +      + + S + + +    RDCQLMG
Sbjct  203  ARRLKRDC------ARPGVPGCSKCLHALSTIKAGSGGAVAASGKLQAAASSERDCQLMG  256

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTN--------GSDPLSCTLNSDGMPLAVD  214
            L WLL +N  RY    +AV+RALM +           + P +C+L  D MP A +
Sbjct  257  LMWLLQRNATRYGAAATAVIRALMAADEASAVGAAAVAGPAACSLAVDDMPFAAE  311



>dbj|BAK05878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 89/175 (51%), Gaps = 21/175 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSC-PEAFSMNSHGELVGHQS  532
            C  + ++AL ++G  L +P   N TCDV +CYCG+RL  L+C P+   +          +
Sbjct  145  CAGAADRALRSEGAALPRPPGANGTCDVAFCYCGVRLRRLTCGPQPTGVGQWAP--AESA  202

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDE-RGSKMRSRDCQLMG  355
             +RL+ DC          +  CSKCL++L  +      + + S + + +    RDCQLMG
Sbjct  203  ARRLKRDC------ARPGVPGCSKCLHALSTIKAGSGGAVAASGKLQAAASSERDCQLMG  256

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTN--------GSDPLSCTLNSDGMPLAVD  214
            L WLL +N  RY    +AV+RALM +           + P +C+L  D MP A +
Sbjct  257  LMWLLQRNATRYGAAATAVIRALMAADEASAVGAAAVAGPAACSLAVDDMPFAAE  311



>ref|XP_003570217.2| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Brachypodium distachyon]
Length=394

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 99/205 (48%), Gaps = 27/205 (13%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSV  529
            C  + E+AL ++G  L +P   N TCDV +CYCG+RL  L+C    + N+        + 
Sbjct  199  CAGAAERALRSEGAALPRPPGANGTCDVAFCYCGVRLRRLTCGAQPTGNAGMWSPADAAA  258

Query  528  KRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLT  349
            +RLE DC          +  CSKCL +L  + K+   +    D   S+   RDC+L+G+ 
Sbjct  259  RRLERDC------AKPGVHGCSKCLRALATI-KAGAAAGKHGDGASSE---RDCELIGIM  308

Query  348  WLLNKNRARYIHTVSAVLRALMMSTN---------GSDPLSCTLNSDGMPLAVDSSEFYD  196
            WLL +N  RY    ++V+RALM +                +C+L+ D MPL    +    
Sbjct  309  WLLQRNATRYGAAATSVIRALMAADEASAAGVAAAAGSTAACSLSVDDMPLPAQYARL-S  367

Query  195  QSSSFTLQISHYTYIIVPLLLLYIS  121
            ++S   L +  +  I    LLL IS
Sbjct  368  EASGPPLAVRGFRLI----LLLAIS  388



>ref|XP_002987778.1| hypothetical protein SELMODRAFT_183423 [Selaginella moellendorffii]
 gb|EFJ11081.1| hypothetical protein SELMODRAFT_183423 [Selaginella moellendorffii]
Length=356

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 99/191 (52%), Gaps = 23/191 (12%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEA-FSMNSHGELVGHQS  532
            C  SL++   ++GI+L   N +CD+  CYCGIRL     L+CP   F  N    L  H  
Sbjct  141  CAASLQQGFHSRGIDLPLLNASCDMSLCYCGIRLRQMASLNCPVGYFHKNRSALLPSHAP  200

Query  531  -VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMG  355
             ++ L+++C   S +G SS  +     NS+  + + +  +  K+   G+   + DC+LMG
Sbjct  201  FLRHLQSNCSDPSLHGCSSCIAALD--NSVVWIGQ-KVAANPKASSSGATPSTLDCRLMG  257

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSD---------------PLSCTLNSDGMPLA  220
            L WLL+ NR R+I TVSAVLRAL+ ST+  D               P +C  +   +PLA
Sbjct  258  LMWLLSDNRTRFIPTVSAVLRALLYSTDSDDQDASAGDGEVPAAASPGACRSDQAQLPLA  317

Query  219  VDSSEFYDQSS  187
             DS    D ++
Sbjct  318  SDSPGPEDSAA  328



>ref|XP_002993750.1| hypothetical protein SELMODRAFT_431796 [Selaginella moellendorffii]
 gb|EFJ05169.1| hypothetical protein SELMODRAFT_431796 [Selaginella moellendorffii]
Length=353

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 104/216 (48%), Gaps = 28/216 (13%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEA-FSMNSHGELVGHQS  532
            C  SL++   ++GI+L   N +CD+  CYCGIRL     L+CP   F  N    L  H  
Sbjct  141  CAASLQQGFHSRGIDLPLLNASCDMSLCYCGIRLRQMASLNCPVGYFHKNRSALLPSHAP  200

Query  531  VKR-LETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMG  355
              R L+++C   S       +SC   L++  +    +  +  K+   G+   + DC+LMG
Sbjct  201  FLRHLQSNC---SDPSLHGCSSCIAALDNSVVWIGQKVAANPKAGSSGATPSTLDCRLMG  257

Query  354  LTWLLNKNRARYIHTVSAVLRALMMSTNGSD---------------PLSCTLNSDGMPLA  220
            L WLL+ NR R+I TVSAVLRAL+ ST+  D               P +C  +   +PLA
Sbjct  258  LMWLLSDNRTRFIPTVSAVLRALLYSTDSDDQDASAGDGEVPAAASPGACRSDQAQLPLA  317

Query  219  VDSSEFYDQS-----SSFTLQISHYTYIIVPLLLLY  127
             DS    D +     S  TL      + ++ LL ++
Sbjct  318  SDSLGPEDSAALLAHSPLTLFFHRAFFFVLFLLSVW  353



>ref|XP_004953652.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Setaria italica]
Length=370

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 101/217 (47%), Gaps = 35/217 (16%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGEL--VGHQ  535
            C  + ++AL   G  L +P   N TCDV +CYCG+RL  L+C  A    + G L     +
Sbjct  157  CAGAADRALRAGGASLPRPPGGNGTCDVAFCYCGVRLRRLACGPA---PADGGLWAPADE  213

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLLSKS---------ETRSTSKSDERGSKM  382
              +RLE DC        +    CSKCL +L  +  +         + +S +    R S+ 
Sbjct  214  VARRLEKDC------AQAGTPGCSKCLRALATIKPNTPGGGTEAVKGKSQAAGPGRSSES  267

Query  381  RSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMM------------STNGSDPLSCTLNS  238
              RDC+LMGL WLL +N  RY    +AV++ALM             + +     +C+L  
Sbjct  268  DDRDCELMGLMWLLQRNATRYGAAATAVIQALMAVDEASAAGVAVAAADAGPAAACSLPV  327

Query  237  DGMPLAVDSSEFYDQSSSFTLQISHYTYIIVPLLLLY  127
            D MPL  + ++    +S  +     +  +++ +L+ +
Sbjct  328  DDMPLPAEYAQLNGAASGTSGACCFHLVLLLAVLMSF  364



>ref|XP_006658688.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Oryza brachyantha]
Length=249

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 8/94 (9%)
 Frame = -3

Query  462  KCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALM  283
            +C+ SL  L  + +R  +  D R  +M  RDCQLMGLTWLL KN+  YI TVSAVLRA++
Sbjct  123  RCVQSLQKLKGNVSREVAGGD-RARRMLGRDCQLMGLTWLLAKNKTVYIPTVSAVLRAML  181

Query  282  MSTN-------GSDPLSCTLNSDGMPLAVDSSEF  202
             S         G+ P  C+ + + MPLAVDS +F
Sbjct  182  YSARPTESASAGAAPQRCSPDQENMPLAVDSLQF  215



>ref|XP_004965364.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Setaria italica]
Length=353

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 92/176 (52%), Gaps = 22/176 (13%)
 Frame = -3

Query  636  TCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLETDCFsssangysslascSKC  457
             CDV +CYCG+RL    CP        G +      +RLE DC          +A CSKC
Sbjct  195  ACDVEFCYCGVRLRRPVCPA-----PEGRMA-----RRLERDC------ALPGIAGCSKC  238

Query  456  LNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMS  277
            L +L  LS  +T +TS +  R  + +  DCQ+MGLTWLL +N  R+    +AV++ALM +
Sbjct  239  LRALNKLS-GKTNATSSAKAR--QEQREDCQVMGLTWLLQRNATRHREAATAVIQALMAA  295

Query  276  --TNGSDPLSCTLNS-DGMPLAVDSSEFYDQSSSFTLQISHYTYIIVPLLLLYISK  118
                     +C+L + D +P+AV SS+    +++    + H   +++   L ++S+
Sbjct  296  DEAGAGHQATCSLPAGDELPVAVGSSQINGTAAASPSAVGHLLLVLLGASLAFVSQ  351



>ref|NP_001047896.1| Os02g0710700 [Oryza sativa Japonica Group]
 dbj|BAD07493.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD07775.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF09810.1| Os02g0710700 [Oryza sativa Japonica Group]
Length=351

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 88/190 (46%), Gaps = 30/190 (16%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELV-GHQS  532
            C  + ++AL  +G  L +P   N TCDV +CYCG+RL  L+C         G+      +
Sbjct  143  CAGAADRALRAEGAALPRPPGANGTCDVAFCYCGVRLRRLTC--GPPPAEGGQWAPADAA  200

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRS--------  376
             +RLE DC          +  CSKCL +L  +      + + +     K +         
Sbjct  201  ARRLEKDC------AEPGVPGCSKCLRALTTIKAGSGGAAAAAAAAAKKKQQQGGAGVTG  254

Query  375  -RDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTN---------GSDPLSCTLNSDGMP  226
             R+CQLMG+ WLL +N  RY    +AV++ALM +              P +C+L  D MP
Sbjct  255  ERECQLMGIMWLLQRNATRYGAAATAVIQALMAADEASAAGVAAAADGPAACSLPVDDMP  314

Query  225  LAVDSSEFYD  196
            LA + + F D
Sbjct  315  LAAEYARFSD  324



>gb|EAY87253.1| hypothetical protein OsI_08655 [Oryza sativa Indica Group]
Length=351

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 88/190 (46%), Gaps = 30/190 (16%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELV-GHQS  532
            C  + ++AL  +G  L +P   N TCDV +CYCG+RL  L+C         G+      +
Sbjct  143  CAGAADRALRAEGAALPRPPGANGTCDVAFCYCGVRLRRLTC--GPPPAEGGQWAPADAA  200

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMRS--------  376
             +RLE DC          +  CSKCL +L  +      + + +     K +         
Sbjct  201  ARRLEKDC------AEPGVPGCSKCLRALTTIKAGSGGAAAAAAAAAKKKQQQGGAGVTG  254

Query  375  -RDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTN---------GSDPLSCTLNSDGMP  226
             R+CQLMG+ WLL +N  RY    +AV++ALM +              P +C+L  D MP
Sbjct  255  ERECQLMGIMWLLQRNATRYGAAATAVIQALMAADEASAAGVAAAADGPAACSLPVDDMP  314

Query  225  LAVDSSEFYD  196
            LA + + F D
Sbjct  315  LAAEYARFSD  324



>ref|NP_001144341.1| uncharacterized protein LOC100277244 precursor [Zea mays]
 gb|ACG39687.1| hypothetical protein [Zea mays]
Length=352

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 78/152 (51%), Gaps = 19/152 (13%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP----NQTCDVVYCYCGIRLHPLSC-PEAFSMNSHGELVGHQ  535
            C  + ++AL   G  L +P    N TCDV +CYCG+RL  L+C P   +           
Sbjct  147  CAGAADRALRAAGATLPRPTGGNNGTCDVAFCYCGVRLRRLTCGPPPAAEGGLWAPADDA  206

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK----SDERGSKMRS---  376
            + +RLE DC          +  CSKCL +L ++  +     +     S E+ + +RS   
Sbjct  207  AARRLERDC------AQPGVPGCSKCLLALTMIKNTSPGXGAAAEAASKEKQAAVRSGES  260

Query  375  -RDCQLMGLTWLLNKNRARYIHTVSAVLRALM  283
             RDC+LMGL WLL +N  RY  T +AV++ALM
Sbjct  261  DRDCELMGLMWLLQRNATRYGATATAVIQALM  292



>ref|XP_008677003.1| PREDICTED: uncharacterized protein LOC100277244 isoform X1 [Zea 
mays]
 gb|AFW63581.1| hypothetical protein ZEAMMB73_212242 [Zea mays]
Length=361

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 93/196 (47%), Gaps = 30/196 (15%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKP----NQTCDVVYCYCGIRLHPLSC-PEAFSMNSHGELVGHQ  535
            C  + ++AL   G  L +P    N TCDV +CYCG+RL  L+C P   +           
Sbjct  147  CAGAADRALRAAGATLPRPTGGNNGTCDVAFCYCGVRLRRLTCGPPPAAEGGLWAPADDA  206

Query  534  SVKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSK----SDERGSKMRS---  376
            + +RLE DC          +  CSKCL +L ++  +     +     S E+ + +RS   
Sbjct  207  AARRLERDC------AQPGVPGCSKCLLALTMIKNTSPGGGAAAEAASKEKQAAVRSGES  260

Query  375  -RDCQLMGLTWLLNKNRARYIHTVSAVLRALMM-----------STNGSDPLSCTLNSDG  232
             RDC+LMGL WLL +N  RY  T +AV++ALM            + +     +C+L  D 
Sbjct  261  DRDCELMGLMWLLQRNATRYGATATAVIQALMAVDEASAAGVAVAADAGPAAACSLPVDD  320

Query  231  MPLAVDSSEFYDQSSS  184
            MPL  + ++    S +
Sbjct  321  MPLPAEYAQVGGASDA  336



>gb|EMT29347.1| hypothetical protein F775_23569 [Aegilops tauschii]
Length=153

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -3

Query  462  KCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALM  283
            K L +L L +  E  +TS     G+K R RDCQLMGLTWLL +N  R+    +AVL+ALM
Sbjct  35   KELVALTLNAIGEKNATSGKANHGAKPRERDCQLMGLTWLLQRNATRHRAAATAVLQALM  94

Query  282  MSTNG---SDPLSCTLNSDGMPLAVDSSEF  202
             +      S P +C+L  DG+PLAV SSE 
Sbjct  95   AAEEAGATSAPATCSLPVDGLPLAVASSEI  124



>gb|EMS66696.1| hypothetical protein TRIUR3_31273 [Triticum urartu]
Length=237

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 15/107 (14%)
 Frame = -3

Query  462  KCLNSLYLLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALM  283
            +C+ SL  +  + +R  +  D R  +M   DCQLMGLTWLL KN+  YI TVSAVLRA++
Sbjct  107  RCVQSLQKVKGNVSREVAGGD-RARRMLGLDCQLMGLTWLLAKNKTVYIPTVSAVLRAML  165

Query  282  MST--------------NGSDPLSCTLNSDGMPLAVDSSEFYDQSSS  184
             +                G  P  C+ + + MPLAVDS +F    S+
Sbjct  166  YTAHPTESGSHSKVSGGGGGAPPRCSPDQENMPLAVDSLQFEHAGST  212



>ref|NP_001144450.1| uncharacterized protein LOC100277413 precursor [Zea mays]
 gb|ACG40625.1| hypothetical protein [Zea mays]
Length=364

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 82/179 (46%), Gaps = 33/179 (18%)
 Frame = -3

Query  642  NQTCDVVYCYCGIRLHPLSC---PEAFSMNSHGELVGHQSVKRLETDCFsssangyssla  472
            N TCDV +CYCG+RL  L+C   P    M S  +     + + LE DC          + 
Sbjct  177  NGTCDVAFCYCGVRLRRLACGSPPAEGGMWSPAD----AAARELEKDC------AQPGVP  226

Query  471  scSKCLNSLYLLSKSETRSTSKSDERGSKMRS--------RDCQLMGLTWLLNKNRARYI  316
             CSKCL +L  +  +     +  +  G K +         RDC+LMGL WLL +N  RY 
Sbjct  227  GCSKCLLALTTIKATNPGCGAGVEAAGKKKQQIYRWTASDRDCELMGLMWLLQRNATRYG  286

Query  315  HTVSAVLRALM-----------MSTNGSDPLSCTLN-SDGMPLAVDSSEFYDQSSSFTL  175
               +AV+RALM           ++ +    ++C+L   D MPL  + ++    S +  L
Sbjct  287  AAATAVIRALMAVDEAFTAGVAVAADTGAAVACSLPVDDDMPLPAEYAQVSRASDAPRL  345



>tpg|DAA41109.1| TPA: hypothetical protein ZEAMMB73_853726 [Zea mays]
Length=109

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 44/67 (66%), Gaps = 6/67 (9%)
 Frame = -3

Query  384  MRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMM------STNGSDPLSCTLNSDGMPL  223
            M  RDCQLMGLTWLL KN+  YI TVSAVLRA++       S +G     C+ + + MPL
Sbjct  1    MLGRDCQLMGLTWLLAKNKTAYIPTVSAVLRAMLYTARPTESGSGGAAPRCSPDQENMPL  60

Query  222  AVDSSEF  202
            AVDS +F
Sbjct  61   AVDSLQF  67



>ref|XP_002454401.1| hypothetical protein SORBIDRAFT_04g030180 [Sorghum bicolor]
 gb|EES07377.1| hypothetical protein SORBIDRAFT_04g030180 [Sorghum bicolor]
Length=355

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 83/189 (44%), Gaps = 30/189 (16%)
 Frame = -3

Query  642  NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLETDCFsssangysslascS  463
            N TCDV +CYCG+RL  L+C    S           + ++LE DC          +  CS
Sbjct  163  NGTCDVAFCYCGVRLRRLTCGPPPSEGGGLWSPADAAARKLEKDC------AQPGVPGCS  216

Query  462  KCLNSLYLLSKSETRSTS-----------KSDERGSKMRSRDCQLMGLTWLLNKNRARYI  316
            KCL +L  +  S                 ++  R S+   RDC+LMGL WLL +N  RY 
Sbjct  217  KCLLALTTIKASNNPEGGAGAEAAAGKKKQTAGRSSE-SDRDCELMGLMWLLQRNATRYG  275

Query  315  HTVSAVLRALMM------------STNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQ  172
             T +AV++ALM             +T+     +C+L  D MPL  + ++    S +  + 
Sbjct  276  ATATAVIQALMAVDEASAAGVVAVATDAGPAAACSLPVDDMPLPAEYAQVGRASDAPRVC  335

Query  171  ISHYTYIIV  145
              H   ++ 
Sbjct  336  CFHLVVLLA  344



>gb|AFW73063.1| hypothetical protein ZEAMMB73_382585 [Zea mays]
Length=367

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 62/131 (47%), Gaps = 21/131 (16%)
 Frame = -3

Query  642  NQTCDVVYCYCGIRLHPLSC---PEAFSMNSHGELVGHQSVKRLETDCFsssangyssla  472
            N TCDV +CYCG+RL  L+C   P    M S  +     + + LE DC          + 
Sbjct  179  NGTCDVAFCYCGVRLRRLACGSPPAEGGMWSPAD----AAARELEKDC------AQPGVP  228

Query  471  scSKCLNSLYLLSKSETRSTSKSDERGSKMRS--------RDCQLMGLTWLLNKNRARYI  316
             CSKCL +L  +  +     + +   G K           RDC+LMGL W+L +N  RY 
Sbjct  229  GCSKCLLALTTIKATNPEGGAGAKAPGKKKEQIDRSTASDRDCELMGLMWVLQRNATRYG  288

Query  315  HTVSAVLRALM  283
               + V++ALM
Sbjct  289  AAATTVIQALM  299



>gb|KDO55799.1| hypothetical protein CISIN_1g020738mg [Citrus sinensis]
Length=275

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 65/111 (59%), Gaps = 16/111 (14%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNS-HGELVGHQS  532
            CV+SL+ AL +K +++ +PN +CD + C+CGIRLH    LSCP AF++ +    +    +
Sbjct  124  CVNSLQSALVSKNVKIPQPNASCDAILCFCGIRLHQISSLSCPAAFNVTAGFRNVTPTAA  183

Query  531  VKRLETDCFsssangysslascSKCLNSLYLLSKSETRSTSKSDERGSKMR  379
            VK LE +C        SS + C+KCL +L +++K       +  ER S+ R
Sbjct  184  VKNLEKNC------RNSSYSGCTKCLGALQMVAK------RREQERNSRTR  222



>gb|AFW86538.1| hypothetical protein ZEAMMB73_536074 [Zea mays]
Length=154

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -3

Query  420  RSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCT  247
            RS + S  +  +    DC LMGLTWLLN+N  RY    +AV++ALM +       P +C+
Sbjct  50   RSNATSSAKAKQEHREDCHLMGLTWLLNRNPTRYREAATAVIQALMAADEAGAGHPATCS  109

Query  246  LNSDG-MPLAVDSSEFYDQSSS  184
            L +D  +P+AV SS+    +S+
Sbjct  110  LPADDELPVAVASSQINGATSA  131



>tpg|DAA35957.1| TPA: hypothetical protein ZEAMMB73_447066 [Zea mays]
Length=222

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG---ELVGH  538
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  131  CVDTLGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVKTGAAARNATPT  190

Query  537  QSVKRLETDC  508
             +VK LE  C
Sbjct  191  AAVKALEKSC  200



>dbj|BAD45779.1| hypothetical protein [Oryza sativa Japonica Group]
Length=404

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = -3

Query  372  DCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSD-PLSCTLNSDGMPLAVDSSEFYD  196
            DCQLMGLTWLL++N  R+    +AV++ALM + + +  P  C+L SD +P+AV SSE   
Sbjct  308  DCQLMGLTWLLHRNATRHGAAATAVIQALMAADDATGRPAPCSLPSDDLPVAVASSEING  367

Query  195  QSSS  184
             ++S
Sbjct  368  AAAS  371



>ref|NP_001183921.1| uncharacterized protein LOC100502514 [Zea mays]
 gb|ACR38759.1| unknown [Zea mays]
Length=219

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG---ELVGH  538
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  19   CVDTLGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVKTGAAARNATPT  78

Query  537  QSVKRLETDC  508
             +VK LE  C
Sbjct  79   AAVKALEKSC  88



>gb|EEC80671.1| hypothetical protein OsI_23081 [Oryza sativa Indica Group]
Length=421

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -3

Query  372  DCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSD-PLSCTLNSDGMPLAVDSSEF  202
            DCQLMGLTWLL++N  R+    +AV++ALM + + +  P +C+L SD +P+AV SSE 
Sbjct  325  DCQLMGLTWLLHRNATRHGAAATAVIQALMAADDATGRPATCSLPSDDLPVAVASSEI  382



>tpg|DAA35956.1| TPA: hypothetical protein ZEAMMB73_447066 [Zea mays]
Length=331

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHG---ELVGH  538
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP AF++ +          
Sbjct  131  CVDTLGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVKTGAAARNATPT  190

Query  537  QSVKRLETDC  508
             +VK LE  C
Sbjct  191  AAVKALEKSC  200



>gb|EEE67402.1| hypothetical protein OsJ_24716 [Oryza sativa Japonica Group]
Length=133

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 9/80 (11%)
 Frame = -3

Query  441  LLSKSETRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSD  262
            LL  + +R  +  D R  +M  RDCQLMGLTWLL KN+     T SA          G  
Sbjct  25   LLKGNVSREVAGGD-RARRMLGRDCQLMGLTWLLAKNKTVARPTESA--------AAGGA  75

Query  261  PLSCTLNSDGMPLAVDSSEF  202
            P  C+ + + MPLAVDS +F
Sbjct  76   PPRCSPDQENMPLAVDSLQF  95



>gb|AFG68066.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68067.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68068.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68069.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68070.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68071.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68072.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68073.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68074.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68075.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68076.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68077.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68078.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
 gb|AFG68079.1| hypothetical protein 0_13494_01, partial [Pinus taeda]
Length=148

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLS---CPEAFSMNSHG  553
            CV++L+ +L  +G+ + +PN TCD V C+CGIRLH LS   CP+AF++   G
Sbjct  97   CVNNLQSSLQRRGVRIPQPNDTCDPVQCFCGIRLHSLSLVTCPQAFNVTVSG  148



>gb|AEW07870.1| hypothetical protein 0_13494_01, partial [Pinus radiata]
Length=148

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHPLS---CPEAFSMNSHG  553
            C ++L+ +L  +G+ + +PN TCD V C+CGIRLH LS   CP+AF++   G
Sbjct  97   CANNLQSSLQRRGVRIPQPNDTCDPVQCFCGIRLHSLSLVTCPQAFNVTVSG  148



>ref|XP_002438348.1| hypothetical protein SORBIDRAFT_10g013280 [Sorghum bicolor]
 gb|EER89715.1| hypothetical protein SORBIDRAFT_10g013280 [Sorghum bicolor]
Length=137

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = -3

Query  423  TRSTSKSDERGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTN---GSDPLS  253
            + +TS +  +  + +  DC LMGLTWLLN+N  R+    +AV++ALM +     G  P +
Sbjct  30   SNATSSASAKAKQEQRDDCHLMGLTWLLNRNATRHREAATAVIQALMAADEAGAGHQP-T  88

Query  252  CTLNS-DGMPLAVDSSEF  202
            C+L + D +P+AV SS+ 
Sbjct  89   CSLPAGDELPVAVGSSQI  106



>ref|XP_008670488.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
isoform X2 [Zea mays]
Length=301

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 3/43 (7%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLH---PLSCP  580
            CVD+L  AL  +G+ L +PN TCD V C+CGIRLH    L CP
Sbjct  131  CVDALGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCP  173



>gb|ACG30608.1| hypothetical protein [Zea mays]
Length=85

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = -3

Query  360  MGLTWLLNKNRARYIHTVSAVLRALMMS--TNGSDPLSCTLNSDG-MPLAVDSSEFYDQS  190
            MGLTWLLN+N  RY    +AV++ALM +       P +C+L +D  +P+AV SS+    +
Sbjct  1    MGLTWLLNRNPTRYREAATAVIQALMAADEAGAGHPATCSLPADDELPVAVASSQINGAT  60

Query  189  SS  184
            S+
Sbjct  61   SA  62



>ref|XP_009373629.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Pyrus x bretschneideri]
Length=227

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = -3

Query  699  CVDSLEKALGNKGIELVKPNQTCDVVYCYCGIRLHP---LSCPEAFSMNSH  556
            CV+SL+ +L ++ I + +PN +CD V C+CGIRLH    L CP   + N H
Sbjct  98   CVNSLQSSLVSRNIRIPQPNASCDAVLCFCGIRLHQIGSLRCPAFPTRNRH  148



>ref|XP_006648977.1| PREDICTED: uncharacterized GPI-anchored protein At4g28100-like 
[Oryza brachyantha]
Length=216

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 51/113 (45%), Gaps = 18/113 (16%)
 Frame = -3

Query  642  NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLETDCFsssangysslascS  463
            N TCDV +CYCG+RL  L+C  A +           + +RLE DC          +  CS
Sbjct  74   NATCDVAFCYCGVRLRRLTCGAAPAEGGQWA-PADAAARRLERDC------AQPGVPGCS  126

Query  462  KCLNSLYLL-----------SKSETRSTSKSDERGSKMRSRDCQLMGLTWLLN  337
            KCL +L  +           + + T         GS    RDCQLMGL WLL+
Sbjct  127  KCLRALTTIKSGSGGAAASSASAATGKQQGGGGSGSGTGERDCQLMGLMWLLS  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320