BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024N24

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344428.1|  PREDICTED: uncharacterized protein LOC102597060    219   3e-66   Solanum tuberosum [potatoes]
ref|XP_004236230.1|  PREDICTED: uncharacterized protein LOC101257648    217   3e-65   Solanum lycopersicum
ref|XP_007036303.1|  Embryo defective 2759 isoform 2                    214   8e-65   
ref|XP_009595596.1|  PREDICTED: uncharacterized protein LOC104091859    216   1e-64   Nicotiana tomentosiformis
ref|XP_009763845.1|  PREDICTED: uncharacterized protein LOC104215685    215   2e-64   Nicotiana sylvestris
ref|XP_007036302.1|  Embryo defective 2759, putative isoform 1          214   3e-64   
ref|XP_007209326.1|  hypothetical protein PRUPE_ppa008249mg             213   1e-63   Prunus persica
ref|XP_002263464.1|  PREDICTED: uncharacterized protein LOC100265372    211   5e-63   Vitis vinifera
ref|XP_008351790.1|  PREDICTED: uncharacterized protein LOC103415...    208   2e-62   
ref|XP_008346735.1|  PREDICTED: uncharacterized protein LOC103409...    208   2e-62   
emb|CAN66425.1|  hypothetical protein VITISV_007985                     209   3e-62   Vitis vinifera
ref|XP_008351789.1|  PREDICTED: uncharacterized protein LOC103415...    208   7e-62   
ref|XP_008346734.1|  PREDICTED: uncharacterized protein LOC103409...    208   1e-61   
ref|XP_008244999.1|  PREDICTED: uncharacterized protein LOC103343...    207   3e-61   
ref|XP_008245000.1|  PREDICTED: uncharacterized protein LOC103343...    206   4e-61   Prunus mume [ume]
ref|XP_009362976.1|  PREDICTED: uncharacterized protein LOC103952...    204   7e-61   Pyrus x bretschneideri [bai li]
gb|KJB53102.1|  hypothetical protein B456_008G293700                    205   1e-60   Gossypium raimondii
ref|XP_009362975.1|  PREDICTED: uncharacterized protein LOC103952...    204   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_004298965.1|  PREDICTED: uncharacterized protein LOC101308376    204   2e-60   Fragaria vesca subsp. vesca
gb|KHG08396.1|  Adenylosuccinate synthetase                             204   3e-60   Gossypium arboreum [tree cotton]
gb|EYU22149.1|  hypothetical protein MIMGU_mgv1a009494mg                203   7e-60   Erythranthe guttata [common monkey flower]
gb|KHG29598.1|  recA                                                    203   7e-60   Gossypium arboreum [tree cotton]
gb|KJB08224.1|  hypothetical protein B456_001G071700                    199   3e-58   Gossypium raimondii
ref|XP_011071908.1|  PREDICTED: uncharacterized protein LOC105157...    197   6e-58   
ref|XP_011071907.1|  PREDICTED: uncharacterized protein LOC105157...    197   8e-58   Sesamum indicum [beniseed]
ref|XP_011071906.1|  PREDICTED: uncharacterized protein LOC105157...    197   1e-57   Sesamum indicum [beniseed]
ref|XP_010102523.1|  hypothetical protein L484_014579                   197   2e-57   Morus notabilis
ref|XP_011071905.1|  PREDICTED: uncharacterized protein LOC105157...    197   2e-57   
ref|XP_011071904.1|  PREDICTED: uncharacterized protein LOC105157...    197   3e-57   
ref|XP_011046159.1|  PREDICTED: uncharacterized protein LOC105140...    196   4e-57   Populus euphratica
ref|XP_011046164.1|  PREDICTED: uncharacterized protein LOC105140...    196   5e-57   Populus euphratica
ref|XP_002511367.1|  conserved hypothetical protein                     196   5e-57   Ricinus communis
gb|KCW51790.1|  hypothetical protein EUGRSUZ_J01240                     188   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010550686.1|  PREDICTED: uncharacterized protein LOC104821...    193   4e-56   Tarenaya hassleriana [spider flower]
emb|CDY16747.1|  BnaA09g06350D                                          194   4e-56   Brassica napus [oilseed rape]
ref|XP_010550688.1|  PREDICTED: uncharacterized protein LOC104821...    193   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_002322176.2|  hypothetical protein POPTR_0015s09120g             193   5e-56   Populus trichocarpa [western balsam poplar]
emb|CDX87278.1|  BnaC09g05930D                                          193   5e-56   
gb|KDP31068.1|  hypothetical protein JCGZ_11444                         193   6e-56   Jatropha curcas
ref|XP_009112054.1|  PREDICTED: uncharacterized protein LOC103837445    193   8e-56   Brassica rapa
ref|XP_010027415.1|  PREDICTED: uncharacterized protein LOC104417915    192   1e-55   Eucalyptus grandis [rose gum]
ref|XP_011046174.1|  PREDICTED: uncharacterized protein LOC105140...    191   4e-55   Populus euphratica
ref|XP_010034353.1|  PREDICTED: uncharacterized protein LOC104423587    187   5e-55   Eucalyptus grandis [rose gum]
ref|XP_011046177.1|  PREDICTED: uncharacterized protein LOC105140...    191   6e-55   Populus euphratica
ref|XP_008438584.1|  PREDICTED: uncharacterized protein LOC103483...    190   8e-55   Cucumis melo [Oriental melon]
ref|XP_008438592.1|  PREDICTED: uncharacterized protein LOC103483...    190   9e-55   Cucumis melo [Oriental melon]
ref|XP_010278056.1|  PREDICTED: uncharacterized protein LOC104612...    188   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010248566.1|  PREDICTED: uncharacterized protein LOC104591...    187   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010444166.1|  PREDICTED: uncharacterized protein LOC104726903    189   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010248564.1|  PREDICTED: uncharacterized protein LOC104591...    187   4e-54   Nelumbo nucifera [Indian lotus]
gb|EPS63513.1|  hypothetical protein M569_11269                         186   5e-54   Genlisea aurea
ref|XP_010248562.1|  PREDICTED: uncharacterized protein LOC104591...    187   5e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010278054.1|  PREDICTED: uncharacterized protein LOC104612...    188   5e-54   Nelumbo nucifera [Indian lotus]
ref|XP_011040480.1|  PREDICTED: uncharacterized protein LOC105136...    187   6e-54   Populus euphratica
ref|XP_002864832.1|  EMB2759                                            188   7e-54   
ref|XP_002318084.2|  hypothetical protein POPTR_0012s09050g             187   8e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011040479.1|  PREDICTED: uncharacterized protein LOC105136...    187   8e-54   Populus euphratica
ref|XP_010484025.1|  PREDICTED: uncharacterized protein LOC104762443    187   8e-54   Camelina sativa [gold-of-pleasure]
gb|ABK96116.1|  unknown                                                 187   9e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006394322.1|  hypothetical protein EUTSA_v10004512mg             187   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_011040476.1|  PREDICTED: uncharacterized protein LOC105136...    187   1e-53   Populus euphratica
ref|XP_011040478.1|  PREDICTED: uncharacterized protein LOC105136...    187   1e-53   Populus euphratica
ref|XP_010545998.1|  PREDICTED: uncharacterized protein LOC104818212    187   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_006280741.1|  hypothetical protein CARUB_v10026710mg             186   2e-53   Capsella rubella
ref|XP_010459745.1|  PREDICTED: uncharacterized protein LOC104740753    186   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007155447.1|  hypothetical protein PHAVU_003G202200g             186   4e-53   Phaseolus vulgaris [French bean]
ref|XP_010051327.1|  PREDICTED: uncharacterized protein LOC104440036    182   5e-53   Eucalyptus grandis [rose gum]
gb|KEH31820.1|  embryo defective 2759 protein, putative                 186   7e-53   Medicago truncatula
dbj|BAB10547.1|  unnamed protein product                                180   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150435.1|  PREDICTED: uncharacterized protein LOC103873787    182   7e-52   Brassica rapa
emb|CDY00350.1|  BnaA06g22510D                                          182   7e-52   
gb|KCW83031.1|  hypothetical protein EUGRSUZ_C04410                     175   2e-51   Eucalyptus grandis [rose gum]
emb|CDX84380.1|  BnaC03g51200D                                          181   3e-51   
ref|NP_201110.2|  protein EMBRYO DEFECTIVE 2759                         181   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190603.1|  protein EMBRYO DEFECTIVE 2759                      181   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KCW81778.1|  hypothetical protein EUGRSUZ_C03135                     174   5e-51   Eucalyptus grandis [rose gum]
gb|KHN30931.1|  hypothetical protein glysoja_017468                     179   7e-51   Glycine soja [wild soybean]
gb|EYU17699.1|  hypothetical protein MIMGU_mgv1a009574mg                179   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_004508882.1|  PREDICTED: uncharacterized protein LOC101499...    179   1e-50   Cicer arietinum [garbanzo]
ref|XP_004508881.1|  PREDICTED: uncharacterized protein LOC101499...    179   2e-50   Cicer arietinum [garbanzo]
emb|CDP12656.1|  unnamed protein product                                179   3e-50   Coffea canephora [robusta coffee]
ref|XP_010942418.1|  PREDICTED: uncharacterized protein LOC105060428    176   1e-49   Elaeis guineensis
dbj|BAB82451.1|  PBng110                                                172   2e-49   Vigna radiata [mung bean]
ref|NP_001242677.1|  uncharacterized protein LOC100798149               175   4e-49   
ref|XP_010670202.1|  PREDICTED: uncharacterized protein LOC104887288    172   9e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007138040.1|  hypothetical protein PHAVU_009G176100g             171   1e-47   Phaseolus vulgaris [French bean]
ref|XP_011101307.1|  PREDICTED: uncharacterized protein LOC105179393    171   1e-47   Sesamum indicum [beniseed]
gb|KHN19278.1|  hypothetical protein glysoja_012198                     171   2e-47   Glycine soja [wild soybean]
ref|XP_009399545.1|  PREDICTED: uncharacterized protein LOC103983918    171   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782690.1|  PREDICTED: uncharacterized protein LOC103702154    170   4e-47   Phoenix dactylifera
ref|XP_003527009.1|  PREDICTED: uncharacterized protein LOC100802...    169   8e-47   Glycine max [soybeans]
ref|XP_006581918.1|  PREDICTED: uncharacterized protein LOC100802...    169   1e-46   Glycine max [soybeans]
ref|XP_006476824.1|  PREDICTED: uncharacterized protein LOC102631...    163   1e-44   Citrus sinensis [apfelsine]
ref|XP_006439862.1|  hypothetical protein CICLE_v10021009mg             163   2e-44   
ref|XP_006439864.1|  hypothetical protein CICLE_v10021009mg             162   2e-44   
ref|XP_010923746.1|  PREDICTED: uncharacterized protein LOC105046751    161   8e-44   Elaeis guineensis
ref|XP_008787333.1|  PREDICTED: uncharacterized protein LOC103705...    161   8e-44   
ref|XP_008464548.1|  PREDICTED: uncharacterized protein LOC103502...    158   1e-42   Cucumis melo [Oriental melon]
ref|XP_004501900.1|  PREDICTED: uncharacterized protein LOC101490180    154   1e-42   
ref|XP_003601234.1|  hypothetical protein MTR_3g077490                  157   4e-42   Medicago truncatula
ref|XP_004501898.1|  PREDICTED: uncharacterized protein LOC101489...    154   3e-41   Cicer arietinum [garbanzo]
gb|KJB08225.1|  hypothetical protein B456_001G071700                    135   3e-34   Gossypium raimondii
ref|XP_004157782.1|  PREDICTED: uncharacterized protein LOC101229897    133   3e-33   
emb|CDX72055.1|  BnaC08g28190D                                          131   1e-32   
ref|XP_004152483.1|  PREDICTED: uncharacterized protein LOC101204576    131   1e-32   Cucumis sativus [cucumbers]
gb|KDO69572.1|  hypothetical protein CISIN_1g020410mg                   120   1e-28   Citrus sinensis [apfelsine]
gb|KDO69567.1|  hypothetical protein CISIN_1g020410mg                   120   2e-28   Citrus sinensis [apfelsine]
gb|ABK21678.1|  unknown                                               53.5    5e-05   Picea sitchensis



>ref|XP_006344428.1| PREDICTED: uncharacterized protein LOC102597060 [Solanum tuberosum]
Length=338

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAV LVYGAEVSKEL PLWILGP +VALY+KML+GICALYVF FKQTV VVKN P
Sbjct  201  FVPLYLAVTLVYGAEVSKELTPLWILGPLIVALYVKMLRGICALYVFSFKQTVNVVKNLP  260

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +LA +YIV+GK+KE+IR R LQP +DIKN+DYKE AK + +D+KV L EKYLD  ES
Sbjct  261  TYSLLAYDYIVRGKLKEDIRMRLLQPFIDIKNLDYKEAAKRKAKDIKVYLVEKYLDFVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  321  IWPYYCRTIRFLKRANLI  338



>ref|XP_004236230.1| PREDICTED: uncharacterized protein LOC101257648 [Solanum lycopersicum]
Length=337

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAV LVYGAEVSKEL PLWILGP +VALY+KML+GICALYVF FKQTV VVKN P
Sbjct  200  FVPLYLAVTLVYGAEVSKELTPLWILGPLIVALYVKMLRGICALYVFSFKQTVNVVKNLP  259

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +LA +YIV+GK+KE IR R LQP +DIKN+DYKE AK + +D++V L EKYLD  ES
Sbjct  260  TYSLLAYDYIVRGKLKEYIRMRLLQPFIDIKNLDYKEAAKRKAKDIEVFLVEKYLDFVES  319

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  320  IWPYYCRTIRFLKRANLI  337



>ref|XP_007036303.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao]
 gb|EOY20804.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao]
Length=290

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP+YLAV+L+YGAEVSKEL PLW+ GP +VALYIK+L+G+CALYVFCFKQTV++++N P
Sbjct  153  FVPWYLAVSLIYGAEVSKELTPLWVFGPLIVALYIKILRGLCALYVFCFKQTVQIIRNLP  212

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY+LA  YI +GK+KE++RARF QPV+D+KN+DYKE+++ +M+D +    EKYLD  ES
Sbjct  213  TYYLLAYNYIARGKLKEDVRARFWQPVVDLKNLDYKELSRRKMKDFQEWAMEKYLDFVES  272

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  273  IWPYYCRTIRFLKRANLI  290



>ref|XP_009595596.1| PREDICTED: uncharacterized protein LOC104091859 [Nicotiana tomentosiformis]
Length=340

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAV L+YG EVSKEL PLW LGP +VALY+KML+GICALYVF FKQTV+VVKN P
Sbjct  203  FVPLYLAVTLIYGVEVSKELTPLWTLGPLIVALYVKMLRGICALYVFSFKQTVKVVKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +L  +Y+ +GK KE+IRAR LQP++DIKN+DYKEVAK + +DL+V L EKYLD  ES
Sbjct  263  TYSLLTYDYVARGKFKEDIRARLLQPLVDIKNLDYKEVAKRKAKDLEVYLVEKYLDYVES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  323  IWPYYCRTIRFLKRANLI  340



>ref|XP_009763845.1| PREDICTED: uncharacterized protein LOC104215685 [Nicotiana sylvestris]
Length=339

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAV L+YG EVSKEL PLW LGP +VALY+KML+GICALYVF FKQTV+VV+N P
Sbjct  202  FVPLYLAVTLIYGVEVSKELTPLWTLGPLIVALYVKMLRGICALYVFSFKQTVKVVRNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +L  +Y+ +GK+KE+IRAR LQP++DIKN+DYKEVAK + +DL+V L EKYLD  ES
Sbjct  262  TYSLLTYDYVARGKLKEDIRARLLQPLVDIKNLDYKEVAKRKAKDLEVYLVEKYLDYVES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  322  IWPYYCRTIRFLKRANLI  339



>ref|XP_007036302.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao]
 gb|EOY20803.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao]
Length=343

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP+YLAV+L+YGAEVSKEL PLW+ GP +VALYIK+L+G+CALYVFCFKQTV++++N P
Sbjct  206  FVPWYLAVSLIYGAEVSKELTPLWVFGPLIVALYIKILRGLCALYVFCFKQTVQIIRNLP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY+LA  YI +GK+KE++RARF QPV+D+KN+DYKE+++ +M+D +    EKYLD  ES
Sbjct  266  TYYLLAYNYIARGKLKEDVRARFWQPVVDLKNLDYKELSRRKMKDFQEWAMEKYLDFVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>ref|XP_007209326.1| hypothetical protein PRUPE_ppa008249mg [Prunus persica]
 gb|EMJ10525.1| hypothetical protein PRUPE_ppa008249mg [Prunus persica]
Length=339

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN++YGAEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  202  FIPGYLAVNIIYGAEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVQVIKNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI QGK+KE+IRARF QPVL+IKN+DYK++++ +++ L+ ++ EKYLD  ES
Sbjct  262  TYYMVAYRYIAQGKLKEDIRARFWQPVLNIKNLDYKKLSRRKLKGLQELIVEKYLDFIES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  322  IWPYYCRTIRFLKRANLI  339



>ref|XP_002263464.1| PREDICTED: uncharacterized protein LOC100265372 [Vitis vinifera]
 emb|CBI14996.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YG EVSKEL PLW+LGP +VALYIKML+GICALYVF FKQTV++VKN P
Sbjct  206  FIPLYLAVNVAYGPEVSKELAPLWVLGPLIVALYIKMLRGICALYVFSFKQTVKLVKNIP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY+LA  YI  GK+KE+I+ARF QPV+DIKN+DY+E+++ +++DL+  L E+YLD  ES
Sbjct  266  TYYLLAYTYIAHGKLKEDIQARFWQPVVDIKNLDYRELSRRKLKDLQEWLLERYLDFVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>ref|XP_008351790.1| PREDICTED: uncharacterized protein LOC103415230 isoform X2 [Malus 
domestica]
Length=280

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+++GA+VSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  143  FIPMYLAVNMIHGAKVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLP  202

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI  GK+KEEIRARF QP+L++KN+DYK++++ +++ L+ ++ EKYLD  ES
Sbjct  203  TYYMVAYTYIAHGKLKEEIRARFWQPLLNVKNLDYKKLSRRKLKALQGLIIEKYLDFVES  262

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  263  IWPYYCRTIRFLKRANLI  280



>ref|XP_008346735.1| PREDICTED: uncharacterized protein LOC103409711 isoform X2 [Malus 
domestica]
Length=279

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN +YGAEVSKEL PLW+LGPF+VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  142  FIPMYLAVNTIYGAEVSKELTPLWVLGPFIVALYIKMLQXLCALYVFSFKQTVKVIKNLP  201

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y+M+A  YI  GK+KEEIR RF QP+L+++N+DYK++++ +++ L+ ++ E+YLD  ES
Sbjct  202  SYFMVAYTYIAHGKLKEEIRTRFWQPLLNVRNLDYKKLSRRKLKALQELIVERYLDFVES  261

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  262  IWPYYCRTIRFLKRANLI  279



>emb|CAN66425.1| hypothetical protein VITISV_007985 [Vitis vinifera]
Length=307

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YG EVSKEL PLW+ GP +VALYIKML+GICALYVF FKQTV++VKN P
Sbjct  170  FIPLYLAVNVAYGPEVSKELAPLWVXGPLIVALYIKMLRGICALYVFSFKQTVKLVKNIP  229

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY+LA  YI  GK+KE+I+ARF QPV+DIKN+DY+E+++ +++DL+  L E+YLD  ES
Sbjct  230  TYYLLAYTYIAHGKLKEDIQARFWQPVVDIKNLDYRELSRRKLKDLQEWLLERYLDFVES  289

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  290  IWPYYCRTIRFLKRANLI  307



>ref|XP_008351789.1| PREDICTED: uncharacterized protein LOC103415230 isoform X1 [Malus 
domestica]
Length=339

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+++GA+VSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  202  FIPMYLAVNMIHGAKVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI  GK+KEEIRARF QP+L++KN+DYK++++ +++ L+ ++ EKYLD  ES
Sbjct  262  TYYMVAYTYIAHGKLKEEIRARFWQPLLNVKNLDYKKLSRRKLKALQGLIIEKYLDFVES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  322  IWPYYCRTIRFLKRANLI  339



>ref|XP_008346734.1| PREDICTED: uncharacterized protein LOC103409711 isoform X1 [Malus 
domestica]
Length=337

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN +YGAEVSKEL PLW+LGPF+VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  200  FIPMYLAVNTIYGAEVSKELTPLWVLGPFIVALYIKMLQXLCALYVFSFKQTVKVIKNLP  259

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y+M+A  YI  GK+KEEIR RF QP+L+++N+DYK++++ +++ L+ ++ E+YLD  ES
Sbjct  260  SYFMVAYTYIAHGKLKEEIRTRFWQPLLNVRNLDYKKLSRRKLKALQELIVERYLDFVES  319

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  320  IWPYYCRTIRFLKRANLI  337



>ref|XP_008244999.1| PREDICTED: uncharacterized protein LOC103343102 isoform X1 [Prunus 
mume]
Length=343

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YGAEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  206  FIPGYLAVNITYGAEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVQVIKNLP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI QGK+KE+IRA F QPVL+IK++DYK++++ +++ L+ ++ EKYLD  ES
Sbjct  266  TYYMVAYRYIAQGKLKEDIRACFWQPVLNIKSLDYKKLSRRKLKGLQELIVEKYLDFIES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>ref|XP_008245000.1| PREDICTED: uncharacterized protein LOC103343102 isoform X2 [Prunus 
mume]
Length=339

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YGAEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  202  FIPGYLAVNITYGAEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVQVIKNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI QGK+KE+IRA F QPVL+IK++DYK++++ +++ L+ ++ EKYLD  ES
Sbjct  262  TYYMVAYRYIAQGKLKEDIRACFWQPVLNIKSLDYKKLSRRKLKGLQELIVEKYLDFIES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  322  IWPYYCRTIRFLKRANLI  339



>ref|XP_009362976.1| PREDICTED: uncharacterized protein LOC103952990 isoform X2 [Pyrus 
x bretschneideri]
Length=280

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+++GAEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  143  FIPMYLAVNMIHGAEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLP  202

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI +GK+KEEI  RF QP+L+IKN+DYK++++ +++ L+ ++ E+YLD  ES
Sbjct  203  TYYMVAYTYIARGKLKEEIWTRFWQPLLNIKNLDYKKLSRRKLKALQGLIIERYLDFVES  262

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  263  IWPYYCRTIRFLKRANLI  280



>gb|KJB53102.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
 gb|KJB53103.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
 gb|KJB53104.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
Length=342

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP+YL VNL+YGAEVSKEL PLW+ GP ++ALYIKML+G+CALYVFCF QTV++++N P
Sbjct  205  FVPWYLGVNLIYGAEVSKELTPLWVFGPLIIALYIKMLRGLCALYVFCFTQTVQLIRNLP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY+LA  YI  GK+KE++R    QPV+D+KN+DYKEV   +M+D +  + EKYLD  ES
Sbjct  265  TYYLLAYNYIAHGKLKEDVRVHVWQPVVDMKNLDYKEVCIKKMKDFQEWMMEKYLDYVES  324

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  325  IWPYYCRTIRFLKRANLI  342



>ref|XP_009362975.1| PREDICTED: uncharacterized protein LOC103952990 isoform X1 [Pyrus 
x bretschneideri]
Length=339

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+++GAEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN P
Sbjct  202  FIPMYLAVNMIHGAEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYYM+A  YI +GK+KEEI  RF QP+L+IKN+DYK++++ +++ L+ ++ E+YLD  ES
Sbjct  262  TYYMVAYTYIARGKLKEEIWTRFWQPLLNIKNLDYKKLSRRKLKALQGLIIERYLDFVES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  322  IWPYYCRTIRFLKRANLI  339



>ref|XP_004298965.1| PREDICTED: uncharacterized protein LOC101308376 [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN++YGAEVSKEL PLW+LGPF+ ALYIKMLQ +CALY+F FKQTV+VV N P
Sbjct  202  FVPSYLAVNILYGAEVSKELTPLWVLGPFIAALYIKMLQWLCALYIFSFKQTVKVVTNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY+ A  YI  GK KE+I ARF QPV+DIKN+DYK++++ +++ L+ ++ EKYLD  ES
Sbjct  262  TYYLAAYRYIFHGKFKEDIYARFWQPVVDIKNLDYKKLSRRKLKVLQELIVEKYLDFVES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANLI
Sbjct  322  IWPYYCRAIRFLKRANLI  339



>gb|KHG08396.1| Adenylosuccinate synthetase [Gossypium arboreum]
Length=354

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  703  VPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPT  524
            VP+YL VNL+YGAEVSKEL PLW+ GP ++ALYIKML+G+CALYVFCF QTV++++N PT
Sbjct  218  VPWYLGVNLIYGAEVSKELTPLWVFGPLIIALYIKMLRGLCALYVFCFTQTVQLIRNLPT  277

Query  523  YYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESI  344
            YY+LA  YI  GK+KE++R    QPV+D+KN+DYKEV + +M+D +  + EKYLD  ESI
Sbjct  278  YYLLAYNYIAHGKLKEDVRVHVWQPVVDMKNLDYKEVCRKKMKDFQEWMMEKYLDYVESI  337

Query  343  WPYYCRAIRTLKRANLI  293
            WPYYCR IR LKRANLI
Sbjct  338  WPYYCRTIRFLKRANLI  354



>gb|EYU22149.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
 gb|EYU22150.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
 gb|EYU22151.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
Length=340

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG EVSKEL PLWILGP +VALYIKM + IC LYVF FKQTV+VVKN P
Sbjct  203  FTPLYLAVNLVYGPEVSKELTPLWILGPLIVALYIKMFRAICGLYVFSFKQTVKVVKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +L +EY+ +GK+KE IRAR  QP+ DIKN+DYKE A+++M+ L+  L EKYLD  ES
Sbjct  263  TYCVLVHEYLFRGKLKEAIRARLWQPIADIKNMDYKEAARTKMKILQEWLVEKYLDYVES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANL+
Sbjct  323  IWPYYCRIIRFLKRANLL  340



>gb|KHG29598.1| recA [Gossypium arboreum]
Length=342

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P Y+AV+L+YGAEVSKEL PLW+ GP +VALYI++L+G+CALYV C KQT+++V N P
Sbjct  205  FIPLYMAVSLIYGAEVSKELTPLWVFGPLIVALYIRILRGLCALYVLCLKQTLQIVGNLP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A  YI  GK+KEE+RAR  QPV+DIKN+DYKE+++ +M+D +  + EKY+D+ ES
Sbjct  265  TYYVMAYNYIAHGKLKEEVRARVWQPVVDIKNLDYKELSRRKMKDFQEWMMEKYVDIVES  324

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRAN+I
Sbjct  325  VWPYYCRTIRFLKRANII  342



>gb|KJB08224.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
 gb|KJB08226.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
 gb|KJB08227.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
Length=342

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P Y+AV+L+YGAEVSKEL PLW+ GP +VALYI++L+G+CALYV C KQT+++V N P
Sbjct  205  FIPLYMAVSLIYGAEVSKELTPLWVFGPLIVALYIRILRGLCALYVLCLKQTLQIVGNLP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A  YI  GK+KEE+RAR  QPV++IKN+DYKE+++ +M+D +  + E Y+D+ ES
Sbjct  265  TYYVVAYNYIAHGKLKEEVRARVWQPVVNIKNLDYKELSRRKMKDFQEWMMENYVDIVES  324

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRAN+I
Sbjct  325  VWPYYCRTIRFLKRANII  342



>ref|XP_011071908.1| PREDICTED: uncharacterized protein LOC105157246 isoform X5 [Sesamum 
indicum]
 ref|XP_011071909.1| PREDICTED: uncharacterized protein LOC105157246 isoform X5 [Sesamum 
indicum]
Length=292

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG+EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P
Sbjct  155  FTPLYLAVNLVYGSEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLP  214

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY+L +EYI +GK+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E 
Sbjct  215  AYYLLLHEYIFRGKLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIEL  274

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  275  IWPYYCRTIRFLKRANLI  292



>ref|XP_011071907.1| PREDICTED: uncharacterized protein LOC105157246 isoform X4 [Sesamum 
indicum]
Length=306

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG+EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P
Sbjct  169  FTPLYLAVNLVYGSEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLP  228

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY+L +EYI +GK+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E 
Sbjct  229  AYYLLLHEYIFRGKLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIEL  288

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  289  IWPYYCRTIRFLKRANLI  306



>ref|XP_011071906.1| PREDICTED: uncharacterized protein LOC105157246 isoform X3 [Sesamum 
indicum]
Length=340

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG+EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P
Sbjct  203  FTPLYLAVNLVYGSEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY+L +EYI +GK+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E 
Sbjct  263  AYYLLLHEYIFRGKLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIEL  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  323  IWPYYCRTIRFLKRANLI  340



>ref|XP_010102523.1| hypothetical protein L484_014579 [Morus notabilis]
 gb|EXB93587.1| hypothetical protein L484_014579 [Morus notabilis]
Length=327

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 116/138 (84%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+PFYLAVN++YGAEVSKEL PLW++GP +V LYIKML+ + ALYVF F+QTV+V+KN P
Sbjct  194  FIPFYLAVNVIYGAEVSKELTPLWVVGPVIVVLYIKMLRWLFALYVFSFRQTVKVIKNLP  253

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY     Y+VQGK+KEE R+RF QPV++IKN++YKE +K+++++L+V L E+YLD  ES
Sbjct  254  VYY----SYLVQGKLKEEFRSRFWQPVVNIKNLNYKEFSKTKLKELQVWLVERYLDFVES  309

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  310  IWPYYCRTIRFLKRANLI  327



>ref|XP_011071905.1| PREDICTED: uncharacterized protein LOC105157246 isoform X2 [Sesamum 
indicum]
Length=355

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG+EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P
Sbjct  218  FTPLYLAVNLVYGSEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLP  277

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY+L +EYI +GK+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E 
Sbjct  278  AYYLLLHEYIFRGKLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIEL  337

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  338  IWPYYCRTIRFLKRANLI  355



>ref|XP_011071904.1| PREDICTED: uncharacterized protein LOC105157246 isoform X1 [Sesamum 
indicum]
Length=359

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG+EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P
Sbjct  222  FTPLYLAVNLVYGSEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLP  281

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY+L +EYI +GK+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E 
Sbjct  282  AYYLLLHEYIFRGKLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIEL  341

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  342  IWPYYCRTIRFLKRANLI  359



>ref|XP_011046159.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046160.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046161.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046162.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046163.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
Length=343

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P +LAVN++YGA VSKEL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN P
Sbjct  206  FIPLFLAVNVMYGAGVSKELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A+ YI QGK+KE+I+AR LQP+   KN+D KE ++ +M +L+  L EKYLD  ES
Sbjct  266  TYYLVASGYIRQGKLKEDIQARVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANLI
Sbjct  326  IWPYYCRAIRFLKRANLI  343



>ref|XP_011046164.1| PREDICTED: uncharacterized protein LOC105140850 isoform X2 [Populus 
euphratica]
Length=340

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P +LAVN++YGA VSKEL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN P
Sbjct  203  FIPLFLAVNVMYGAGVSKELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A+ YI QGK+KE+I+AR LQP+   KN+D KE ++ +M +L+  L EKYLD  ES
Sbjct  263  TYYLVASGYIRQGKLKEDIQARVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANLI
Sbjct  323  IWPYYCRAIRFLKRANLI  340



>ref|XP_002511367.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51969.1| conserved hypothetical protein [Ricinus communis]
Length=343

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+VYG EVSKEL PLWILGP +VALYIKML+ + ALYVF F+QTV++VKN P
Sbjct  206  FIPLYLAVNVVYGVEVSKELTPLWILGPLIVALYIKMLRVLWALYVFSFRQTVKLVKNLP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A+ YI +G++KE++ AR +QPV++IKN+DYKE+++ ++++ +  L +KY D  ES
Sbjct  266  TYYLVASSYITRGRLKEDVHARVVQPVINIKNLDYKELSRKKLKEFEEWLLDKYFDYVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>gb|KCW51790.1| hypothetical protein EUGRSUZ_J01240, partial [Eucalyptus grandis]
Length=137

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  700  PFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTY  521
            P YLA+N+ YG+EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN P Y
Sbjct  2    PLYLAINVTYGSEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLPVY  61

Query  520  YMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIW  341
            Y+ A +Y+  GK+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIW
Sbjct  62   YLTAYQYVANGKLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIW  121

Query  340  PYYCRAIRTLKRANLI  293
            PYYCR IR LKRAN I
Sbjct  122  PYYCRTIRFLKRANFI  137



>ref|XP_010550686.1| PREDICTED: uncharacterized protein LOC104821481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010550687.1| PREDICTED: uncharacterized protein LOC104821481 isoform X1 [Tarenaya 
hassleriana]
Length=327

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  703  VPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPT  524
            VP ++AVN +YGAEVSKELMPLW++GP VVALY+KM QGICALY FCFKQT+ +++N P 
Sbjct  191  VPGFVAVNSIYGAEVSKELMPLWVVGPLVVALYVKMFQGICALYAFCFKQTINIIRNLPA  250

Query  523  YYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESI  344
            Y +LA  YI++GK+KE+     L+PV+ IKN+DYKEVA++R++ L+  + EKYLD  ESI
Sbjct  251  YAILAYNYIIRGKLKEDALGFVLRPVVAIKNMDYKEVARTRLKLLQKWVIEKYLDFVESI  310

Query  343  WPYYCRAIRTLKRANLI  293
            WPYYCR IR LKRANLI
Sbjct  311  WPYYCRTIRFLKRANLI  327



>emb|CDY16747.1| BnaA09g06350D [Brassica napus]
Length=346

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLWI GP +VALY+KM QG+CALY FCFKQT +V++N P
Sbjct  209  FVPAFLAVNAIYGAEVTKELSPLWIAGPLIVALYVKMFQGLCALYAFCFKQTAKVIRNLP  268

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI QGK+++++R    +P++ +KN DYKE+  ++++ L+  L EKYLD  ES
Sbjct  269  SYYIIAYHYIAQGKLRDDVRGLVTRPMVAVKNADYKELTGAKLKQLREWLVEKYLDFVES  328

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  329  IWPYYCRTIRFLKRANLI  346



>ref|XP_010550688.1| PREDICTED: uncharacterized protein LOC104821481 isoform X2 [Tarenaya 
hassleriana]
Length=321

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  703  VPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPT  524
            VP ++AVN +YGAEVSKELMPLW++GP VVALY+KM QGICALY FCFKQT+ +++N P 
Sbjct  185  VPGFVAVNSIYGAEVSKELMPLWVVGPLVVALYVKMFQGICALYAFCFKQTINIIRNLPA  244

Query  523  YYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESI  344
            Y +LA  YI++GK+KE+     L+PV+ IKN+DYKEVA++R++ L+  + EKYLD  ESI
Sbjct  245  YAILAYNYIIRGKLKEDALGFVLRPVVAIKNMDYKEVARTRLKLLQKWVIEKYLDFVESI  304

Query  343  WPYYCRAIRTLKRANLI  293
            WPYYCR IR LKRANLI
Sbjct  305  WPYYCRTIRFLKRANLI  321



>ref|XP_002322176.2| hypothetical protein POPTR_0015s09120g [Populus trichocarpa]
 gb|EEF06303.2| hypothetical protein POPTR_0015s09120g [Populus trichocarpa]
Length=343

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P +LAVN+VYGA VSKEL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN P
Sbjct  206  FIPLFLAVNVVYGAGVSKELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A  YI QGK+KE+I+AR LQP+   KN+D KE ++ +M +L+    EKYLD  ES
Sbjct  266  TYYLVAYGYIRQGKLKEDIQARVLQPLQSFKNLDRKEFSRKKMMELQEWCMEKYLDYVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANLI
Sbjct  326  IWPYYCRAIRFLKRANLI  343



>emb|CDX87278.1| BnaC09g05930D [Brassica napus]
Length=346

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLWI GP +V+LY+KM QG+C LY FCFKQT +V++N P
Sbjct  209  FVPAFLAVNAIYGAEVTKELSPLWIAGPLIVSLYVKMFQGLCTLYAFCFKQTAKVIRNLP  268

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI QGK+++++R    +P++ +KN DYKE+  +R++ L+V + EKYLD  ES
Sbjct  269  SYYIIAYHYIAQGKLRDDVRGLVTRPMVAVKNADYKELTGARLKQLRVWIVEKYLDFVES  328

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  329  IWPYYCRTIRFLKRANLI  346



>gb|KDP31068.1| hypothetical protein JCGZ_11444 [Jatropha curcas]
Length=343

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P Y AVN++YG +VSKEL PLWILGP  VA YIKML+ + ALYVF FKQTV+V+KN P
Sbjct  206  FIPMYFAVNVIYGVQVSKELTPLWILGPLAVAFYIKMLRVLWALYVFSFKQTVKVLKNLP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY +A+ YI QGK+KE+I+A   QP++D KN+DYKE++K +M++ +    +KYLD  ES
Sbjct  266  TYYAVASSYISQGKLKEDIQAHVFQPMIDFKNLDYKELSKKKMKEFEEWFVDKYLDFVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>ref|XP_009112054.1| PREDICTED: uncharacterized protein LOC103837445 [Brassica rapa]
Length=346

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLWI GP +VALY+KM QG+C LY FCFKQT +V++N P
Sbjct  209  FVPAFLAVNAIYGAEVTKELSPLWIAGPLIVALYVKMFQGLCTLYAFCFKQTAKVIRNLP  268

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI QGK+++++R    +P++ +KN DYKE+  ++++ L+  L EKYLD  ES
Sbjct  269  SYYIMAYHYIAQGKLRDDVRGLVTRPMVAVKNADYKEITGAKLKQLREWLVEKYLDFVES  328

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  329  IWPYYCRTIRFLKRANLI  346



>ref|XP_010027415.1| PREDICTED: uncharacterized protein LOC104417915 [Eucalyptus grandis]
 gb|KCW83317.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
 gb|KCW83318.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
 gb|KCW83319.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
Length=336

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLA+N+ YG EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN P
Sbjct  199  FAPLYLAINVTYGREVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLP  258

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY+ A +Y+V GK+KE+I +R  QPV+D+KN+DYKE+++ ++++L+  L E+YLD  ES
Sbjct  259  VYYLTAYQYVVNGKLKEDIHSRVWQPVVDVKNLDYKELSRRKLKELQEWLLERYLDFIES  318

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRAN I
Sbjct  319  IWPYYCRTIRFLKRANFI  336



>ref|XP_011046174.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
 ref|XP_011046175.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
 ref|XP_011046176.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
Length=343

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P +LAVN++YGA VS+EL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN P
Sbjct  206  FIPLFLAVNVMYGAGVSRELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A+ YI QGK+KE+I+A  LQP+   KN+D KE ++ +M +L+  L EKYLD  ES
Sbjct  266  TYYLVASGYIRQGKLKEDIQACVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANLI
Sbjct  326  IWPYYCRAIRFLKRANLI  343



>ref|XP_010034353.1| PREDICTED: uncharacterized protein LOC104423587 [Eucalyptus grandis]
Length=223

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  700  PFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTY  521
            P YLA+N+ YG+EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN P Y
Sbjct  88   PLYLAINVTYGSEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLPVY  147

Query  520  YMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIW  341
            Y+ A +Y+  GK+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIW
Sbjct  148  YLTAYQYVANGKLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIW  207

Query  340  PYYCRAIRTLKRANLI  293
            PYYCR IR LKRAN I
Sbjct  208  PYYCRTIRFLKRANFI  223



>ref|XP_011046177.1| PREDICTED: uncharacterized protein LOC105140855 isoform X2 [Populus 
euphratica]
Length=340

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P +LAVN++YGA VS+EL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN P
Sbjct  203  FIPLFLAVNVMYGAGVSRELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY++A+ YI QGK+KE+I+A  LQP+   KN+D KE ++ +M +L+  L EKYLD  ES
Sbjct  263  TYYLVASGYIRQGKLKEDIQACVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANLI
Sbjct  323  IWPYYCRAIRFLKRANLI  340



>ref|XP_008438584.1| PREDICTED: uncharacterized protein LOC103483645 isoform X1 [Cucumis 
melo]
Length=340

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YL VN+ YGAEVS+EL PLWILGP + ALY+K+ Q ICALYVF FKQT +++ N P
Sbjct  203  FVPLYLVVNVSYGAEVSRELTPLWILGPLLTALYVKLFQWICALYVFSFKQTAKLIMNSP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY   + YI+QGK+KE+  ARF+QP+++IKN+DYKE++K ++ +L+    EKYLD  ES
Sbjct  263  SYYWTVHHYIIQGKLKEQFVARFVQPIINIKNLDYKELSKRKLIELRERAMEKYLDYVES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANL+
Sbjct  323  IWPYYCRAIRFLKRANLL  340



>ref|XP_008438592.1| PREDICTED: uncharacterized protein LOC103483645 isoform X2 [Cucumis 
melo]
Length=338

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YL VN+ YGAEVS+EL PLWILGP + ALY+K+ Q ICALYVF FKQT +++ N P
Sbjct  201  FVPLYLVVNVSYGAEVSRELTPLWILGPLLTALYVKLFQWICALYVFSFKQTAKLIMNSP  260

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY   + YI+QGK+KE+  ARF+QP+++IKN+DYKE++K ++ +L+    EKYLD  ES
Sbjct  261  SYYWTVHHYIIQGKLKEQFVARFVQPIINIKNLDYKELSKRKLIELRERAMEKYLDYVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANL+
Sbjct  321  IWPYYCRAIRFLKRANLL  338



>ref|XP_010278056.1| PREDICTED: uncharacterized protein LOC104612361 isoform X2 [Nelumbo 
nucifera]
Length=278

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL+VN+VYG EVSKEL PLW+ GP V+ALYIKML+G+CALYVF FKQ V+V+KN P
Sbjct  145  FIPWYLSVNVVYGPEVSKELTPLWVFGPLVMALYIKMLRGLCALYVFTFKQMVQVLKNLP  204

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY     Y+ QGK+ +++RA F QPV+DIKN+DYKE  + ++++ +  L +KYLD  ES
Sbjct  205  TYY----NYVAQGKLNDDLRAYFWQPVVDIKNLDYKEAFRKKLKEFEAWLVDKYLDFVES  260

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRA+LI
Sbjct  261  IWPYYCRTIRFLKRAHLI  278



>ref|XP_010248566.1| PREDICTED: uncharacterized protein LOC104591437 isoform X3 [Nelumbo 
nucifera]
Length=273

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL+VN+VYG +VSKEL PLW+ GP +VALYIKML+G+CALY+F FKQTV+V+KN P
Sbjct  140  FIPWYLSVNVVYGPKVSKELTPLWVFGPLIVALYIKMLRGLCALYIFSFKQTVQVLKNLP  199

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY     Y+ +GK+KE++ A F QPV+DIKN+D+KE+ + ++++L+  L EKYLD  ES
Sbjct  200  TYY----NYVARGKLKEDLLAYFWQPVVDIKNMDHKELFRKKLKELEAWLVEKYLDFVES  255

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKR++LI
Sbjct  256  IWPYYCRTIRFLKRSHLI  273



>ref|XP_010444166.1| PREDICTED: uncharacterized protein LOC104726903 [Camelina sativa]
Length=345

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YG EV+KEL P+W+ GP +VALYIKMLQG+CALY FCF QT+++++N P
Sbjct  208  FVPAFLAVNAIYGTEVTKELSPMWVAGPLIVALYIKMLQGLCALYAFCFNQTIKMIRNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K++++A   +PV+ IKN DYKE+  ++++  +  + EKYLD  ES
Sbjct  268  SYYLVAYHYIAHGKLKDDVKALLFRPVVAIKNTDYKELTGTKLKQFQEWIIEKYLDFVES  327

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  328  VWPYYCRTIRFLKRANLI  345



>ref|XP_010248564.1| PREDICTED: uncharacterized protein LOC104591437 isoform X2 [Nelumbo 
nucifera]
Length=305

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL+VN+VYG +VSKEL PLW+ GP +VALYIKML+G+CALY+F FKQTV+V+KN P
Sbjct  172  FIPWYLSVNVVYGPKVSKELTPLWVFGPLIVALYIKMLRGLCALYIFSFKQTVQVLKNLP  231

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY     Y+ +GK+KE++ A F QPV+DIKN+D+KE+ + ++++L+  L EKYLD  ES
Sbjct  232  TYY----NYVARGKLKEDLLAYFWQPVVDIKNMDHKELFRKKLKELEAWLVEKYLDFVES  287

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKR++LI
Sbjct  288  IWPYYCRTIRFLKRSHLI  305



>gb|EPS63513.1| hypothetical protein M569_11269, partial [Genlisea aurea]
Length=259

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P +LAVNL+YG+EVSKEL+PLW LGP +VALY+K  Q I  LYVF F+QTV+V+KN P
Sbjct  122  FTPMFLAVNLIYGSEVSKELIPLWTLGPLIVALYVKTFQLIFNLYVFTFRQTVKVIKNLP  181

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y  +A +Y+V GK+K  IR    QPV+D+KN+DYKE    ++ DL+  L EKYLD  ES
Sbjct  182  VYSTVAYDYVVSGKLKAAIRKHLFQPVVDVKNMDYKEFTLKKLNDLREWLTEKYLDFVES  241

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LKRANL+
Sbjct  242  IWPYYCRAIRFLKRANLL  259



>ref|XP_010248562.1| PREDICTED: uncharacterized protein LOC104591437 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248563.1| PREDICTED: uncharacterized protein LOC104591437 isoform X1 [Nelumbo 
nucifera]
Length=330

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL+VN+VYG +VSKEL PLW+ GP +VALYIKML+G+CALY+F FKQTV+V+KN P
Sbjct  197  FIPWYLSVNVVYGPKVSKELTPLWVFGPLIVALYIKMLRGLCALYIFSFKQTVQVLKNLP  256

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY     Y+ +GK+KE++ A F QPV+DIKN+D+KE+ + ++++L+  L EKYLD  ES
Sbjct  257  TYY----NYVARGKLKEDLLAYFWQPVVDIKNMDHKELFRKKLKELEAWLVEKYLDFVES  312

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKR++LI
Sbjct  313  IWPYYCRTIRFLKRSHLI  330



>ref|XP_010278054.1| PREDICTED: uncharacterized protein LOC104612361 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278055.1| PREDICTED: uncharacterized protein LOC104612361 isoform X1 [Nelumbo 
nucifera]
Length=335

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL+VN+VYG EVSKEL PLW+ GP V+ALYIKML+G+CALYVF FKQ V+V+KN P
Sbjct  202  FIPWYLSVNVVYGPEVSKELTPLWVFGPLVMALYIKMLRGLCALYVFTFKQMVQVLKNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY     Y+ QGK+ +++RA F QPV+DIKN+DYKE  + ++++ +  L +KYLD  ES
Sbjct  262  TYY----NYVAQGKLNDDLRAYFWQPVVDIKNLDYKEAFRKKLKEFEAWLVDKYLDFVES  317

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRA+LI
Sbjct  318  IWPYYCRTIRFLKRAHLI  335



>ref|XP_011040480.1| PREDICTED: uncharacterized protein LOC105136723 isoform X4 [Populus 
euphratica]
Length=306

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P  LA+N++YGA VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P
Sbjct  169  FIPLVLAINVIYGAGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVP  228

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++A+ YI QGK+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ES
Sbjct  229  AYYLVASGYIRQGKLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVES  288

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK+ANLI
Sbjct  289  IWPYYCRAIRFLKKANLI  306



>ref|XP_002864832.1| EMB2759 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41091.1| EMB2759 [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL P+W++GP +VALYIKM QG+C+LY FCF QT+++++N P
Sbjct  208  FVPAFLAVNAIYGAEVTKELSPMWVVGPLIVALYIKMFQGLCSLYAFCFNQTIKMIRNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K++++A   +PV+ IKN DYKE+ +++++  +  + E+YLD  ES
Sbjct  268  SYYLVAYHYIAHGKLKDDVKALVFRPVVAIKNTDYKELTRTKLKQFQEWIIERYLDFVES  327

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  328  VWPYYCRTIRFLKRANLI  345



>ref|XP_002318084.2| hypothetical protein POPTR_0012s09050g [Populus trichocarpa]
 gb|EEE96304.2| hypothetical protein POPTR_0012s09050g [Populus trichocarpa]
Length=342

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P  LA+N++YGA VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P
Sbjct  205  FIPLVLAINVIYGAGVSKELTPLWILGPLIVAIYIKLFQGLWALYVFSFRQTVKLIKNVP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++A+ YI QGK+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ES
Sbjct  265  AYYLVASGYIRQGKLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVES  324

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK+ANLI
Sbjct  325  IWPYYCRAIRFLKKANLI  342



>ref|XP_011040479.1| PREDICTED: uncharacterized protein LOC105136723 isoform X3 [Populus 
euphratica]
Length=310

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P  LA+N++YGA VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P
Sbjct  173  FIPLVLAINVIYGAGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVP  232

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++A+ YI QGK+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ES
Sbjct  233  AYYLVASGYIRQGKLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVES  292

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK+ANLI
Sbjct  293  IWPYYCRAIRFLKKANLI  310



>ref|XP_010484025.1| PREDICTED: uncharacterized protein LOC104762443 [Camelina sativa]
Length=345

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YG EV+KEL P+W+ GP +VALYIKM QG+CALY FCF QT+++++N P
Sbjct  208  FVPAFLAVNAIYGTEVTKELSPMWVAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES
Sbjct  268  SYYLVAYHYIAHGKLKDDVKALVFRPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVES  327

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  328  VWPYYCRTIRFLKRANLI  345



>gb|ABK96116.1| unknown [Populus trichocarpa]
Length=342

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P  LA+N++YGA VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P
Sbjct  205  FIPLVLAINVIYGAGVSKELTPLWILGPLIVAIYIKLFQGLWALYVFSFRQTVKLIKNVP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++A+ YI QGK+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ES
Sbjct  265  AYYLVASGYIRQGKLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVES  324

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK+ANLI
Sbjct  325  IWPYYCRAIRFLKKANLI  342



>ref|XP_006394322.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum]
 gb|ESQ31608.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum]
Length=344

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLW+ GP +VALYIKM QG+CALY FCF QT+++++N P
Sbjct  207  FVPAFLAVNAIYGAEVTKELSPLWMAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNVP  266

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+++++RA   +PV  IKN DY+E+++++++  +  + EKYLD  ES
Sbjct  267  SYYLVAYHYISHGKLRDDMRALVTRPVAAIKNTDYRELSRTKLKQFQEWIIEKYLDFVES  326

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  327  IWPYYCRTIRFLKRANLI  344



>ref|XP_011040476.1| PREDICTED: uncharacterized protein LOC105136723 isoform X1 [Populus 
euphratica]
 ref|XP_011040477.1| PREDICTED: uncharacterized protein LOC105136723 isoform X1 [Populus 
euphratica]
Length=342

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P  LA+N++YGA VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P
Sbjct  205  FIPLVLAINVIYGAGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++A+ YI QGK+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ES
Sbjct  265  AYYLVASGYIRQGKLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVES  324

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK+ANLI
Sbjct  325  IWPYYCRAIRFLKKANLI  342



>ref|XP_011040478.1| PREDICTED: uncharacterized protein LOC105136723 isoform X2 [Populus 
euphratica]
Length=339

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P  LA+N++YGA VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P
Sbjct  202  FIPLVLAINVIYGAGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++A+ YI QGK+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ES
Sbjct  262  AYYLVASGYIRQGKLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK+ANLI
Sbjct  322  IWPYYCRAIRFLKKANLI  339



>ref|XP_010545998.1| PREDICTED: uncharacterized protein LOC104818212 [Tarenaya hassleriana]
Length=343

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P ++AVN +YGA V+KEL+PLW++GP VVALYIKM QG+CALY FCF +TV +VKN P
Sbjct  206  FIPGFVAVNAIYGAGVTKELLPLWVIGPLVVALYIKMFQGLCALYAFCFSKTVNIVKNLP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y +LA  YI+QGK++E++R   ++PV+ I+ +DY++VA++R++ L+  + EKYLD  ES
Sbjct  266  AYAILAYNYIIQGKLREDVRGFVVRPVVAIRGMDYRKVARTRLKLLQDWIVEKYLDFVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>ref|XP_006280741.1| hypothetical protein CARUB_v10026710mg [Capsella rubella]
 gb|EOA13639.1| hypothetical protein CARUB_v10026710mg [Capsella rubella]
Length=345

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YG EV+KEL P+W+ GP +VALYIKM QG+CALY FCF QT+++++N P
Sbjct  208  FVPAFLAVNAIYGTEVTKELSPMWVAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK++++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES
Sbjct  268  SYYLVAYHYISHGKLRDDVKALVFRPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVES  327

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  328  VWPYYCRTIRFLKRANLI  345



>ref|XP_010459745.1| PREDICTED: uncharacterized protein LOC104740753 [Camelina sativa]
Length=344

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YG EV+KEL P+W+ GP +VALYIKM QG+CALY FCF QT+++++N P
Sbjct  207  FVPAFLAVNAIYGTEVTKELSPMWVAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNLP  266

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K++++A   +PV  IKN DYKE+ +++++  +  + EKYLD  ES
Sbjct  267  SYYLVAYHYIAHGKLKDDVKALVYRPVAAIKNTDYKELTRTKLKQFQEWIIEKYLDFVES  326

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  327  VWPYYCRTIRFLKRANLI  344



>ref|XP_007155447.1| hypothetical protein PHAVU_003G202200g [Phaseolus vulgaris]
 gb|ESW27441.1| hypothetical protein PHAVU_003G202200g [Phaseolus vulgaris]
Length=334

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F PFYLAVN VYGAEVSK+L PLW+LGP +VAL+I M + +CALYVF FKQT++V+KN P
Sbjct  197  FAPFYLAVNAVYGAEVSKDLTPLWVLGPLIVALFIMMGRWLCALYVFSFKQTIKVIKNLP  256

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y+MLA  Y+  GK+K +  A  LQP L I N DYK++ + ++++L   + EKYLD  ES
Sbjct  257  SYFMLAYSYVFCGKLKGDFDAHILQPTLSITNTDYKQLGRKKLKELSEWIVEKYLDFVES  316

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  317  IWPYYCRTIRFLKRANLI  334



>ref|XP_010051327.1| PREDICTED: uncharacterized protein LOC104440036 [Eucalyptus grandis]
Length=216

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -1

Query  700  PFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTY  521
            P YLA+N+ YG+EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN   Y
Sbjct  81   PLYLAINVTYGSEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLLVY  140

Query  520  YMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIW  341
            Y+ A +Y+  GK+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIW
Sbjct  141  YLTAYQYVANGKLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIW  200

Query  340  PYYCRAIRTLKRANLI  293
            PYYCR IR +KRAN I
Sbjct  201  PYYCRTIRFVKRANFI  216



>gb|KEH31820.1| embryo defective 2759 protein, putative [Medicago truncatula]
Length=352

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F PF+LAVN +YG EVSKEL PLW++GPF+VALYIKM+Q +CALYV+ FKQTV+V+K+ P
Sbjct  215  FAPFFLAVNAIYGPEVSKELTPLWVMGPFIVALYIKMVQVLCALYVYSFKQTVKVIKSLP  274

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            ++  LA+ Y+  GKIKE+I+   LQP+L+IKN DYK++    ++ L   + EKYLD  ES
Sbjct  275  SFCKLAHNYVFDGKIKEDIKVHILQPILNIKNADYKQLTIKLLKVLAEWIGEKYLDFVES  334

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKR+NLI
Sbjct  335  IWPYYCRTIRFLKRSNLI  352



>dbj|BAB10547.1| unnamed protein product [Arabidopsis thaliana]
Length=216

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAV  + GAEV+KEL P+W++GP ++ALYIKM QG+C+LY FCF QT+++++N P
Sbjct  79   FVPAFLAVYAICGAEVTKELSPMWVVGPLIIALYIKMFQGLCSLYAFCFNQTIKMIRNLP  138

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A +YI  GK+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES
Sbjct  139  SYYLVAYQYIADGKLKDDVKALVFKPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVES  198

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  199  VWPYYCRTIRFLKRANLI  216



>ref|XP_009150435.1| PREDICTED: uncharacterized protein LOC103873787 [Brassica rapa]
Length=325

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLWI+GP +VALYIK  QGICALY FCF QT +V++N P
Sbjct  188  FVPAFLAVNAIYGAEVTKELSPLWIVGPLIVALYIKTFQGICALYAFCFNQTTKVIRNLP  247

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K+++RA   +P++ IKN D +++ +++++ ++  + E+YLD  E 
Sbjct  248  SYYIIAYHYISHGKLKDDVRALVTRPIVAIKNTDNRQLTRTKLKQVQEWIIERYLDFVEF  307

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRAN I
Sbjct  308  IWPYYCRTIRFLKRANFI  325



>emb|CDY00350.1| BnaA06g22510D [Brassica napus]
Length=324

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLWI+GP +VALYIK  QGICALY FCF QT +V++N P
Sbjct  187  FVPAFLAVNAIYGAEVTKELSPLWIVGPLIVALYIKTFQGICALYAFCFNQTTKVIRNLP  246

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K+++RA   +P++ IKN D +++ +++++ ++  + E+YLD  E 
Sbjct  247  SYYIIAYHYISHGKLKDDVRALVTRPIVAIKNTDNRQLTRTKLKQVQEWIIERYLDFDEF  306

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRAN I
Sbjct  307  IWPYYCRTIRFLKRANFI  324



>gb|KCW83031.1| hypothetical protein EUGRSUZ_C04410, partial [Eucalyptus grandis]
Length=137

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  700  PFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTY  521
            P YLA+N+ YG+EVSKEL PLWILG  +VALY K+ +G+ ALY+F FKQTV+VVKN   Y
Sbjct  2    PLYLAINVTYGSEVSKELTPLWILGLPLVALYFKLFRGLWALYLFTFKQTVKVVKNLHVY  61

Query  520  YMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIW  341
            Y+ A +Y+  GK+KE++R+   QPV+D+KN+DYKE+++ ++++L+  L + YLD  ESIW
Sbjct  62   YLTAYQYVANGKLKEDVRSHVWQPVVDVKNLDYKELSRRKLKELQEWLLKWYLDFIESIW  121

Query  340  PYYCRAIRTLKRANLI  293
            PYYCR IR LKRAN I
Sbjct  122  PYYCRTIRFLKRANFI  137



>emb|CDX84380.1| BnaC03g51200D [Brassica napus]
Length=322

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 107/138 (78%), Gaps = 3/138 (2%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN +YGAEV+KEL PLWI+GP +VA YIK  QG+CALY FCF QT +V++N P
Sbjct  188  FVPAFLAVNAIYGAEVTKELSPLWIVGPLIVAFYIKTFQGLCALYAFCFNQTTKVIRNLP  247

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A  YI  GK+K+++RA   +P++   N DY+E+ +++++ ++  + E+YLD  ES
Sbjct  248  SYYIIAYHYISHGKLKDDLRALVTRPIV---NTDYRELTRTKLKQVQEWIIERYLDFVES  304

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  305  IWPYYCRTIRFLKRANLI  322



>ref|NP_201110.2| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana]
 gb|AAR92269.1| At5g63050 [Arabidopsis thaliana]
 gb|AAS76255.1| At5g63050 [Arabidopsis thaliana]
 gb|AED97691.1| embryo defective 2759 protein [Arabidopsis thaliana]
Length=345

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAV  + GAEV+KEL P+W++GP ++ALYIKM QG+C+LY FCF QT+++++N P
Sbjct  208  FVPAFLAVYAICGAEVTKELSPMWVVGPLIIALYIKMFQGLCSLYAFCFNQTIKMIRNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A +YI  GK+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES
Sbjct  268  SYYLVAYQYIADGKLKDDVKALVFKPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVES  327

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  328  VWPYYCRTIRFLKRANLI  345



>ref|NP_001190603.1| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana]
 gb|AED97692.1| embryo defective 2759 protein [Arabidopsis thaliana]
Length=339

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAV  + GAEV+KEL P+W++GP ++ALYIKM QG+C+LY FCF QT+++++N P
Sbjct  202  FVPAFLAVYAICGAEVTKELSPMWVVGPLIIALYIKMFQGLCSLYAFCFNQTIKMIRNLP  261

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +YY++A +YI  GK+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES
Sbjct  262  SYYLVAYQYIADGKLKDDVKALVFKPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVES  321

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR IR LKRANLI
Sbjct  322  VWPYYCRTIRFLKRANLI  339



>gb|KCW81778.1| hypothetical protein EUGRSUZ_C03135, partial [Eucalyptus grandis]
Length=130

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -1

Query  700  PFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTY  521
            P YLA+N+ YG+EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN   Y
Sbjct  2    PLYLAINVTYGSEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLLVY  61

Query  520  YMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIW  341
            Y+ A +Y+  GK+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIW
Sbjct  62   YLTAYQYVANGKLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIW  121

Query  340  PYYCRAIR  317
            PYYCR IR
Sbjct  122  PYYCRTIR  129



>gb|KHN30931.1| hypothetical protein glysoja_017468 [Glycine soja]
Length=296

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVSKEL PLWILGPF+VA  +  ++ +CALYVF FKQTV+++KN P
Sbjct  159  FVPLYLAVNVKYGAEVSKELTPLWILGPFIVATQVLAIRWLCALYVFSFKQTVKLLKNSP  218

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y +LA+ Y+ +GK+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ES
Sbjct  219  SYCILAHSYVFRGKLKEDISTYVLQPILSVKNRDYKQLTRKKLKELQEWIVEMYLDYVES  278

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  279  IWPYYCRTIRFLKRANLI  296



>gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Erythranthe guttata]
Length=337

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAV + YG++VSKEL PLWILGP   ALY+KM + IC +Y F FKQT ++VKN P
Sbjct  200  FTPLYLAVYVAYGSKVSKELTPLWILGPLFAALYVKMFRAICKVYGFSFKQTAKLVKNLP  259

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             YY++ +++IV GK+ E  R    +P+  IKN DYKE+ K+RM+DL+    E+YLD  ES
Sbjct  260  VYYLVVHDHIVNGKLNEATRRHIFEPLAVIKNTDYKELTKNRMKDLQGWFVERYLDFVES  319

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  320  IWPYYCRTIRFLKRANLI  337



>ref|XP_004508882.1| PREDICTED: uncharacterized protein LOC101499621 isoform X2 [Cicer 
arietinum]
 ref|XP_004508883.1| PREDICTED: uncharacterized protein LOC101499621 isoform X3 [Cicer 
arietinum]
Length=338

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F PF+LAVN +YGAEVSKEL PLW++GP +VALYI M++ +CALYV+ FKQTV+V+K+ P
Sbjct  201  FAPFFLAVNAIYGAEVSKELTPLWVMGPLIVALYIMMVRVLCALYVYSFKQTVKVIKSLP  260

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y  LA  Y+  GK+KE+I+A  LQP+L IKN DYK++ +  ++ L   + E+YLD  ES
Sbjct  261  SYCNLAYSYVYDGKLKEDIKAHILQPILSIKNADYKQLTRKMLKVLAEWIGERYLDFVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK +NLI
Sbjct  321  IWPYYCRTIRFLKSSNLI  338



>ref|XP_004508881.1| PREDICTED: uncharacterized protein LOC101499621 isoform X1 [Cicer 
arietinum]
Length=347

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F PF+LAVN +YGAEVSKEL PLW++GP +VALYI M++ +CALYV+ FKQTV+V+K+ P
Sbjct  210  FAPFFLAVNAIYGAEVSKELTPLWVMGPLIVALYIMMVRVLCALYVYSFKQTVKVIKSLP  269

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y  LA  Y+  GK+KE+I+A  LQP+L IKN DYK++ +  ++ L   + E+YLD  ES
Sbjct  270  SYCNLAYSYVYDGKLKEDIKAHILQPILSIKNADYKQLTRKMLKVLAEWIGERYLDFVES  329

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK +NLI
Sbjct  330  IWPYYCRTIRFLKSSNLI  347



>emb|CDP12656.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN++YGAEVS+EL PLW+LGP + ALY+K+ +GI ALYVF FKQTV+++ + P
Sbjct  219  FIPLYLAVNIIYGAEVSRELTPLWVLGPLIAALYVKLWRGIGALYVFSFKQTVKLLISLP  278

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            T+Y++A++YI  GK+  ++     QP++D++N+DYK  +K ++++L++ + EKYLD  ES
Sbjct  279  TWYLVAHDYIGNGKL-NQVVGHLFQPLVDLRNMDYKGASKRKLKELEIFVVEKYLDFVES  337

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  338  IWPYYCRTIRFLKRANLI  355



>ref|XP_010942418.1| PREDICTED: uncharacterized protein LOC105060428 [Elaeis guineensis]
Length=340

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL V +VYG EV+KEL PLWILGP +VALYIK++QG+C+LY+F F Q VR+VKN P
Sbjct  203  FIPWYLTVRVVYGVEVTKELTPLWILGPLIVALYIKIIQGLCSLYLFVFMQAVRLVKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +L + YI +GK+K    A F +P++DIKN+DY+++ + + + L     EKYLD  ES
Sbjct  263  TYSLLVHNYIAEGKLKAVFWALFWKPIIDIKNLDYRDLFRQKAQQLGEWAGEKYLDFIES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK+A+LI
Sbjct  323  IWPYYCRTIRFLKKAHLI  340



>dbj|BAB82451.1| PBng110 [Vigna radiata]
Length=198

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVSKEL PLWILGP +VA+ + +++ +CALY F FKQTV++ KN P
Sbjct  61   FVPLYLAVNVKYGAEVSKELTPLWILGPLIVAMQVMIIRWLCALYAFSFKQTVKLFKNSP  120

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y + A  YI +GK+KE+I    LQP+L  KN DY+++ + ++++L+  + E+YLD  ES
Sbjct  121  SYCISAYSYIFRGKLKEDISTNVLQPILSAKNRDYRQLTRKKLKELQDWVLERYLDYVES  180

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  181  IWPYYCRTIRFLKRANLI  198



>ref|NP_001242677.1| uncharacterized protein LOC100798149 [Glycine max]
 gb|ACU22822.1| unknown [Glycine max]
Length=332

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVSKEL PLWILGPF+VA  +  ++ +CALYVF FKQTV+++KN P
Sbjct  195  FVPPYLAVNVKYGAEVSKELTPLWILGPFIVATQVLAIRWLCALYVFSFKQTVKLLKNSP  254

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            +Y +LA+ Y+ +GK+KE+I     QP+L +KN DYK++ + ++++L+  + E YLD  ES
Sbjct  255  SYCILAHSYVFRGKLKEDISTYVPQPILSVKNRDYKQLTRKKLKELQEWIVEMYLDYVES  314

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  315  IWPYYCRTIRFLKRANLI  332



>ref|XP_010670202.1| PREDICTED: uncharacterized protein LOC104887288 [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 109/138 (79%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YG +VS+EL PLWI+GP +VALY+K+L+GI ALYVF FKQ+V+VVKN P
Sbjct  205  FIPLYLAVNVKYGGQVSRELTPLWIVGPLIVALYVKLLRGIFALYVFSFKQSVKVVKNLP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TYY +A  Y+ +GK++    A+F QP +++K +D+KE++ S+ + ++  + EKYLD  ES
Sbjct  265  TYYSIACNYLAEGKLQ----AQFWQPFINVKGMDHKELSTSKWKVVQEWMYEKYLDFVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR IR LKRANL+
Sbjct  321  IWPHYCRTIRFLKRANLM  338



>ref|XP_007138040.1| hypothetical protein PHAVU_009G176100g [Phaseolus vulgaris]
 gb|ESW10034.1| hypothetical protein PHAVU_009G176100g [Phaseolus vulgaris]
Length=332

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVSKEL PLWILGP +VA  + +++ +CALY F FKQTV + KN P
Sbjct  195  FVPLYLAVNVKYGAEVSKELTPLWILGPLIVATQVMIMRWLCALYAFSFKQTVNLFKNSP  254

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            ++ +LA  YI +GK+KE+I    LQP+L +KN DY+++ + ++++L+  + E YLD  ES
Sbjct  255  SFCILAYSYIFRGKLKEDISTNVLQPILSVKNRDYRQLTRKKLKELQKWIMEMYLDYVES  314

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR IR LKRANLI
Sbjct  315  IWPFYCRTIRFLKRANLI  332



>ref|XP_011101307.1| PREDICTED: uncharacterized protein LOC105179393 [Sesamum indicum]
Length=339

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F P YLAVNLVYG++VSKEL PLWILGP V+ALYIK+ + IC LY F FKQT+++ K+ P
Sbjct  206  FTPLYLAVNLVYGSKVSKELTPLWILGPLVIALYIKIFRAICVLYAFSFKQTIKIAKSLP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y++L ++YI  GK+KE ++   LQPV DIK++DY  V K    DL+  L E+YLD  E 
Sbjct  266  AYHLLLHDYIFHGKLKEAMKKHILQPVEDIKSMDYILVIK----DLQRWLVERYLDFIEL  321

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR +R LKRANLI
Sbjct  322  IWPFYCRTLRFLKRANLI  339



>gb|KHN19278.1| hypothetical protein glysoja_012198 [Glycine soja]
Length=340

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YGAEVSKEL PLWILGP +VA  I  ++ +CALYVF FKQTV+++KN P
Sbjct  203  FIPLYLAVNVKYGAEVSKELTPLWILGPLIVATQILAIRWLCALYVFSFKQTVKLLKNSP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y +LA  Y+ +GK+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ES
Sbjct  263  YYCILAYSYVFRGKLKEDISTYVLQPILRVKNRDYKQLIRKKLKELQEWIVEMYLDYVES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  323  IWPYYCRTIRFLKRANLI  340



>ref|XP_009399545.1| PREDICTED: uncharacterized protein LOC103983918 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL V +VYGAEV+KELMPLWILGP + ALYIK++QG+C+LYVF F Q VR++KN P
Sbjct  201  FIPWYLTVKMVYGAEVTKELMPLWILGPLIFALYIKIIQGLCSLYVFVFMQAVRLIKNLP  260

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y +L   +I +GK++  +   F++P++DIKN+DY   ++ + +       EKYLD  ES
Sbjct  261  RYSLLVYNFIAEGKLRAYLWDHFVKPIVDIKNMDYGAFSRRKYKQFVTWAVEKYLDYVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK+A+LI
Sbjct  321  IWPYYCRTIRFLKKAHLI  338



>ref|XP_008782690.1| PREDICTED: uncharacterized protein LOC103702154 [Phoenix dactylifera]
Length=340

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL V LVYG EV+KEL PLW+LGP +VALYIK+++G+C+LY+F F Q VR+VKN P
Sbjct  203  FIPWYLTVKLVYGVEVTKELTPLWVLGPLIVALYIKIIEGLCSLYLFLFMQAVRLVKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY +L + YI +GK+K  + A F +P+++IKN+DY+ + + +++ L+    EKYLD  ES
Sbjct  263  TYSLLVHNYINEGKLKAFLWALFWKPLINIKNLDYRALFRGKVKQLEEWAVEKYLDYIES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK+A+LI
Sbjct  323  IWPYYCRTIRFLKKAHLI  340



>ref|XP_003527009.1| PREDICTED: uncharacterized protein LOC100802447 isoform X1 [Glycine 
max]
Length=332

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YGAEVSKEL PLWILGP +VA  I  ++ +CALYVF F QTV+++KN P
Sbjct  195  FIPLYLAVNVKYGAEVSKELTPLWILGPLIVATQILAIRWLCALYVFSFNQTVKLLKNSP  254

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y +LA  Y+ +GK+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ES
Sbjct  255  YYCILAYSYVFRGKLKEDISTYVLQPILRVKNRDYKQLIRKKLKELQEWIVEMYLDYVES  314

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  315  IWPYYCRTIRFLKRANLI  332



>ref|XP_006581918.1| PREDICTED: uncharacterized protein LOC100802447 isoform X2 [Glycine 
max]
 ref|XP_006581919.1| PREDICTED: uncharacterized protein LOC100802447 isoform X3 [Glycine 
max]
Length=343

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YLAVN+ YGAEVSKEL PLWILGP +VA  I  ++ +CALYVF F QTV+++KN P
Sbjct  206  FIPLYLAVNVKYGAEVSKELTPLWILGPLIVATQILAIRWLCALYVFSFNQTVKLLKNSP  265

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y +LA  Y+ +GK+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ES
Sbjct  266  YYCILAYSYVFRGKLKEDISTYVLQPILRVKNRDYKQLIRKKLKELQEWIVEMYLDYVES  325

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LKRANLI
Sbjct  326  IWPYYCRTIRFLKRANLI  343



>ref|XP_006476824.1| PREDICTED: uncharacterized protein LOC102631155 isoform X1 [Citrus 
sinensis]
 ref|XP_006476825.1| PREDICTED: uncharacterized protein LOC102631155 isoform X2 [Citrus 
sinensis]
 ref|XP_006476826.1| PREDICTED: uncharacterized protein LOC102631155 isoform X3 [Citrus 
sinensis]
Length=338

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN+ YGAEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P
Sbjct  208  FVPVFLAVNVAYGAEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
                 A  Y+ QGK+KE+++ R   P   I N+D +++ +  +++ K  L E YLD  ES
Sbjct  268  A----ACRYVAQGKLKEDVQVRVWDP---INNLDKEQLFRKTLKEFKEWLTESYLDFVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR IR LKRA+LI
Sbjct  321  IWPHYCRTIRFLKRAHLI  338



>ref|XP_006439862.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439863.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439865.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439866.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53102.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53103.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53105.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53106.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
Length=338

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN+ YGAEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P
Sbjct  208  FVPVFLAVNVAYGAEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
                 A  Y+ QGK+KE+++ R   P   I N+D +++ +  +++ K  L E YLD  ES
Sbjct  268  A----ACRYVAQGKLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKKWLTESYLDFVES  320

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR IR LKRA+LI
Sbjct  321  IWPHYCRTIRFLKRAHLI  338



>ref|XP_006439864.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53104.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
Length=335

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN+ YGAEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P
Sbjct  205  FVPVFLAVNVAYGAEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLP  264

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
                 A  Y+ QGK+KE+++ R   P   I N+D +++ +  +++ K  L E YLD  ES
Sbjct  265  A----ACRYVAQGKLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKKWLTESYLDFVES  317

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR IR LKRA+LI
Sbjct  318  IWPHYCRTIRFLKRAHLI  335



>ref|XP_010923746.1| PREDICTED: uncharacterized protein LOC105046751 [Elaeis guineensis]
 ref|XP_010923747.1| PREDICTED: uncharacterized protein LOC105046751 [Elaeis guineensis]
Length=340

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL V LVYG EV+KEL PLW+LGP +VA YIK++QG+C LY+F F Q  R++KN P
Sbjct  203  FIPWYLTVKLVYGVEVTKELTPLWVLGPLIVAFYIKIIQGLCLLYLFLFMQASRLIKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y  L   YI  GK+K  I A F +P++DIKN+DYK + + + + L+    EKYLD  E 
Sbjct  263  IYSSLVYTYIAPGKLKAFIWALFWKPIIDIKNLDYKALLRQKFKQLEEWALEKYLDFIEL  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK+A+ I
Sbjct  323  IWPYYCRTIRFLKKAHFI  340



>ref|XP_008787333.1| PREDICTED: uncharacterized protein LOC103705411 isoform X1 [Phoenix 
dactylifera]
Length=340

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P+YL V LVYG EV+KEL PLW+LGP +VA YIK++QG+C+LY F F Q V +VKN P
Sbjct  203  FIPWYLTVKLVYGVEVTKELTPLWVLGPLIVAFYIKIIQGLCSLYFFLFMQAVSLVKNLP  262

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y  L   YI +GK+K  + A F +P++ IKN+DY+ + + + + L+    EKYLD  ES
Sbjct  263  IYSSLVYTYIAEGKLKAFLWALFWKPIIVIKNLDYRALFRQKFKQLEEWAVEKYLDYIES  322

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCR IR LK+A+LI
Sbjct  323  IWPYYCRTIRFLKKAHLI  340



>ref|XP_008464548.1| PREDICTED: uncharacterized protein LOC103502398 isoform X1 [Cucumis 
melo]
Length=333

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F+P YL + + YGA+VSKELMPLW+ GPF+VA YIKM   +C L +  FK+T  ++KNF 
Sbjct  196  FIPLYLTIKIFYGAQVSKELMPLWVFGPFIVAFYIKMFHWLCCLSILSFKRTAYLMKNFL  255

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
             Y+ L   Y+  G++KE +RAR  QP+++I+++ YKE+++ + + ++  + E+YLD  E 
Sbjct  256  CYFKLVCGYVSHGRLKEVVRARVWQPLVNIRSLHYKELSRRKFQFMQEWIMERYLDFLEL  315

Query  346  IWPYYCRAIRTLKRANLI  293
            +WPYYCR+IR LKRANL+
Sbjct  316  VWPYYCRSIRFLKRANLV  333



>ref|XP_004501900.1| PREDICTED: uncharacterized protein LOC101490180 [Cicer arietinum]
Length=197

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ +GAEVSKEL PLWI GP +VA++I +++G+CALY   F +TV+++   P
Sbjct  60   FVPLYLAVNVKFGAEVSKELTPLWIFGPLIVAIHIMIIRGLCALYALSFNRTVKILSKLP  119

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            ++ +L N YI  G +KE I    L+P+L +K+IDY ++ +  ++ L+  L +KYLD  ES
Sbjct  120  SFCILVNNYIFGGVLKEHIGVYLLRPILSLKDIDYIQLTRRILKVLQEWLVDKYLDYVES  179

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR +R LK +NLI
Sbjct  180  IWPHYCRTVRFLKTSNLI  197



>ref|XP_003601234.1| hypothetical protein MTR_3g077490 [Medicago truncatula]
 gb|AES71485.1| embryo defective 2759 protein [Medicago truncatula]
Length=332

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVSKEL PLW+ GP +VAL+I +++G+CALY   F +TV +++  P
Sbjct  195  FVPLYLAVNVKYGAEVSKELTPLWVFGPLIVALHIIIIRGLCALYASSFNRTVEILRKVP  254

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            ++ +LAN YI  G +KE+I    L+P+  +K+IDY ++ +  ++ L+  L +KYLD  ES
Sbjct  255  SWCILANYYIFGGGLKEQIAVYLLRPISSLKHIDYIQLTRRILKVLQEWLMDKYLDYVES  314

Query  346  IWPYYCRAIRTLKRANLI  293
            IWPYYCRAIR LK +NLI
Sbjct  315  IWPYYCRAIRFLKTSNLI  332



>ref|XP_004501898.1| PREDICTED: uncharacterized protein LOC101489640 isoform X1 [Cicer 
arietinum]
 ref|XP_004501899.1| PREDICTED: uncharacterized protein LOC101489640 isoform X2 [Cicer 
arietinum]
Length=331

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ +GAEVSKEL PLWI GP +VA++I +++G+CALY   F +TV+++   P
Sbjct  194  FVPLYLAVNVKFGAEVSKELTPLWIFGPLIVAIHIMIIRGLCALYALSFNRTVKILSKLP  253

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            ++ +L N YI  G +KE I    L+P+L +K+IDY ++ +  ++ L+  L +KYLD  ES
Sbjct  254  SFCILVNNYIFGGVLKEHIGVYLLRPILSLKDIDYIQLTRRILKVLQEWLVDKYLDYVES  313

Query  346  IWPYYCRAIRTLKRANLI  293
            IWP+YCR +R LK +NLI
Sbjct  314  IWPHYCRTVRFLKTSNLI  331



>gb|KJB08225.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
Length=307

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -1

Query  583  CALYVFCFKQTVRVVKNFPTYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKS  404
            CALYV C KQT+++V N PTYY++A  YI  GK+KEE+RAR  QPV++IKN+DYKE+++ 
Sbjct  211  CALYVLCLKQTLQIVGNLPTYYVVAYNYIAHGKLKEEVRARVWQPVVNIKNLDYKELSRR  270

Query  403  RMEDLKVILAEKYLDLAESIWPYYCRAIRTLKRANLI  293
            +M+D +  + E Y+D+ ES+WPYYCR IR LKRAN+I
Sbjct  271  KMKDFQEWMMENYVDIVESVWPYYCRTIRFLKRANII  307



>ref|XP_004157782.1| PREDICTED: uncharacterized protein LOC101229897 [Cucumis sativus]
Length=331

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 92/138 (67%), Gaps = 7/138 (5%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVS+EL PLWILGP V A YIK+   +CAL +F F Q V+++ N P
Sbjct  201  FVPLYLAVNVFYGAEVSRELTPLWILGPLVTAFYIKICHWMCALCIFSFMQAVKLILNSP  260

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY+ +   YI++GK+ E    RF+Q ++    ID K + K ++ +L+    EKYLD  ES
Sbjct  261  TYFWIVYHYIIRGKLVE----RFMQSII---KIDLKALPKRKLMELRGWAIEKYLDYVES  313

Query  346  IWPYYCRAIRTLKRANLI  293
             W  Y R IR LKRA+LI
Sbjct  314  NWQRYFRTIRFLKRAHLI  331



>emb|CDX72055.1| BnaC08g28190D [Brassica napus]
Length=294

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 79/104 (76%), Gaps = 3/104 (3%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LA N +YGAEV+KE  PLWI+GP +VA YIK  QG+CALY FCF QT +V++N P
Sbjct  188  FVPAFLAYNAIYGAEVTKESSPLWIVGPLIVAFYIKTFQGLCALYAFCFNQTTKVIRNLP  247

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRME  395
            +YY++A  YI  GK+K+++RA   +P++   N DY+E+ +++++
Sbjct  248  SYYIIAYHYISHGKLKDDLRALVTRPIV---NTDYRELTRTKLK  288



>ref|XP_004152483.1| PREDICTED: uncharacterized protein LOC101204576 [Cucumis sativus]
 gb|KGN64325.1| hypothetical protein Csa_1G046220 [Cucumis sativus]
Length=331

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP YLAVN+ YGAEVS+EL PLWILGP V A YIK+   +CAL +F F Q V+++ N P
Sbjct  201  FVPLYLAVNVFYGAEVSRELTPLWILGPLVTAFYIKICHWMCALCIFSFMQAVKLILNSP  260

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAES  347
            TY  +   YI++GK+ E    RF+Q ++    ID K + K ++ +L+    EKYLD  ES
Sbjct  261  TYLWIVYHYIIRGKLVE----RFMQSII---KIDLKALPKRKLMELRGWAIEKYLDYVES  313

Query  346  IWPYYCRAIRTLKRANLI  293
             W  Y R IR LKRA+LI
Sbjct  314  NWQRYFRTIRFLKRAHLI  331



>gb|KDO69572.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69573.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
Length=290

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 7/115 (6%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN+ YGAEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P
Sbjct  172  FVPVFLAVNVAYGAEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLP  231

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYL  362
                 A  Y+ QGK+KE+++ R   P   I N+D +++ +  +++ K +   + L
Sbjct  232  A----ACRYVAQGKLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKRVANRELL  279



>gb|KDO69567.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69568.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69569.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69570.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69571.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
Length=326

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 7/115 (6%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            FVP +LAVN+ YGAEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P
Sbjct  208  FVPVFLAVNVAYGAEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLP  267

Query  526  TYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYL  362
                 A  Y+ QGK+KE+++ R   P   I N+D +++ +  +++ K +   + L
Sbjct  268  A----ACRYVAQGKLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKRVANRELL  315



>gb|ABK21678.1| unknown [Picea sitchensis]
 gb|ABR16281.1| unknown [Picea sitchensis]
Length=321

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 63/147 (43%), Gaps = 25/147 (17%)
 Frame = -1

Query  706  FVPFYLAVNLVYGAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFP  527
            F  +Y A+ + YG   S +L+PLWI+GP ++ ++IK+ Q +   Y  C + T  VV    
Sbjct  183  FFSWYFAITVFYGFRASNDLLPLWIIGPLMMGIFIKLCQTV---YAHCIRITTNVVN---  236

Query  526  TYYMLANEYIVQGKIKEEIRARFLQ--PVLDIKNIDYKEVAKSRMEDLKVILAEKYL---  362
                +     +  K  +  R   LQ     +IK  +     K   E LK  L +K     
Sbjct  237  ----MGKATCIAAKNGDLTRPMLLQFEQFFEIKRSELVYFLKG--EGLKDFLQQKRREYE  290

Query  361  --------DLAESIWPYYCRAIRTLKR  305
                    D AE+ WP Y    R L++
Sbjct  291  ERIEEAIQDYAEANWPRYRATTRFLRK  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350