BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024M09

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794621.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    295   4e-94   Nicotiana sylvestris
ref|XP_009620725.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    295   5e-94   Nicotiana tomentosiformis
ref|XP_011077121.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    285   3e-90   
emb|CDP20135.1|  unnamed protein product                                285   4e-90   Coffea canephora [robusta coffee]
ref|XP_004250074.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    285   4e-90   Solanum lycopersicum
ref|XP_004493124.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    281   6e-89   Cicer arietinum [garbanzo]
gb|KGN61333.1|  hypothetical protein Csa_2G091770                       276   9e-89   Cucumis sativus [cucumbers]
gb|KHN00653.1|  Omega-hydroxypalmitate O-feruloyl transferase           272   6e-88   Glycine soja [wild soybean]
ref|XP_011016099.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    273   7e-88   Populus euphratica
gb|KJB26880.1|  hypothetical protein B456_004G264500                    277   3e-87   Gossypium raimondii
ref|XP_004138891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    277   4e-87   Cucumis sativus [cucumbers]
ref|XP_010673872.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    276   9e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002270329.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    276   1e-86   Vitis vinifera
ref|XP_002316174.2|  hypothetical protein POPTR_0010s18710g             275   2e-86   
ref|XP_010110380.1|  Omega-hydroxypalmitate O-feruloyl transferase      270   3e-86   
ref|XP_011014891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    275   3e-86   Populus euphratica
emb|CAN73821.1|  hypothetical protein VITISV_014805                     273   4e-86   Vitis vinifera
gb|KDP26918.1|  hypothetical protein JCGZ_18076                         274   6e-86   Jatropha curcas
ref|XP_010093570.1|  Omega-hydroxypalmitate O-feruloyl transferase      268   1e-85   
gb|KHN13415.1|  Omega-hydroxypalmitate O-feruloyl transferase           272   2e-85   Glycine soja [wild soybean]
ref|XP_007151622.1|  hypothetical protein PHAVU_004G062600g             272   2e-85   Phaseolus vulgaris [French bean]
ref|XP_003548930.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    272   3e-85   Glycine max [soybeans]
gb|KDO45315.1|  hypothetical protein CISIN_1g012689mg                   271   5e-85   Citrus sinensis [apfelsine]
ref|XP_006425205.1|  hypothetical protein CICLE_v10010861mg             271   5e-85   Citrus clementina [clementine]
ref|XP_006480697.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    271   5e-85   Citrus sinensis [apfelsine]
ref|XP_003519943.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    271   1e-84   Glycine max [soybeans]
ref|XP_008370853.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    272   1e-84   
ref|XP_009361568.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    271   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_007028077.1|  HXXXD-type acyl-transferase family protein         270   2e-84   
gb|KHG26258.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    270   2e-84   Gossypium arboreum [tree cotton]
ref|XP_006353264.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    270   2e-84   Solanum tuberosum [potatoes]
ref|NP_001185319.1|  dual transcription unit and alternative spli...    264   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556190.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    265   1e-82   Tarenaya hassleriana [spider flower]
ref|NP_564853.2|  dual transcription unit and alternative splicin...    265   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886918.1|  hypothetical protein ARALYDRAFT_315582             263   8e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_002514787.1|  Anthranilate N-benzoyltransferase protein, p...    261   3e-81   Ricinus communis
ref|XP_003624566.1|  Anthranilate N-benzoyltransferase protein          261   5e-81   Medicago truncatula
ref|XP_003553994.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    261   6e-81   Glycine max [soybeans]
gb|KHN46377.1|  Omega-hydroxypalmitate O-feruloyl transferase           261   6e-81   Glycine soja [wild soybean]
gb|AHA84252.1|  omega-hydroxypalmitate O-feruloyl transferase           261   8e-81   Phaseolus vulgaris [French bean]
ref|XP_008218487.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    261   1e-80   Prunus mume [ume]
ref|XP_010038444.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    260   1e-80   Eucalyptus grandis [rose gum]
gb|KHN46812.1|  Omega-hydroxypalmitate O-feruloyl transferase           258   3e-80   Glycine soja [wild soybean]
ref|XP_011466087.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    261   4e-80   Fragaria vesca subsp. vesca
ref|XP_003548796.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    258   5e-80   Glycine max [soybeans]
ref|XP_007205121.1|  hypothetical protein PRUPE_ppa004875mg             259   8e-80   Prunus persica
gb|EYU39480.1|  hypothetical protein MIMGU_mgv1a027110mg                255   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_006301983.1|  hypothetical protein CARUB_v10022464mg             256   6e-79   Capsella rubella
ref|XP_010415082.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    252   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010511440.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    251   2e-77   
ref|XP_010470417.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    251   3e-77   Camelina sativa [gold-of-pleasure]
emb|CDY07450.1|  BnaA07g25290D                                          246   5e-77   Brassica napus [oilseed rape]
ref|XP_006391555.1|  hypothetical protein EUTSA_v10018535mg             251   5e-77   Eutrema salsugineum [saltwater cress]
gb|EPS57259.1|  hypothetical protein M569_17562                         246   6e-77   Genlisea aurea
emb|CDY16408.1|  BnaA02g12120D                                          248   8e-76   Brassica napus [oilseed rape]
ref|XP_009127402.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    247   1e-75   Brassica rapa
emb|CDY39285.1|  BnaC06g27060D                                          247   1e-75   Brassica napus [oilseed rape]
ref|XP_007161775.1|  hypothetical protein PHAVU_001G097400g             238   6e-74   Phaseolus vulgaris [French bean]
ref|XP_010241521.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    242   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010268237.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    237   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008802387.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    227   3e-69   
ref|XP_010912121.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    222   5e-66   Elaeis guineensis
ref|XP_011075071.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    219   7e-65   Sesamum indicum [beniseed]
ref|XP_003624564.1|  Omega-hydroxypalmitate O-feruloyl transferase      215   2e-63   
gb|EYU39979.1|  hypothetical protein MIMGU_mgv1a005557mg                214   9e-63   Erythranthe guttata [common monkey flower]
ref|XP_010255141.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    210   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_011100415.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   5e-58   Sesamum indicum [beniseed]
ref|XP_006858654.1|  hypothetical protein AMTR_s00066p00062130          199   1e-56   
gb|EYU20701.1|  hypothetical protein MIMGU_mgv1a023965mg                196   7e-56   Erythranthe guttata [common monkey flower]
gb|EYU34262.1|  hypothetical protein MIMGU_mgv1a025490mg                191   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_011100416.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    194   2e-55   Sesamum indicum [beniseed]
gb|AAT72495.1|  AT1G65450                                               185   9e-55   Arabidopsis lyrata subsp. petraea
gb|EYU34269.1|  hypothetical protein MIMGU_mgv1a006390mg                192   1e-54   Erythranthe guttata [common monkey flower]
gb|EYU17601.1|  hypothetical protein MIMGU_mgv1a006316mg                192   1e-54   Erythranthe guttata [common monkey flower]
ref|XP_011078800.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    191   2e-54   Sesamum indicum [beniseed]
gb|EYU17599.1|  hypothetical protein MIMGU_mgv1a006131mg                190   1e-53   Erythranthe guttata [common monkey flower]
gb|EYU17598.1|  hypothetical protein MIMGU_mgv1a006131mg                190   1e-53   Erythranthe guttata [common monkey flower]
gb|EYU17596.1|  hypothetical protein MIMGU_mgv1a021071mg                186   5e-53   Erythranthe guttata [common monkey flower]
ref|XP_006858657.1|  hypothetical protein AMTR_s00066p00063330          186   9e-52   Amborella trichopoda
gb|ACN57286.1|  At1g65450-like protein                                  174   1e-50   Capsella rubella
gb|ACN57299.1|  At1g65450-like protein                                  173   2e-50   Capsella grandiflora
gb|ACN57300.1|  At1g65450-like protein                                  173   2e-50   Capsella grandiflora
gb|ACN57301.1|  At1g65450-like protein                                  171   1e-49   Capsella grandiflora
gb|ACN57307.1|  At1g65450-like protein                                  171   2e-49   Capsella grandiflora
gb|ACN57306.1|  At1g65450-like protein                                  171   2e-49   Capsella grandiflora
gb|EYU17594.1|  hypothetical protein MIMGU_mgv1a006220mg                174   7e-48   Erythranthe guttata [common monkey flower]
gb|ACN57305.1|  At1g65450-like protein                                  166   2e-47   Capsella grandiflora
gb|ACN57304.1|  At1g65450-like protein                                  165   2e-47   Capsella grandiflora
gb|ACN57302.1|  At1g65450-like protein                                  165   3e-47   Capsella grandiflora
gb|ADL37203.1|  At1g65450-like protein                                  164   6e-47   Arabidopsis lyrata subsp. lyrata
gb|ADL37205.1|  At1g65450-like protein                                  163   2e-46   Arabidopsis lyrata subsp. lyrata
gb|ADL37207.1|  At1g65450-like protein                                  163   2e-46   Arabidopsis lyrata subsp. lyrata
gb|ADL37212.1|  At1g65450-like protein                                  162   3e-46   Arabidopsis lyrata subsp. lyrata
gb|ADL37208.1|  At1g65450-like protein                                  162   3e-46   Arabidopsis lyrata subsp. lyrata
gb|ADL37221.1|  At1g65450-like protein                                  162   5e-46   Arabidopsis lyrata subsp. lyrata
gb|ACB41562.1|  At1g65450-like protein                                  161   6e-46   Arabidopsis arenosa
gb|ACB41560.1|  At1g65450-like protein                                  161   7e-46   Arabidopsis arenosa
gb|ADL37204.1|  At1g65450-like protein                                  162   7e-46   Arabidopsis lyrata subsp. lyrata
gb|EYU17590.1|  hypothetical protein MIMGU_mgv1a026424mg                164   1e-45   Erythranthe guttata [common monkey flower]
gb|ACB41561.1|  At1g65450-like protein                                  160   1e-45   Arabidopsis arenosa
gb|ADL37211.1|  At1g65450-like protein                                  161   1e-45   Arabidopsis lyrata subsp. lyrata
gb|ACB41559.1|  At1g65450-like protein                                  160   1e-45   Arabidopsis arenosa
gb|ADL37213.1|  At1g65450-like protein                                  160   2e-45   Arabidopsis lyrata subsp. lyrata
gb|ADL37209.1|  At1g65450-like protein                                  160   2e-45   Arabidopsis lyrata subsp. lyrata
gb|ADL37307.1|  At1g65450-like protein                                  158   2e-44   Arabidopsis lyrata subsp. lyrata
gb|ACB41564.1|  At1g65450-like protein                                  155   2e-43   Arabidopsis suecica
gb|ADL37215.1|  At1g65450-like protein                                  154   4e-43   Arabidopsis lyrata subsp. lyrata
gb|ACB41569.1|  At1g65450-like protein                                  152   2e-42   Arabidopsis suecica
ref|XP_007035554.1|  BAHD family acyltransferase, clade V, putative     159   5e-42   
gb|EYU24129.1|  hypothetical protein MIMGU_mgv1a020263mg                157   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_010930413.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    157   2e-41   Elaeis guineensis
gb|EYU34268.1|  hypothetical protein MIMGU_mgv1a005307mg                153   1e-39   Erythranthe guttata [common monkey flower]
gb|ABK24776.1|  unknown                                                 149   1e-38   Picea sitchensis
ref|XP_008786402.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    149   3e-38   Phoenix dactylifera
gb|EYU34266.1|  hypothetical protein MIMGU_mgv1a023386mg                148   3e-38   Erythranthe guttata [common monkey flower]
ref|XP_011071659.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    145   4e-37   Sesamum indicum [beniseed]
ref|XP_009415665.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    139   1e-34   
gb|EYU24114.1|  hypothetical protein MIMGU_mgv1a018501mg                130   5e-34   Erythranthe guttata [common monkey flower]
ref|XP_002992378.1|  BAHD family acyltransferase, clade V               136   7e-34   
ref|XP_002967754.1|  BAHD family acyltransferase, clade V               136   8e-34   Selaginella moellendorffii
ref|XP_010666009.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    132   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010259678.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    132   3e-32   Nelumbo nucifera [Indian lotus]
gb|EYU45561.1|  hypothetical protein MIMGU_mgv1a005829mg                130   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_004491723.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    129   2e-31   Cicer arietinum [garbanzo]
gb|KDP26368.1|  hypothetical protein JCGZ_17526                         127   1e-30   Jatropha curcas
gb|EYU20679.1|  hypothetical protein MIMGU_mgv1a006412mg                127   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_010248037.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    127   1e-30   Nelumbo nucifera [Indian lotus]
gb|KDO64448.1|  hypothetical protein CISIN_1g013997mg                   126   3e-30   Citrus sinensis [apfelsine]
ref|XP_006436888.1|  hypothetical protein CICLE_v10031592mg             125   8e-30   Citrus clementina [clementine]
ref|XP_007140651.1|  hypothetical protein PHAVU_008G130300g             124   1e-29   Phaseolus vulgaris [French bean]
ref|XP_004511192.1|  PREDICTED: pentatricopeptide repeat-containi...    127   1e-29   
gb|EYU39478.1|  hypothetical protein MIMGU_mgv1a022672mg                116   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_003551391.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    121   2e-28   
gb|ADL62856.1|  acyltransferase                                         120   2e-28   Cynara cardunculus var. scolymus [artichoke]
ref|XP_004503772.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    120   2e-28   Cicer arietinum [garbanzo]
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase      120   3e-28   Morus notabilis
gb|KEH22614.1|  HXXXD-type acyl-transferase family protein              120   3e-28   Medicago truncatula
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    120   3e-28   Sesamum indicum [beniseed]
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    120   4e-28   Sesamum indicum [beniseed]
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    119   7e-28   Nelumbo nucifera [Indian lotus]
ref|XP_003602785.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    119   7e-28   
ref|XP_007031933.1|  HXXXD-type acyl-transferase family protein         120   7e-28   
emb|CBI33005.3|  unnamed protein product                                119   9e-28   Vitis vinifera
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    119   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    119   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010652628.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    119   1e-27   
emb|CAN63569.1|  hypothetical protein VITISV_043430                     118   1e-27   Vitis vinifera
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...    119   1e-27   
ref|XP_004235315.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    119   1e-27   Solanum lycopersicum
ref|XP_007038057.1|  HXXXD-type acyl-transferase family protein, ...    118   2e-27   
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    117   3e-27   Solanum tuberosum [potatoes]
gb|KHN28276.1|  Omega-hydroxypalmitate O-feruloyl transferase           117   4e-27   Glycine soja [wild soybean]
ref|XP_003549071.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    117   5e-27   Glycine max [soybeans]
gb|EYU31840.1|  hypothetical protein MIMGU_mgv1a019044mg                117   6e-27   Erythranthe guttata [common monkey flower]
gb|KHG11495.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    116   7e-27   Gossypium arboreum [tree cotton]
gb|KHN41391.1|  Omega-hydroxypalmitate O-feruloyl transferase           116   7e-27   Glycine soja [wild soybean]
ref|XP_002449535.1|  hypothetical protein SORBIDRAFT_05g018060          116   1e-26   
ref|XP_007200675.1|  hypothetical protein PRUPE_ppa015918mg             116   1e-26   Prunus persica
ref|NP_001275190.1|  feruloyl transferase                               116   1e-26   Solanum tuberosum [potatoes]
ref|XP_010112404.1|  Omega-hydroxypalmitate O-feruloyl transferase      116   1e-26   
ref|XP_002321725.2|  hypothetical protein POPTR_0015s11290g             116   1e-26   Populus trichocarpa [western balsam poplar]
gb|KHN17483.1|  Omega-hydroxypalmitate O-feruloyl transferase           115   1e-26   Glycine soja [wild soybean]
gb|ACY79409.1|  omega-hydroxyacid hydroxycinnamoyltransferase           115   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009600109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   2e-26   Nicotiana tomentosiformis
ref|XP_002303052.1|  hypothetical protein POPTR_0002s24610g             115   2e-26   
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   2e-26   Vitis vinifera
ref|XP_002458822.1|  hypothetical protein SORBIDRAFT_03g040950          115   2e-26   
ref|XP_008235736.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   2e-26   Prunus mume [ume]
ref|XP_006856294.1|  hypothetical protein AMTR_s00047p00102350          115   2e-26   Amborella trichopoda
ref|XP_003525421.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   2e-26   Glycine max [soybeans]
ref|XP_003553956.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   3e-26   Glycine max [soybeans]
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   3e-26   Cucumis melo [Oriental melon]
emb|CDY68497.1|  BnaCnng59260D                                          115   3e-26   Brassica napus [oilseed rape]
ref|XP_009770247.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    115   3e-26   Nicotiana sylvestris
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    114   3e-26   Cucumis sativus [cucumbers]
ref|XP_009381343.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    114   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002962552.1|  BAHD family acyltransferase, clade V               114   4e-26   Selaginella moellendorffii
ref|XP_011024641.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    114   4e-26   Populus euphratica
ref|XP_002992754.1|  BAHD family acyltransferase, clade V               114   4e-26   
ref|XP_001752413.1|  predicted protein                                  114   4e-26   
ref|XP_007137866.1|  hypothetical protein PHAVU_009G162300g             114   4e-26   Phaseolus vulgaris [French bean]
gb|EPS64002.1|  hypothetical protein M569_10778                         114   4e-26   Genlisea aurea
ref|XP_010110923.1|  Omega-hydroxypalmitate O-feruloyl transferase      114   4e-26   
ref|XP_008672444.1|  PREDICTED: uncharacterized protein LOC100273...    114   5e-26   
ref|XP_011023948.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    114   6e-26   Populus euphratica
gb|EMS51970.1|  Omega-hydroxypalmitate O-feruloyl transferase           114   6e-26   Triticum urartu
gb|KJB19785.1|  hypothetical protein B456_003G119000                    114   6e-26   Gossypium raimondii
ref|XP_010929588.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    114   7e-26   Elaeis guineensis
gb|ABR16192.1|  unknown                                                 114   7e-26   Picea sitchensis
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    113   8e-26   Ricinus communis
emb|CDY11732.1|  BnaC06g13400D                                          113   1e-25   Brassica napus [oilseed rape]
emb|CDX67482.1|  BnaA07g15220D                                          113   1e-25   
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    113   1e-25   Brassica rapa
ref|XP_004979328.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    113   1e-25   Setaria italica
ref|XP_006581855.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   1e-25   Glycine max [soybeans]
gb|KHN15565.1|  Omega-hydroxypalmitate O-feruloyl transferase           115   1e-25   Glycine soja [wild soybean]
gb|KDP41799.1|  hypothetical protein JCGZ_26817                         112   1e-25   Jatropha curcas
ref|XP_003528100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   1e-25   Glycine max [soybeans]
dbj|BAJ89613.1|  predicted protein                                      112   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010678277.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   2e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT29891.1|  Taxadien-5-alpha-ol O-acetyltransferase                 112   2e-25   
dbj|BAJ90980.1|  predicted protein                                      112   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY48963.1|  BnaA04g10770D                                          112   2e-25   Brassica napus [oilseed rape]
gb|KHN32561.1|  Omega-hydroxypalmitate O-feruloyl transferase           112   2e-25   Glycine soja [wild soybean]
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   2e-25   Brassica rapa
gb|KDP22581.1|  hypothetical protein JCGZ_26412                         112   2e-25   Jatropha curcas
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...    112   2e-25   Quercus suber [cork oak]
gb|ACN28372.1|  unknown                                                 112   2e-25   Zea mays [maize]
ref|NP_001150426.1|  transferase                                        112   2e-25   
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   3e-25   Phoenix dactylifera
gb|KJB70702.1|  hypothetical protein B456_011G088000                    112   3e-25   Gossypium raimondii
gb|KJB70701.1|  hypothetical protein B456_011G088000                    112   3e-25   Gossypium raimondii
ref|XP_003522443.2|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   3e-25   Glycine max [soybeans]
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    112   4e-25   Phoenix dactylifera
gb|KJB76362.1|  hypothetical protein B456_012G084200                    111   4e-25   Gossypium raimondii
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    111   6e-25   Tarenaya hassleriana [spider flower]
ref|XP_006844599.1|  hypothetical protein AMTR_s00016p00213830          111   6e-25   Amborella trichopoda
ref|XP_007209159.1|  hypothetical protein PRUPE_ppa006018mg             110   7e-25   Prunus persica
ref|XP_010550744.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    111   7e-25   Tarenaya hassleriana [spider flower]
ref|XP_006662951.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    111   7e-25   Oryza brachyantha
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   8e-25   Tarenaya hassleriana [spider flower]
emb|CDO98678.1|  unnamed protein product                                110   8e-25   Coffea canephora [robusta coffee]
gb|EYU23064.1|  hypothetical protein MIMGU_mgv1a006699mg                110   8e-25   Erythranthe guttata [common monkey flower]
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                    110   9e-25   Arabis alpina [alpine rockcress]
ref|XP_011045747.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   1e-24   Populus euphratica
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   1e-24   Prunus mume [ume]
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   1e-24   Prunus mume [ume]
ref|XP_011010462.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   1e-24   Populus euphratica
gb|KEH21000.1|  omega-hydroxypalmitate O-feruloyl transferase           110   1e-24   Medicago truncatula
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   2e-24   Pyrus x bretschneideri [bai li]
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    110   2e-24   Coffea arabica [arabica coffee]
ref|XP_010679985.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   2e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP32472.1|  hypothetical protein JCGZ_13397                         109   2e-24   Jatropha curcas
ref|XP_007161685.1|  hypothetical protein PHAVU_001G089700g             109   2e-24   Phaseolus vulgaris [French bean]
gb|ABA93921.1|  transferase family protein, putative, expressed         109   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    110   2e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001067952.2|  Os11g0507200                                       109   2e-24   
ref|XP_001772486.1|  predicted protein                                  109   2e-24   
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg             109   2e-24   
ref|XP_010026248.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   3e-24   Fragaria vesca subsp. vesca
ref|XP_011468200.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   3e-24   Fragaria vesca subsp. vesca
ref|XP_004297519.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   3e-24   Fragaria vesca subsp. vesca
ref|XP_001755199.1|  predicted protein                                  109   3e-24   
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_003532502.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   4e-24   Glycine max [soybeans]
gb|EAY81037.1|  hypothetical protein OsI_36216                          108   4e-24   Oryza sativa Indica Group [Indian rice]
gb|KDO63871.1|  hypothetical protein CISIN_1g014029mg                   108   4e-24   Citrus sinensis [apfelsine]
ref|XP_002981455.1|  BAHD family acyltransferase, clade V               108   5e-24   Selaginella moellendorffii
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    109   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   5e-24   Phoenix dactylifera
ref|XP_004516455.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   6e-24   Cicer arietinum [garbanzo]
ref|XP_011010199.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    108   8e-24   Populus euphratica
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase         107   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase         108   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002993631.1|  BAHD family acyltransferase, clade V               107   9e-24   
gb|AGJ03151.1|  hydroxycinnamoyltransferase                             107   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002512898.1|  Anthranilate N-benzoyltransferase protein, p...    107   1e-23   
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg             108   1e-23   
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg             107   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_002973250.1|  BAHD family acyltransferase, clade V               107   1e-23   
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006470104.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-23   Citrus sinensis [apfelsine]
ref|XP_002298644.2|  hypothetical protein POPTR_0001s33390g             107   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006447016.1|  hypothetical protein CICLE_v10015302mg             107   1e-23   
ref|XP_002870657.1|  transferase family protein                         107   1e-23   
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   1e-23   Eucalyptus grandis [rose gum]
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                     107   1e-23   Eucalyptus grandis [rose gum]
gb|KEH21938.1|  omega-hydroxypalmitate O-feruloyl transferase           107   1e-23   Medicago truncatula
ref|XP_002969985.1|  BAHD family acyltransferase, clade V               107   2e-23   Selaginella moellendorffii
ref|XP_004169053.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   2e-23   
emb|CDY62885.1|  BnaC03g74670D                                          107   2e-23   Brassica napus [oilseed rape]
ref|XP_004134484.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   2e-23   Cucumis sativus [cucumbers]
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010926850.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    107   3e-23   
ref|XP_008374212.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    106   3e-23   Malus domestica [apple tree]
ref|XP_006415631.1|  hypothetical protein EUTSA_v10007612mg             106   3e-23   Eutrema salsugineum [saltwater cress]
ref|XP_006373237.1|  hypothetical protein POPTR_0017s09970g             105   3e-23   
ref|XP_010252750.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    106   3e-23   
gb|KFK34173.1|  hypothetical protein AALP_AA5G109900                    105   4e-23   
emb|CDY08092.1|  BnaA06g16340D                                          105   5e-23   
emb|CDY05866.1|  BnaC08g20430D                                          105   5e-23   
ref|XP_009149801.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   5e-23   
ref|XP_009344220.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   5e-23   
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   8e-23   
gb|KFK28037.1|  hypothetical protein AALP_AA8G463700                    105   8e-23   
ref|XP_002864855.1|  transferase family protein                         105   9e-23   
ref|XP_009150410.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    104   1e-22   
emb|CDY41518.1|  BnaA06g22710D                                          104   1e-22   
ref|XP_009346788.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    104   2e-22   
emb|CDY34088.1|  BnaA09g27140D                                          103   2e-22   
ref|XP_002320517.1|  hypothetical protein POPTR_0014s16460g             103   3e-22   
ref|XP_009113637.1|  PREDICTED: 3'-N-debenzoyl-2'-deoxytaxol N-be...    103   3e-22   
ref|XP_009405177.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   4e-22   
ref|XP_002521072.1|  Anthranilate N-benzoyltransferase protein, p...    102   6e-22   
gb|KCW60299.1|  hypothetical protein EUGRSUZ_H030131                    101   8e-22   
gb|AAM62785.1|  acyltransferase-like protein                            102   1e-21   
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   1e-21   
ref|XP_004964655.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   1e-21   
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    101   1e-21   
ref|NP_201161.1|  HXXXD-type acyl-transferase-like protein              101   2e-21   
ref|XP_008438874.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    101   2e-21   
ref|XP_010023900.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   3e-21   
ref|XP_002268922.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   3e-21   
emb|CAN61656.1|  hypothetical protein VITISV_017126                     100   3e-21   
ref|XP_010023898.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   4e-21   
ref|XP_006394262.1|  hypothetical protein EUTSA_v10003601mg             102   6e-21   
gb|AAF24555.2|AC007508_18  F1K23.12                                   99.4    1e-20   
ref|XP_011076842.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  99.4    1e-20   
ref|XP_002890783.1|  transferase family protein                       99.0    1e-20   
ref|NP_174189.1|  HXXXD-type acyl-transferase family protein          99.0    1e-20   
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  98.6    2e-20   
ref|XP_006307488.1|  hypothetical protein CARUB_v10009112mg           99.0    2e-20   
ref|XP_006291175.1|  hypothetical protein CARUB_v10017301mg           98.6    2e-20   
emb|CAT00084.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  97.8    2e-20   
gb|ABR16860.1|  unknown                                               98.6    2e-20   
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  98.6    2e-20   
ref|XP_010478102.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  98.2    3e-20   
ref|XP_002875921.1|  transferase family protein                       97.8    3e-20   
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.8    4e-20   
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.4    4e-20   
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972  99.8    5e-20   
emb|CDY30829.1|  BnaC05g22050D                                        97.4    5e-20   
ref|XP_010499245.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  96.7    5e-20   
gb|KFK44738.1|  hypothetical protein AALP_AA1G296500                  97.4    6e-20   
gb|KJB68229.1|  hypothetical protein B456_010G233600                  97.1    6e-20   
ref|XP_010460517.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.1    6e-20   
gb|KJB68227.1|  hypothetical protein B456_010G233600                  97.1    6e-20   
ref|XP_008237791.1|  PREDICTED: uncharacterized protein LOC103336520  95.9    7e-20   
gb|KCW60293.1|  hypothetical protein EUGRSUZ_H03008                   95.5    7e-20   
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.1    7e-20   
ref|XP_010460660.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  97.1    8e-20   
ref|XP_010499244.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  96.7    1e-19   
ref|NP_001141054.1|  uncharacterized protein LOC100273135             96.3    1e-19   
ref|XP_010023895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  95.9    1e-19   
ref|XP_009396442.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  96.3    1e-19   
ref|XP_010023896.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  95.9    1e-19   
gb|AAQ62868.1|  At3g48720                                             95.9    1e-19   
gb|AGW27208.1|  rosmarinic acid synthase 3                            95.9    2e-19   
ref|XP_010499399.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  96.3    2e-19   
ref|NP_190441.1|  HXXXD-type acyl-transferase family protein          95.9    2e-19   
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  95.9    2e-19   
gb|AGW27211.1|  rosmarinic acid synthase 6                            95.5    2e-19   
gb|KJB68219.1|  hypothetical protein B456_010G233000                  93.2    2e-19   
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...  95.9    2e-19   
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  95.1    2e-19   
ref|XP_006304467.1|  hypothetical protein CARUB_v10011142mg           95.5    3e-19   
ref|XP_002992205.1|  BAHD family acyltransferase, clade V             95.9    3e-19   
dbj|BAE98427.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...  95.5    3e-19   
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg           95.1    3e-19   
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  95.1    3e-19   
ref|NP_001062400.1|  Os08g0543400                                     94.7    4e-19   
gb|EAZ07854.1|  hypothetical protein OsI_30113                        94.4    4e-19   
gb|AEK80405.1|  HQT                                                   94.4    6e-19   
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.4    6e-19   
ref|XP_008779276.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.8    7e-19   
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  94.0    8e-19   
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  94.0    8e-19   
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  94.4    8e-19   
gb|EYU41390.1|  hypothetical protein MIMGU_mgv1a009242mg              92.8    9e-19   
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                        93.6    9e-19   
gb|AGE10614.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...  91.3    1e-18   
ref|XP_002982104.1|  BAHD family acyltransferase, clade V             94.4    1e-18   
gb|EAY81041.1|  hypothetical protein OsI_36220                        92.0    1e-18   
gb|ADG46003.1|  hydroxycinnamoyl transferase                          93.6    1e-18   
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  93.6    1e-18   
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg              93.6    1e-18   
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  93.2    2e-18   
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.8    2e-18   
gb|KCW50679.1|  hypothetical protein EUGRSUZ_J00365                   92.0    2e-18   
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  92.4    3e-18   
ref|XP_010023897.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  90.1    3e-18   
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like     92.4    3e-18   
gb|ABK24908.1|  unknown                                               90.9    3e-18   
ref|XP_008466864.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    3e-18   
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            92.4    3e-18   
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.0    4e-18   
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g           92.4    4e-18   
ref|XP_010031398.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.0    4e-18   
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g           92.4    4e-18   
ref|XP_010478244.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  92.4    4e-18   
ref|XP_007025453.1|  HXXXD-type acyl-transferase family protein       92.0    4e-18   
ref|NP_001172715.1|  Os01g0924933                                     90.5    4e-18   
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  92.0    4e-18   
ref|XP_003569241.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.7    5e-18   
ref|XP_008668232.1|  PREDICTED: hypothetical protein isoform X1       91.3    5e-18   
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.0    5e-18   
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             91.7    5e-18   
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780        91.7    6e-18   
ref|XP_010031390.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.3    6e-18   
ref|XP_010023888.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  91.3    7e-18   
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  91.3    7e-18   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    7e-18   
ref|NP_001141965.1|  hypothetical protein                             91.3    7e-18   
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    8e-18   
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase             91.3    8e-18   
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg          91.3    8e-18   
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  90.9    9e-18   
gb|EPS73563.1|  hypothetical protein M569_01193                       89.7    1e-17   
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.9    1e-17   
ref|XP_010031391.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  90.9    1e-17   
dbj|BAJ89730.1|  predicted protein                                    90.5    1e-17   
ref|XP_010507658.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  90.5    1e-17   
gb|EEC72066.1|  hypothetical protein OsI_04996                        90.5    1e-17   
dbj|BAD88037.1|  putative hydroxyanthranilate hydroxycinnamoyltra...  90.9    1e-17   
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    1e-17   
dbj|BAD93774.1|  putative hypersensitivity-related protein            87.0    1e-17   
gb|EMT23329.1|  Taxadien-5-alpha-ol O-acetyltransferase               90.5    1e-17   
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.7    1e-17   
dbj|BAJ91746.1|  predicted protein                                    90.5    2e-17   
ref|XP_006473895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  90.5    2e-17   
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2           90.5    2e-17   
ref|NP_174083.1|  HXXXD-type acyl-transferase-like protein            90.5    2e-17   
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg           90.5    2e-17   
ref|NP_181552.1|  putative CoA-dependent acyltransferase              90.1    2e-17   
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    2e-17   
gb|KCW60291.1|  hypothetical protein EUGRSUZ_H03004                   88.6    2e-17   
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg           90.1    2e-17   
ref|XP_006435052.1|  hypothetical protein CICLE_v10003709mg           90.1    2e-17   
gb|KDO44967.1|  hypothetical protein CISIN_1g0133461mg                88.6    2e-17   
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2            90.1    2e-17   
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  90.1    2e-17   
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  90.1    2e-17   
ref|XP_002890739.1|  transferase family protein                       90.1    2e-17   
gb|EPS61292.1|  hydroxycinnamoyl transferase                          87.8    2e-17   
emb|CDX84384.1|  BnaC03g51160D                                        89.4    2e-17   
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  90.1    2e-17   
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like     89.7    3e-17   
gb|AFR67331.1|  hydroxycinnamoyl CoA shikimate hydroxycinnamoyl t...  88.2    3e-17   
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.7    3e-17   
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g           89.7    3e-17   
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...  89.7    3e-17   
ref|XP_009133424.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  89.4    3e-17   
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                89.4    3e-17   
gb|KDO84650.1|  hypothetical protein CISIN_1g036687mg                 89.4    3e-17   
ref|XP_004971119.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.4    4e-17   
emb|CDY52430.1|  BnaC03g72540D                                        89.4    4e-17   
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg           89.4    4e-17   
ref|XP_010026821.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.4    4e-17   
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.4    4e-17   
ref|XP_006435775.1|  hypothetical protein CICLE_v10031495mg           89.4    4e-17   
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg           89.0    4e-17   
ref|NP_001169127.1|  hypothetical protein                             89.0    5e-17   
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  89.0    5e-17   
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...  88.2    5e-17   
ref|XP_010023890.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.0    5e-17   
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  89.0    5e-17   
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                        89.0    5e-17   
ref|XP_010031392.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.0    5e-17   
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg           89.0    5e-17   
ref|XP_008374914.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.0    6e-17   
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  89.0    6e-17   
ref|XP_010023884.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  89.0    6e-17   
gb|KJB71596.1|  hypothetical protein B456_011G132100                  88.6    6e-17   
ref|XP_008779303.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.4    7e-17   
ref|XP_010517439.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  88.6    7e-17   
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase       88.6    7e-17   
gb|KCW79732.1|  hypothetical protein EUGRSUZ_C010811                  86.3    7e-17   
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  88.6    8e-17   
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg           88.6    8e-17   
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  88.2    9e-17   
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    88.2    9e-17   
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase         88.2    9e-17   
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  88.2    1e-16   
gb|KHN22398.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  89.0    1e-16   
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   88.2    1e-16   
ref|XP_010508892.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  88.2    1e-16   
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  88.2    1e-16   
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...  87.8    1e-16   
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  88.2    1e-16   
ref|XP_010688137.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  88.2    1e-16   
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    1e-16   
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                   87.4    1e-16   
emb|CDP21408.1|  unnamed protein product                              86.3    1e-16   
ref|XP_010031397.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.8    1e-16   
ref|XP_010534611.1|  PREDICTED: LOW QUALITY PROTEIN: taxadien-5-a...  87.8    1e-16   
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.8    1e-16   
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g           87.8    1e-16   
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.4    1e-16   
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g           87.8    2e-16   
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.4    2e-16   
emb|CBI83579.1|  hydroxycinnamoyl transferase                         87.4    2e-16   
ref|XP_010023883.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.4    2e-16   
gb|KDP41953.1|  hypothetical protein JCGZ_26971                       87.0    2e-16   
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.0    2e-16   
gb|KJB54948.1|  hypothetical protein B456_009G055900                  87.4    2e-16   
emb|CDX93209.1|  BnaC04g46870D                                        87.0    2e-16   
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  87.0    2e-16   
ref|XP_011027715.1|  PREDICTED: 3'-N-debenzoyl-2'-deoxytaxol N-be...  87.0    2e-16   
gb|AGW27209.1|  rosmarinic acid synthase 4                            87.0    2e-16   
gb|AFF19202.1|  BAHD acyltransferase                                  87.0    2e-16   
gb|KJB71577.1|  hypothetical protein B456_011G130700                  87.0    2e-16   
ref|XP_008664074.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    2e-16   
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.0    2e-16   
ref|XP_002456875.1|  hypothetical protein SORBIDRAFT_03g044360        83.6    3e-16   
ref|XP_006411279.1|  hypothetical protein EUTSA_v10016665mg           87.0    3e-16   
gb|AEJ88365.1|  hydroxycinnamoyltransferase                           86.7    3e-16   
gb|ABR17170.1|  unknown                                               86.7    3e-16   



>ref|XP_009794621.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
sylvestris]
Length=455

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 161/196 (82%), Gaps = 2/196 (1%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LKDKAK  +    KVT FN +TA +W+CKALS    ENNS+R+STVLFAVDIR RLNPPL
Sbjct  259  LKDKAKDENAPHAKVTSFNAVTAHVWKCKALS-FDVENNSERISTVLFAVDIRPRLNPPL  317

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVLT Y SA C ELEE PF K V MV +GA RMTDEYARSAIDWGE YKGFP+
Sbjct  318  PKSYTGNAVLTSYASATCHELEEWPFSKIVAMVSKGAMRMTDEYARSAIDWGEFYKGFPN  377

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNS-GVNVLVAL  150
            GEFL+SSWWRLGF  V++PWGKPKYSCPVV HRKDIIL FP+ID+G  SN+ GVN+LVAL
Sbjct  378  GEFLISSWWRLGFSEVEYPWGKPKYSCPVVSHRKDIILFFPNIDDGISSNNDGVNILVAL  437

Query  149  PPKEMEKFKSLFHKFL  102
            P K+MEKF+S FHKFL
Sbjct  438  PAKQMEKFESYFHKFL  453



>ref|XP_009620725.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
tomentosiformis]
Length=456

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 162/197 (82%), Gaps = 3/197 (2%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LKDKAK  +    KVT FNV+TA +W+CKALS    ENNS+R+STVLFAVDIR RLNPPL
Sbjct  259  LKDKAKDENAPHAKVTSFNVVTAYVWKCKALS-FDVENNSERISTVLFAVDIRPRLNPPL  317

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVLT Y SA C ELEE PF K V MV +GA RMTDEYARSAIDWGE YKGFP+
Sbjct  318  PKSYTGNAVLTSYASATCHELEEWPFCKIVAMVSKGAMRMTDEYARSAIDWGEFYKGFPN  377

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG--GKSNSGVNVLVA  153
            GEFL+SSWWRLGF  V++PWGKPKYSCPVV HRKDIILLFP+ID+G    SN GVN+LVA
Sbjct  378  GEFLISSWWRLGFSEVEYPWGKPKYSCPVVSHRKDIILLFPNIDDGITSSSNDGVNILVA  437

Query  152  LPPKEMEKFKSLFHKFL  102
            LP K+MEKF+S F+KFL
Sbjct  438  LPIKQMEKFESYFNKFL  454



>ref|XP_011077121.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase [Sesamum indicum]
Length=448

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 163/197 (83%), Gaps = 6/197 (3%)
 Frame = -2

Query  686  LKDKAKAPD-NVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            LK+KAKA + N  TK+TGFNV+TA +WRCKALS   G N  D    VL+AVDIR +L PP
Sbjct  257  LKEKAKAGEINTNTKITGFNVVTAHVWRCKALSYDVGNNRED---XVLYAVDIRSKLKPP  313

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SY GNAVL+ Y SAKC+ELE+ PF K V+MV  G+ RMTDEYARSAIDWGE+YKGFP
Sbjct  314  LPVSYCGNAVLSAYASAKCSELEDEPFSKLVEMVSAGSTRMTDEYARSAIDWGEVYKGFP  373

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            +GEFL+SSWWRLGF+ V +PWGKP+YSCPVVYHRKDIILLFP+I  GG S++GVNVLVAL
Sbjct  374  NGEFLISSWWRLGFDEVVYPWGKPRYSCPVVYHRKDIILLFPEI--GGASSNGVNVLVAL  431

Query  149  PPKEMEKFKSLFHKFLA  99
            P KEMEKF++LFHK++ 
Sbjct  432  PHKEMEKFQALFHKYMT  448



>emb|CDP20135.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 160/203 (79%), Gaps = 11/203 (5%)
 Frame = -2

Query  686  LKDKAKAP--------DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDI  531
            LK+KAKA              ++TGFNV+TA +WRCKALSC   E   +RLSTVL+AVDI
Sbjct  259  LKEKAKASGPAAAAATATTNYRITGFNVVTAHVWRCKALSC-DSEEGLERLSTVLYAVDI  317

Query  530  RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  351
            R R+ PPLP SY+GNAVLT Y +AKC ELEE PF K V MV EGAARMTDEYARSAIDWG
Sbjct  318  RPRMKPPLPASYTGNAVLTAYATAKCRELEEVPFSKLVAMVSEGAARMTDEYARSAIDWG  377

Query  350  ELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  171
            E+YKGFPHGEFL+SSWWRLGF  +++PWGKP+YSCPVV+ RKDIILLFPDID    + + 
Sbjct  378  EVYKGFPHGEFLISSWWRLGFAEMEYPWGKPRYSCPVVHQRKDIILLFPDID--AANANA  435

Query  170  VNVLVALPPKEMEKFKSLFHKFL  102
            VNVLVALP KEMEKF+SLFHK L
Sbjct  436  VNVLVALPGKEMEKFQSLFHKLL  458



>ref|XP_004250074.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=461

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 160/196 (82%), Gaps = 2/196 (1%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK  +    K+T FNV+T+ +WRCKALS    ENNS+R+STVLFAVDIR RLNPPL
Sbjct  265  LKEKAKDENTPNAKITSFNVVTSYVWRCKALS-YDDENNSERVSTVLFAVDIRPRLNPPL  323

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVLT Y SA C ELEEGPF K V +V +G  RM DEYARSAIDWGE+ KGFP+
Sbjct  324  PQSYAGNAVLTSYASATCHELEEGPFSKIVDLVSQGGKRMDDEYARSAIDWGEINKGFPN  383

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNG-GKSNSGVNVLVAL  150
            GEFL+SSWW+LGF  V++PWGKPKYSCPVV HRK+IILLFP+ID+G   +N GVN+ VAL
Sbjct  384  GEFLLSSWWKLGFSQVEYPWGKPKYSCPVVCHRKEIILLFPNIDDGKSNNNDGVNIFVAL  443

Query  149  PPKEMEKFKSLFHKFL  102
            PPK+M KF+S F+KFL
Sbjct  444  PPKQMNKFESYFNKFL  459



>ref|XP_004493124.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=447

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 153/192 (80%), Gaps = 3/192 (2%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K KA D+   +VTGFNV+ A +WRCKALS   G ++ DR ST+L+AVDIR RLNPPLP S
Sbjct  257  KEKAKDSSTARVTGFNVVAALLWRCKALS---GPSDPDRSSTILYAVDIRSRLNPPLPKS  313

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEF  318
            Y GNAVLT Y +AKC ELE+G F + V+MV EG+ RM DEYARS IDWGELY GFP+GE 
Sbjct  314  YVGNAVLTAYATAKCEELEKGKFSRLVEMVCEGSIRMNDEYARSIIDWGELYDGFPNGEV  373

Query  317  LVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKE  138
            LVSSWWRLGFE VQ+PWGKPKY CP+VYHRKDIILLFP    G   + GVN++VALPPKE
Sbjct  374  LVSSWWRLGFEEVQYPWGKPKYCCPMVYHRKDIILLFPPFHEGDARDDGVNIIVALPPKE  433

Query  137  MEKFKSLFHKFL  102
            M+KF++LFH FL
Sbjct  434  MDKFQTLFHNFL  445



>gb|KGN61333.1| hypothetical protein Csa_2G091770 [Cucumis sativus]
Length=300

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -2

Query  653  KTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  474
            K ++TGFNV+TA +WRCKALS    ++N +R ST+L+AVDIR R++PPLP SY GNAVLT
Sbjct  117  KLRITGFNVVTALVWRCKALS-FEAKDNYERQSTLLYAVDIRSRMDPPLPTSYCGNAVLT  175

Query  473  GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRL  294
             Y +AKC EL++GPF + V+MV E A RMTDEYARSAIDWGELYKGFP+GEFLVSSWWRL
Sbjct  176  VYATAKCKELKDGPFSRVVEMVSEAATRMTDEYARSAIDWGELYKGFPNGEFLVSSWWRL  235

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
            G E V++PWGKP+ SCPVV HRKDIILLFPDI+   K+NSG+N+LVALP  +M KF++LF
Sbjct  236  GLEDVEYPWGKPRSSCPVVNHRKDIILLFPDINESEKTNSGLNILVALPETQMVKFQTLF  295

Query  113  HKFLA  99
             +F+A
Sbjct  296  KEFMA  300



>gb|KHN00653.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=256

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 149/182 (82%), Gaps = 6/182 (3%)
 Frame = -2

Query  644  VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYG  465
            VTGFNV+TA IWRCKALSC   ++N +R ST+L+AVDIR RLNPPLP SY+GNAVLT Y 
Sbjct  79   VTGFNVITAHIWRCKALSC--EDDNPNRSSTILYAVDIRSRLNPPLPKSYAGNAVLTAYA  136

Query  464  SAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFE  285
            + KC ELEE PF K V+MV EGA RMT+EYARS IDWGE  KG P+GE LVSSWWRLGFE
Sbjct  137  TTKCKELEELPFMKLVEMVREGATRMTNEYARSIIDWGETNKGCPNGEVLVSSWWRLGFE  196

Query  284  GVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKF  105
             V++PWGKPKY CPVVYHRKDIILLFP ID GG    GV+++VALPPKEMEKF  LF+KF
Sbjct  197  EVEYPWGKPKYCCPVVYHRKDIILLFPPIDGGG----GVSIIVALPPKEMEKFYGLFNKF  252

Query  104  LA  99
            L 
Sbjct  253  LT  254



>ref|XP_011016099.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=284

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K KA  +   +V+GFNV+TA IWRCKALS    ++  DR+ST+L+AV+IR RL PPLP+S
Sbjct  96   KEKAKTSPSARVSGFNVVTAHIWRCKALSQPEAQD-PDRVSTILYAVNIRPRLIPPLPES  154

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEF  318
            Y+GNAVLT Y +A C EL+EGP  K V+ V EG+ RMTDEY RSAIDWGE++KGFPHG+F
Sbjct  155  YAGNAVLTAYANATCKELQEGPISKLVERVAEGSKRMTDEYVRSAIDWGEIHKGFPHGDF  214

Query  317  LVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKE  138
            LVSSWW+LGF+ V++PWG P+YSCPVVYHRKDIILLFPDID+     + VNVLVALP KE
Sbjct  215  LVSSWWKLGFDEVEYPWGCPRYSCPVVYHRKDIILLFPDIDD----KNSVNVLVALPSKE  270

Query  137  MEKFKSLFHKFLA  99
            MEKF+SLFHKFL+
Sbjct  271  MEKFESLFHKFLS  283



>gb|KJB26880.1| hypothetical protein B456_004G264500 [Gossypium raimondii]
Length=449

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 162/201 (81%), Gaps = 8/201 (4%)
 Frame = -2

Query  689  RLKDKAKAPDN----VKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRR  522
            RLK+KAKA          ++TGFNV+TA +W CKALS    E+N DR+ST+L+AV+IR R
Sbjct  253  RLKEKAKASATGSHVSDARITGFNVVTALVWHCKALSWDNKESNLDRVSTLLYAVNIRPR  312

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
            L PPLP SY+GNAVLT Y  A C E++E PF + V++V EGA RMTDEYARSAIDWG++Y
Sbjct  313  LIPPLPISYTGNAVLTAYARATCKEIDEAPFSRLVELVTEGAKRMTDEYARSAIDWGDIY  372

Query  341  KGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
            +GFP+GEFLVSSWW+LGF+ V++PWG+PKYSCPVV+ RKDIIL FPDID+    N+GVNV
Sbjct  373  QGFPNGEFLVSSWWKLGFDEVEYPWGRPKYSCPVVFQRKDIILFFPDIDD----NNGVNV  428

Query  161  LVALPPKEMEKFKSLFHKFLA  99
            LV+LP KEM KFK+LFHK+LA
Sbjct  429  LVSLPSKEMSKFKTLFHKYLA  449



>ref|XP_004138891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 ref|XP_004155115.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=469

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -2

Query  653  KTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  474
            K ++TGFNV+TA +WRCKALS    ++N +R ST+L+AVDIR R++PPLP SY GNAVLT
Sbjct  286  KLRITGFNVVTALVWRCKALS-FEAKDNYERQSTLLYAVDIRSRMDPPLPTSYCGNAVLT  344

Query  473  GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRL  294
             Y +AKC EL++GPF + V+MV E A RMTDEYARSAIDWGELYKGFP+GEFLVSSWWRL
Sbjct  345  VYATAKCKELKDGPFSRVVEMVSEAATRMTDEYARSAIDWGELYKGFPNGEFLVSSWWRL  404

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
            G E V++PWGKP+ SCPVV HRKDIILLFPDI+   K+NSG+N+LVALP  +M KF++LF
Sbjct  405  GLEDVEYPWGKPRSSCPVVNHRKDIILLFPDINESEKTNSGLNILVALPETQMVKFQTLF  464

Query  113  HKFLA  99
             +F+A
Sbjct  465  KEFMA  469



>ref|XP_010673872.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Beta 
vulgaris subsp. vulgaris]
Length=454

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 155/198 (78%), Gaps = 6/198 (3%)
 Frame = -2

Query  689  RLKDKAKA-PDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
             LK KAK+ P N K K+TGFNV++A +WRCKALS    EN    LST+LFAVDIR +LNP
Sbjct  261  NLKAKAKSGPPNWKGKITGFNVVSALVWRCKALS--NSENEEKSLSTMLFAVDIRPKLNP  318

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP S+ GNAVLT Y +  C  LEE    + V +V EG ARM DEYA+SAIDWGE+YKGF
Sbjct  319  PLPTSFVGNAVLTAYATTDCKTLEEASLSELVHLVSEGGARMNDEYAKSAIDWGEVYKGF  378

Query  332  PHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
            PHGEFL+SSWWRLGF+  ++PWGKPKY CP+VYHRKDIILLFPDID   +SNSGVNVLV 
Sbjct  379  PHGEFLMSSWWRLGFDQAEYPWGKPKYCCPLVYHRKDIILLFPDID---ESNSGVNVLVT  435

Query  152  LPPKEMEKFKSLFHKFLA  99
            LP KEM KF+SLFH FL+
Sbjct  436  LPHKEMAKFQSLFHNFLS  453



>ref|XP_002270329.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
 emb|CBI38342.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 161/196 (82%), Gaps = 4/196 (2%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KAK  D  KTKVTGFNV+   +WRCKALSC  G N+ DRLST+L+AVDIR RL PPL
Sbjct  257  LKAKAKTGD-AKTKVTGFNVVATHVWRCKALSCDTG-NDLDRLSTILYAVDIRPRLVPPL  314

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GN VLT Y +A C +L+E PF + V MV EGA RMTDEYARSAIDWGELYKGFPH
Sbjct  315  PPSYTGNGVLTAYATASCRDLQEEPFSRLVGMVAEGANRMTDEYARSAIDWGELYKGFPH  374

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GEFL+SSWWRLGF  V++PWGK KYSCPVVYHRKDIIL FPDID    +N+GVN+LVALP
Sbjct  375  GEFLISSWWRLGFAEVEYPWGKAKYSCPVVYHRKDIILFFPDID--AVNNNGVNILVALP  432

Query  146  PKEMEKFKSLFHKFLA  99
             KEMEKF++LFHKFLA
Sbjct  433  SKEMEKFQTLFHKFLA  448



>ref|XP_002316174.2| hypothetical protein POPTR_0010s18710g [Populus trichocarpa]
 gb|EEF02345.2| hypothetical protein POPTR_0010s18710g [Populus trichocarpa]
Length=468

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 156/193 (81%), Gaps = 5/193 (3%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K KA  +   +V+GFNV+TA IWRCKALS      + DR+ST+L+AV+IR RL PPLP+S
Sbjct  280  KEKAKTSPSARVSGFNVVTAHIWRCKALS-QSEAQDPDRVSTILYAVNIRPRLTPPLPES  338

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEF  318
            YSGNAVLT Y +A C EL EGP  K V+ V EG+ RMTDEYARSAIDWGE++KGFPHG+F
Sbjct  339  YSGNAVLTAYANATCKELREGPISKLVERVAEGSKRMTDEYARSAIDWGEIHKGFPHGDF  398

Query  317  LVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKE  138
            L+SSWW+LGF+ V +PWG P+YSCPVVYHRKDIILLFPDID+     + VNVLVALP KE
Sbjct  399  LLSSWWKLGFDEVDYPWGCPRYSCPVVYHRKDIILLFPDIDD----KNSVNVLVALPCKE  454

Query  137  MEKFKSLFHKFLA  99
            MEKF+SLFHKFL+
Sbjct  455  MEKFESLFHKFLS  467



>ref|XP_010110380.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC26166.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=309

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 158/210 (75%), Gaps = 17/210 (8%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK++AK+ D  +  +T FNV+TA IWRCKALSC    N+ +R S +L+AVDIRRR++PPL
Sbjct  99   LKERAKSGDGDRV-ITSFNVVTAFIWRCKALSC-DASNDMERQSRILYAVDIRRRVDPPL  156

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVLT Y +    ELEEGPF K V+ V EGA RMT+EYARSAIDWGELYKGFPH
Sbjct  157  PQSYTGNAVLTAYATRYYKELEEGPFSKIVETVAEGARRMTNEYARSAIDWGELYKGFPH  216

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDID---------------N  192
            GE LVSSWWRLGF  V++PWGKPKYSCPVV HRKDIIL FPDI+                
Sbjct  217  GEVLVSSWWRLGFAEVEYPWGKPKYSCPVVCHRKDIILFFPDIEDRDDHDEPDDLNGKQE  276

Query  191  GGKSNSGVNVLVALPPKEMEKFKSLFHKFL  102
            G +   GVNVL+ALP KEMEKF++LFHK+L
Sbjct  277  GRERKDGVNVLLALPAKEMEKFETLFHKYL  306



>ref|XP_011014891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=468

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K KA  +   +V+GFNV+TA IWRCKALS    ++  DR+ST+L+AV+IR RL PPLP+S
Sbjct  280  KEKAKTSPSARVSGFNVVTAHIWRCKALSQPEAQD-PDRVSTILYAVNIRPRLIPPLPES  338

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEF  318
            Y+GNAVLT Y +A C EL+EGP  K V+ V EG+ RMTDEY RSAIDWGE++KGFPHG+F
Sbjct  339  YAGNAVLTAYANATCKELQEGPISKLVERVAEGSKRMTDEYVRSAIDWGEIHKGFPHGDF  398

Query  317  LVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKE  138
            LVSSWW+LGF+ V++PWG P+YSCPVVYHRKDIILLFPDID+     + VNVLVALP KE
Sbjct  399  LVSSWWKLGFDEVEYPWGCPRYSCPVVYHRKDIILLFPDIDD----KNSVNVLVALPSKE  454

Query  137  MEKFKSLFHKFLA  99
            MEKF+SLFHKFL+
Sbjct  455  MEKFESLFHKFLS  467



>emb|CAN73821.1| hypothetical protein VITISV_014805 [Vitis vinifera]
Length=435

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 160/196 (82%), Gaps = 4/196 (2%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
             K KAK  D  KTKVTGFNV+   +WRCKALSC  G N+ DRLST+L+AVDIR RL PPL
Sbjct  244  FKAKAKTGD-AKTKVTGFNVVATHVWRCKALSCDTG-NDLDRLSTILYAVDIRPRLVPPL  301

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GN VLT Y +A C +L+E PF + V MV EGA RMTDEYARSAIDWGELYKGFPH
Sbjct  302  PPSYTGNGVLTAYATASCRDLQEEPFSRLVGMVAEGANRMTDEYARSAIDWGELYKGFPH  361

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GEFL+SSWWRLGF  V++PWGK KYSCPVVYHRKDIIL FPDID    +++GVN+LVALP
Sbjct  362  GEFLISSWWRLGFAEVEYPWGKAKYSCPVVYHRKDIILFFPDID--AVNBNGVNILVALP  419

Query  146  PKEMEKFKSLFHKFLA  99
             KEMEKF++LFHKFLA
Sbjct  420  SKEMEKFQTLFHKFLA  435



>gb|KDP26918.1| hypothetical protein JCGZ_18076 [Jatropha curcas]
Length=450

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 159/196 (81%), Gaps = 9/196 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+K K   N   +V+GFNV+TA +WRCKALS     NN +R+ST+L+AV+IR R+ P L
Sbjct  261  LKEKGKRHAN--GRVSGFNVVTAHVWRCKALS-YEDNNNLERVSTILYAVNIRPRVMPAL  317

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            PDSY+GNAVLT Y SAKC ELEEGP W+ V+MV EGA RMTDEYA+SAIDWGE+ KGFP+
Sbjct  318  PDSYAGNAVLTAYASAKCKELEEGPLWRVVEMVAEGAKRMTDEYAKSAIDWGEINKGFPN  377

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVAL  150
            GEFLVSSWWRLGFE V++PWG PKYSCP+VYHRKDIILLFPD +D      +GVNVLVAL
Sbjct  378  GEFLVSSWWRLGFEEVEYPWGCPKYSCPLVYHRKDIILLFPDPVD-----KNGVNVLVAL  432

Query  149  PPKEMEKFKSLFHKFL  102
            P  +M KF+SLFHKFL
Sbjct  433  PSNQMNKFESLFHKFL  448



>ref|XP_010093570.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC38958.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=309

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 157/210 (75%), Gaps = 17/210 (8%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK++AK+ D  +  +T FNV+TA IWRCKALSC    N+ +R S +L+AVDIRRR++PPL
Sbjct  99   LKERAKSGDGDRV-ITSFNVVTAFIWRCKALSC-DASNDMERQSRILYAVDIRRRVDPPL  156

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVLT Y +    ELEEGPF K V+   EGA RMT+EYARSAIDWGELYKGFPH
Sbjct  157  PQSYTGNAVLTAYATRYYKELEEGPFSKIVETAAEGARRMTNEYARSAIDWGELYKGFPH  216

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDID---------------N  192
            GE LVSSWWRLGF  V++PWGKPKYSCPVV HRKDIIL FPDI+                
Sbjct  217  GEVLVSSWWRLGFAEVEYPWGKPKYSCPVVCHRKDIILFFPDIEDRDDHDEPDDLNGKQE  276

Query  191  GGKSNSGVNVLVALPPKEMEKFKSLFHKFL  102
            G +   GVNVL+ALP KEMEKF++LFHK+L
Sbjct  277  GRERKDGVNVLLALPAKEMEKFETLFHKYL  306



>gb|KHN13415.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=447

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = -2

Query  644  VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYG  465
            VTGFNV+TA IWRCKALSC   EN  +R ST+L+AVDIR RLNPPLP SY+GNAVLT Y 
Sbjct  269  VTGFNVITAYIWRCKALSCYNDEN-PNRSSTILYAVDIRSRLNPPLPKSYAGNAVLTAYA  327

Query  464  SAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFE  285
            +AKC ELEE PF K V+MV EGA RMT+EYARS IDWGE+  GFP+GE LVSSWWRLGFE
Sbjct  328  TAKCKELEEWPFMKLVEMVREGATRMTNEYARSIIDWGEINNGFPNGEVLVSSWWRLGFE  387

Query  284  GVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKF  105
             V++PWGKPKY CPVVYH+KDIILLFP +  G     GV+++VALPPKEMEKF  LF+KF
Sbjct  388  EVEYPWGKPKYCCPVVYHKKDIILLFPPVGGG----EGVSIIVALPPKEMEKFHGLFNKF  443

Query  104  LA  99
            L 
Sbjct  444  LT  445



>ref|XP_007151622.1| hypothetical protein PHAVU_004G062600g [Phaseolus vulgaris]
 gb|ESW23616.1| hypothetical protein PHAVU_004G062600g [Phaseolus vulgaris]
Length=449

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 6/198 (3%)
 Frame = -2

Query  689  RLKDKAKAP--DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK++A+     +  T++TGFN +TA IWRCKALSC  G++N +++ST+L+AVDIR RL 
Sbjct  254  KLKEEARDSVGGDTTTRITGFNAITAHIWRCKALSC-DGDSNPNKVSTILYAVDIRSRLE  312

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP SY+GNAVLT Y +A C ELEE PF + V+ V EGA RM++EYARS IDWGE+ KG
Sbjct  313  PPLPKSYTGNAVLTAYATATCRELEEWPFMRLVERVVEGATRMSNEYARSIIDWGEINKG  372

Query  335  FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
            FP+GE LVSSWWRLGFE V++PWGKPKY CP+VYHRKDIILLFP +D GG    GV+V+V
Sbjct  373  FPNGEVLVSSWWRLGFEEVEYPWGKPKYCCPLVYHRKDIILLFPPVDGGG---DGVSVIV  429

Query  155  ALPPKEMEKFKSLFHKFL  102
            ALPPKEM+KF  LF+KFL
Sbjct  430  ALPPKEMDKFYGLFNKFL  447



>ref|XP_003548930.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Glycine 
max]
Length=457

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = -2

Query  644  VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYG  465
            VTGFNV+TA IWRCKALSC   EN  +R ST+L+AVDIR RLNPPLP SY+GNAVLT Y 
Sbjct  279  VTGFNVITAYIWRCKALSCYNDEN-PNRSSTILYAVDIRSRLNPPLPKSYAGNAVLTAYA  337

Query  464  SAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFE  285
            +AKC ELEE PF K V+MV EGA RMT+EYARS IDWGE+  GFP+GE LVSSWWRLGFE
Sbjct  338  TAKCKELEEWPFMKLVEMVREGATRMTNEYARSIIDWGEINNGFPNGEVLVSSWWRLGFE  397

Query  284  GVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKF  105
             V++PWGKPKY CPVVYH+KDIILLFP +  G     GV+++VALPPKEMEKF  LF+KF
Sbjct  398  EVEYPWGKPKYCCPVVYHKKDIILLFPPVGGG----EGVSIIVALPPKEMEKFHGLFNKF  453

Query  104  LA  99
            L 
Sbjct  454  LT  455



>gb|KDO45315.1| hypothetical protein CISIN_1g012689mg [Citrus sinensis]
Length=458

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTK--VTGFNVLTAAIWRCKALSCLGGENNS-DRLSTVLFAVDIRRRLN  516
            LK+KAKA    +    +TGFNV++A IWRCKALS    +  + +R S +L+AVDIR RLN
Sbjct  264  LKEKAKATVEYENSRYITGFNVVSALIWRCKALSYDHAKGKTPERESRMLYAVDIRPRLN  323

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP SY GNAVL+ Y +AKC EL+E PF + V+MV EGA RM+DEYARSAIDWGE YKG
Sbjct  324  PPLPASYVGNAVLSAYANAKCEELKEKPFSRLVEMVSEGAKRMSDEYARSAIDWGETYKG  383

Query  335  FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
            FPHGEFLVSSWW+LGF  V++PWGKPKYSCPVVYH+KDIILLFP+IDN    ++GVNVLV
Sbjct  384  FPHGEFLVSSWWKLGFSKVEYPWGKPKYSCPVVYHKKDIILLFPNIDN----DNGVNVLV  439

Query  155  ALPPKEMEKFKSLFHKFLA  99
            +LP KEM +F+SLF+KFLA
Sbjct  440  SLPSKEMVEFESLFNKFLA  458



>ref|XP_006425205.1| hypothetical protein CICLE_v10010861mg [Citrus clementina]
 gb|ESR38445.1| hypothetical protein CICLE_v10010861mg [Citrus clementina]
Length=458

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTK--VTGFNVLTAAIWRCKALSCLGGENNS-DRLSTVLFAVDIRRRLN  516
            LK+KAKA    +    +TGFNV++A IWRCKALS    +  + +R S +L+AVDIR RLN
Sbjct  264  LKEKAKATVEYENSRYITGFNVVSALIWRCKALSYDHAKGKTPERESRMLYAVDIRPRLN  323

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP SY GNAVL+ Y +AKC EL+E PF + V+MV EGA RM+DEYARSAIDWGE YKG
Sbjct  324  PPLPASYVGNAVLSAYANAKCEELKEKPFSRLVEMVSEGAKRMSDEYARSAIDWGETYKG  383

Query  335  FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
            FPHGEFLVSSWW+LGF  V++PWGKPKYSCPVVYH+KDIILLFP+IDN    ++GVNVLV
Sbjct  384  FPHGEFLVSSWWKLGFSKVEYPWGKPKYSCPVVYHKKDIILLFPNIDN----DNGVNVLV  439

Query  155  ALPPKEMEKFKSLFHKFLA  99
            +LP KEM +F+SLF+KFLA
Sbjct  440  SLPSKEMVEFESLFNKFLA  458



>ref|XP_006480697.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=458

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTK--VTGFNVLTAAIWRCKALSCLGGENNS-DRLSTVLFAVDIRRRLN  516
            LK+KAKA    +    +TGFNV++A IWRCKALS    +  + +R S +L+AVDIR RLN
Sbjct  264  LKEKAKATVEYENSRYITGFNVVSALIWRCKALSYDHAKGKTPERESRMLYAVDIRPRLN  323

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP SY GNAVL+ Y +AKC EL+E PF + V+MV EGA RM+DEYARSAIDWGE YKG
Sbjct  324  PPLPASYVGNAVLSAYANAKCEELKEKPFSRLVEMVSEGAKRMSDEYARSAIDWGETYKG  383

Query  335  FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
            FPHGEFLVSSWW+LGF  V++PWGKPKYSCPVVYH+KDIILLFP+IDN    ++GVNVLV
Sbjct  384  FPHGEFLVSSWWKLGFSKVEYPWGKPKYSCPVVYHKKDIILLFPNIDN----DNGVNVLV  439

Query  155  ALPPKEMEKFKSLFHKFLA  99
            +LP KEM +F+SLF+KFLA
Sbjct  440  SLPSKEMVEFESLFNKFLA  458



>ref|XP_003519943.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Glycine max]
Length=456

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 6/182 (3%)
 Frame = -2

Query  644  VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYG  465
            VTGFNV+TA IWRCKALSC   ++N +R ST+L+AVDIR RLNPPLP SY+GNA+LT Y 
Sbjct  279  VTGFNVITAHIWRCKALSC--EDDNPNRSSTILYAVDIRSRLNPPLPKSYAGNAMLTAYA  336

Query  464  SAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFE  285
            + KC ELEE PF K V+MV EGA RMT+EYARS IDWGE  KG P+ E LVSSWWRLGFE
Sbjct  337  TTKCKELEELPFMKLVEMVREGATRMTNEYARSIIDWGETNKGCPNREVLVSSWWRLGFE  396

Query  284  GVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKF  105
             V++PWGKPKY CPVVYHRKDIILLFP ID GG    GV+++VALPPKEMEKF  LF+KF
Sbjct  397  EVEYPWGKPKYCCPVVYHRKDIILLFPPIDGGG----GVSIIVALPPKEMEKFYGLFNKF  452

Query  104  LA  99
            L 
Sbjct  453  LT  454



>ref|XP_008370853.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Malus 
domestica]
Length=499

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 156/203 (77%), Gaps = 7/203 (3%)
 Frame = -2

Query  689  RLKDKAKA---PDNVKTKVTGFNVLTAAIWRCKALSCLG--GENNSDRLSTVLFAVDIRR  525
             LK+KAK+       + K+T FNV+TA IWRCKALS      ++   R S +L+AVDIR+
Sbjct  295  HLKEKAKSIASSTKERVKITSFNVVTALIWRCKALSSSTYVDDHGESRESRILYAVDIRQ  354

Query  524  RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  345
            RLNPPLP  Y+GN VLT Y SA C ELEEGPF + V+MV EGAARMTDEYARS IDWGEL
Sbjct  355  RLNPPLPQGYTGNGVLTAYASAGCRELEEGPFSRAVEMVSEGAARMTDEYARSVIDWGEL  414

Query  344  YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP--DIDNGGKSNSG  171
             KGFP+GE LVSSWWRLGF  V++PWGKP YSCPVVYHRKDIIL FP  D+ + G + +G
Sbjct  415  RKGFPNGEVLVSSWWRLGFADVEYPWGKPXYSCPVVYHRKDIILFFPEQDVPDNGTNGTG  474

Query  170  VNVLVALPPKEMEKFKSLFHKFL  102
            VN+LVALP +EM+KF++LF KFL
Sbjct  475  VNILVALPHQEMQKFQALFQKFL  497



>ref|XP_009361568.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Pyrus 
x bretschneideri]
Length=499

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 157/203 (77%), Gaps = 7/203 (3%)
 Frame = -2

Query  689  RLKDKAKA---PDNVKTKVTGFNVLTAAIWRCKALSCLG--GENNSDRLSTVLFAVDIRR  525
             LK+KAK+       + K+T F+V+TA IWRCKALS      ++   R S +L+AVDIR+
Sbjct  295  HLKEKAKSVASSTKERVKITSFSVVTALIWRCKALSSSTYVDDHGESRESRILYAVDIRQ  354

Query  524  RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  345
            RLNPPLP  Y+GN VLT Y SA C ELEEGPF + V+MV EGAARMTDEYARS IDWGEL
Sbjct  355  RLNPPLPQGYTGNGVLTAYASAGCRELEEGPFSRAVEMVSEGAARMTDEYARSVIDWGEL  414

Query  344  YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP--DIDNGGKSNSG  171
             KGFP+GE LVSSWWRLGF  V++PWGKP+YSCPVVYHRKDIIL FP  D+ + G + +G
Sbjct  415  RKGFPNGEVLVSSWWRLGFADVEYPWGKPRYSCPVVYHRKDIILFFPEQDVPDNGTNGTG  474

Query  170  VNVLVALPPKEMEKFKSLFHKFL  102
            VN+LVALP +EM+KF++LF KFL
Sbjct  475  VNILVALPHREMQKFQALFQKFL  497



>ref|XP_007028077.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY08579.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 160/203 (79%), Gaps = 11/203 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVK--TKVTGFNVLTAAIWRCKALS-----CLGGENNSDRLSTVLFAVDIR  528
            LK+KAKA        ++TGFNV+TA +W CKALS          NN+DR ST+L+AV+IR
Sbjct  254  LKEKAKASGGTHKDARITGFNVVTALVWLCKALSWDEETTQERNNNADRESTLLYAVNIR  313

Query  527  RRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGE  348
             RL PPLP SY+GNAVLT Y +AKC E+EE PF + V+MV EGA RMTDEYARSAIDWGE
Sbjct  314  PRLIPPLPRSYTGNAVLTAYATAKCKEIEEWPFSRLVEMVSEGAKRMTDEYARSAIDWGE  373

Query  347  LYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  168
            +Y+GFP+GEFLVSSWW+LGF+ V +PWG+P+YSCPVV+HRKDIILLFPD+D     N+GV
Sbjct  374  IYQGFPNGEFLVSSWWKLGFDEVDYPWGRPRYSCPVVFHRKDIILLFPDVD----ENNGV  429

Query  167  NVLVALPPKEMEKFKSLFHKFLA  99
            NVLV+LP KEM KF+SLF  +LA
Sbjct  430  NVLVSLPSKEMSKFQSLFLNYLA  452



>gb|KHG26258.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=449

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 158/197 (80%), Gaps = 8/197 (4%)
 Frame = -2

Query  686  LKDKAKAP----DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL  519
            LK+KAKA          ++TGFNV+TA +W CKALS    E+N DR+ST+L+AV+IR RL
Sbjct  254  LKEKAKASAIGSHVSDARITGFNVVTALVWHCKALSWDNKESNLDRVSTLLYAVNIRPRL  313

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
             PPLP SY+GNAVLT Y  A C E++E PF + V++V EGA RMTDEYARSAIDWG++Y+
Sbjct  314  IPPLPMSYTGNAVLTAYARATCKEIDEAPFSRLVELVTEGAKRMTDEYARSAIDWGDIYQ  373

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFP+GEFLVSSWW+LGF+ V++PWG+PKYSCPVV+ RKDIIL FPDID+    N+GVNVL
Sbjct  374  GFPNGEFLVSSWWKLGFDEVEYPWGRPKYSCPVVFQRKDIILFFPDIDD----NNGVNVL  429

Query  158  VALPPKEMEKFKSLFHK  108
            V+LP KEM KFK+LFHK
Sbjct  430  VSLPSKEMSKFKTLFHK  446



>ref|XP_006353264.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=461

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK  +   +K+T FNV+T+ +WRCKALS    ENNS+R+STVLFAVDIR RLNPPL
Sbjct  265  LKEKAKDENTPNSKITSFNVVTSYVWRCKALS-YDDENNSERVSTVLFAVDIRPRLNPPL  323

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVLT Y SA C ELEEGPF K V +V +G  RM DEYARSAIDWGE+ KGFP+
Sbjct  324  PQSYAGNAVLTSYASATCHELEEGPFSKIVDLVSQGGKRMNDEYARSAIDWGEINKGFPN  383

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP-DIDNGGKSNSGVNVLVAL  150
            GEFL+SSWW+LGF  V++PWGKPKYSCPVV HRK+IILLFP   D    +N GVN+ VAL
Sbjct  384  GEFLLSSWWKLGFSQVEYPWGKPKYSCPVVCHRKEIILLFPNIDDGINNNNDGVNIFVAL  443

Query  149  PPKEMEKFKSLFHKFL  102
            PPK+M+KF+S F+KFL
Sbjct  444  PPKQMKKFESYFNKFL  459



>ref|NP_001185319.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
 gb|AAM62927.1| Similar to gb|Z84386 anthranilate N-hydroxycinnamoyl/benzoyltransferase 
from Dianthus caryophyllus [Arabidopsis thaliana]
 gb|AEE34378.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
Length=286

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  90   KLKERASETSNGNVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  149

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y   KC  L E PF + V+MV EG+ R+TDEYARSAIDWGELYK
Sbjct  150  NPELPPSYTGNAVLTAYAKEKCKALLEEPFGRIVEMVGEGSKRITDEYARSAIDWGELYK  209

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GV VL
Sbjct  210  GFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYVL  266

Query  158  VALPPKEMEKFKSLFHKFL  102
             ALP KEM KF+  F   L
Sbjct  267  AALPSKEMSKFQHWFEDTL  285



>ref|XP_010556190.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=443

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 155/204 (76%), Gaps = 10/204 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGG-------ENNSDRLSTVLFAVDI  531
            +LK+KA   ++   ++T FNV+TA IW+CKALS   G       E+  ++ ST+L+AVDI
Sbjct  243  KLKEKAGRGESSCVRITSFNVVTALIWKCKALSVPVGTDRDPRNEDLDEKESTILYAVDI  302

Query  530  RRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWG  351
            R RLNPPLP SY+GNAVLT Y  AK  EL   PFW+ V+ V  GA RMTDEYARS IDWG
Sbjct  303  RSRLNPPLPFSYTGNAVLTAYARAKRKELLREPFWRIVEKVEGGAKRMTDEYARSVIDWG  362

Query  350  ELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG  171
            E++KGFPHGE LVSSWW+LGF  V+FPWG+PKYSCPVVYHRKDIIL  PDID    S+ G
Sbjct  363  EMHKGFPHGEVLVSSWWKLGFADVEFPWGRPKYSCPVVYHRKDIILFLPDID---PSSKG  419

Query  170  VNVLVALPPKEMEKFKSLFHKFLA  99
            VNVLVALPPKEME F++LF +FLA
Sbjct  420  VNVLVALPPKEMEIFQALFQEFLA  443



>ref|NP_564853.2| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
 gb|AAC27152.1| Similar to gb|Z84386 anthranilate N-hydroxycinnamoyl/benzoyltransferase 
from Dianthus caryophyllus [Arabidopsis thaliana]
 gb|AEE34376.1| dual transcription unit and alternative splicing protein GLAUCE 
[Arabidopsis thaliana]
Length=450

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  254  KLKERASETSNGNVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  313

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y   KC  L E PF + V+MV EG+ R+TDEYARSAIDWGELYK
Sbjct  314  NPELPPSYTGNAVLTAYAKEKCKALLEEPFGRIVEMVGEGSKRITDEYARSAIDWGELYK  373

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GV VL
Sbjct  374  GFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYVL  430

Query  158  VALPPKEMEKFKSLFHKFL  102
             ALP KEM KF+  F   L
Sbjct  431  AALPSKEMSKFQHWFEDTL  449



>ref|XP_002886918.1| hypothetical protein ARALYDRAFT_315582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63177.1| hypothetical protein ARALYDRAFT_315582 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 150/199 (75%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  254  KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  313

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  314  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  373

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GV VL
Sbjct  374  GFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYVL  430

Query  158  VALPPKEMEKFKSLFHKFL  102
             ALP KEM KF+  F   L
Sbjct  431  AALPSKEMTKFQHWFEDTL  449



>ref|XP_002514787.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47341.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=450

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 159/199 (80%), Gaps = 9/199 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRLN  516
            LK+KAK   + + +V+GFNV+TA +WRCKALS     N   + +R+ST+L+AV+IR RL 
Sbjct  257  LKEKAKT--DAEARVSGFNVVTAHVWRCKALSYDESNNKGQDLERVSTLLYAVNIRARLI  314

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP SY+GNAVLT Y SAKC +L+EGP  + V+MV EGA RM DEYA+S IDWGE+ KG
Sbjct  315  PPLPASYAGNAVLTAYASAKCRDLKEGPLSRLVEMVREGAKRMNDEYAKSVIDWGEINKG  374

Query  335  FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
            FP+GEFLVSSWW+LGF+ V++PWG PKYSCP+VYHRKDIILLFPD  +     +GVNVLV
Sbjct  375  FPNGEFLVSSWWKLGFDEVEYPWGYPKYSCPLVYHRKDIILLFPDTVD----KNGVNVLV  430

Query  155  ALPPKEMEKFKSLFHKFLA  99
            ALP K+M KF++LFH+FL+
Sbjct  431  ALPSKQMNKFQTLFHEFLS  449



>ref|XP_003624566.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AES80784.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=445

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 151/195 (77%), Gaps = 5/195 (3%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   N  ++V  FNV+ A IWRCKALS      + +R S +L+AVDIR RLNPPL
Sbjct  255  LKEKAKG--NNTSRVISFNVVAAHIWRCKALS---KSYDPNRSSIILYAVDIRSRLNPPL  309

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P +Y+GNAVLT Y SAKC EL+EG F + V+MV EG+ RM+DEYARS IDWGELY GFP+
Sbjct  310  PRAYTGNAVLTAYASAKCEELKEGEFSRLVEMVEEGSRRMSDEYARSIIDWGELYNGFPN  369

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            G+ LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIILLFP  + G     GVN++VALP
Sbjct  370  GDVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILLFPSFNGGEGGGDGVNIIVALP  429

Query  146  PKEMEKFKSLFHKFL  102
              EMEKFKSLF+ FL
Sbjct  430  RDEMEKFKSLFYTFL  444



>ref|XP_003553994.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=444

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 151/195 (77%), Gaps = 8/195 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   N +   TGFNV+TA IWRCKALS      N  R ST+L+AVDIR RLNPPL
Sbjct  257  LKEKAKGSTNAR--ATGFNVITAHIWRCKALS---APYNPSRSSTILYAVDIRPRLNPPL  311

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P S++GNAVLT Y +AK  ELE+G F   V MV EGA RM+DEY RS IDWGE++ GFPH
Sbjct  312  PKSFAGNAVLTAYATAKWEELEKGEFSSLVGMVTEGAKRMSDEYTRSMIDWGEVHSGFPH  371

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+FP   +G   + G+N++VALP
Sbjct  372  GEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILVFPPFGSG---DDGINIIVALP  428

Query  146  PKEMEKFKSLFHKFL  102
            PKEM+KF++LF+ FL
Sbjct  429  PKEMDKFETLFYMFL  443



>gb|KHN46377.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=444

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 151/195 (77%), Gaps = 8/195 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   N +   TGFNV+TA IWRCKALS      N  R ST+L+AVDIR RLNPPL
Sbjct  257  LKEKAKGSTNAR--ATGFNVITAHIWRCKALS---APYNPSRSSTILYAVDIRPRLNPPL  311

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P S++GNAVLT Y +AK  ELE+G F   V MV EGA RM+DEY RS IDWGE++ GFPH
Sbjct  312  PKSFAGNAVLTAYATAKWEELEKGEFSSLVGMVTEGAKRMSDEYTRSMIDWGEVHSGFPH  371

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+FP   +G   + G+N++VALP
Sbjct  372  GEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILVFPPFGSG---DDGINIIVALP  428

Query  146  PKEMEKFKSLFHKFL  102
            PKEM+KF++LF+ FL
Sbjct  429  PKEMDKFETLFYMFL  443



>gb|AHA84252.1| omega-hydroxypalmitate O-feruloyl transferase [Phaseolus vulgaris]
Length=457

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 146/178 (82%), Gaps = 4/178 (2%)
 Frame = -2

Query  635  FNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAK  456
            FN +TA IWRCKALSC  G++N +++ST+L+AVDIR RL PPLP  Y+GNAVLT Y +A 
Sbjct  280  FNAITAHIWRCKALSC-DGDSNPNKVSTILYAVDIRSRLEPPLPKFYTGNAVLTAYATAT  338

Query  455  CAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQ  276
            C ELEE PF + V+ V EGA RM++EYARS IDWGE+ KGFP+GE LVSSWWRLGFE V+
Sbjct  339  CRELEEWPFMRLVERVVEGATRMSNEYARSIIDWGEINKGFPNGEVLVSSWWRLGFEEVE  398

Query  275  FPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  102
            +PWGKPKY CP+VYHRKDIILLFP +D GG    GV+V+VALPPKEM+KF  LF+KFL
Sbjct  399  YPWGKPKYCCPLVYHRKDIILLFPPVDGGG---DGVSVIVALPPKEMDKFYGLFNKFL  453



>ref|XP_008218487.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Prunus 
mume]
Length=488

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 157/226 (69%), Gaps = 34/226 (15%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS-------------TV  549
            RLKDKAK+     T  + FNV+TA IWRCKALS     ++ + ++              +
Sbjct  264  RLKDKAKS----TTASSSFNVVTALIWRCKALSSSSSSDDDEDVNYKRAASSSSSRESRI  319

Query  548  LFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYAR  369
            L+AVDIR RL PPLP +Y+GNAVLT Y SAKC ELEE PF + V+MV EGA RMTDEYAR
Sbjct  320  LYAVDIRPRLKPPLPKAYTGNAVLTAYASAKCRELEEVPFSRMVEMVSEGATRMTDEYAR  379

Query  368  SAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN-  192
            S IDWGEL+KGFPHGE LVSSWWRLGF  V++PWGKP+YSCPVVYHRKDIILLFP+  + 
Sbjct  380  SVIDWGELHKGFPHGEVLVSSWWRLGFADVEYPWGKPRYSCPVVYHRKDIILLFPEQQDM  439

Query  191  ----------------GGKSNSGVNVLVALPPKEMEKFKSLFHKFL  102
                            G    +GVN+LVALP KEM+KF++LFHKFL
Sbjct  440  HEYSSSASPTNTTTMAGRAGAAGVNILVALPHKEMQKFQALFHKFL  485



>ref|XP_010038444.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW84609.1| hypothetical protein EUGRSUZ_B01441 [Eucalyptus grandis]
Length=463

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 146/189 (77%), Gaps = 4/189 (2%)
 Frame = -2

Query  653  KTKVTGFNVLTAAIWRCKALS-CLGGENNSD--RLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            K +VTGFNV+TA IWRCKALS C G ++ S   R ST+L+AVDIR RL PPLP  Y+GNA
Sbjct  275  KARVTGFNVVTAHIWRCKALSSCDGTDDGSSKSRSSTLLYAVDIRPRLEPPLPRGYAGNA  334

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSW  303
            VLT Y +  C ELEE P  + V+MV EGA RMTD+YARS IDWGE+  GFPHGE LVSSW
Sbjct  335  VLTAYATVTCGELEEWPLGRLVEMVTEGAGRMTDKYARSVIDWGEVNVGFPHGEVLVSSW  394

Query  302  WRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVALPPKEMEKF  126
            WRLGF  V++PWG+P+YSCP+VYHRKDIILLFPD I        GVNVLVALP  EM KF
Sbjct  395  WRLGFTDVEYPWGRPRYSCPLVYHRKDIILLFPDMITTSPNGGDGVNVLVALPGPEMAKF  454

Query  125  KSLFHKFLA  99
            +SLFHKFLA
Sbjct  455  QSLFHKFLA  463



>gb|KHN46812.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=424

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 149/195 (76%), Gaps = 5/195 (3%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   N +   TGFNV+TA +WRCKALS      +  R S +L+A+DIR RL PPL
Sbjct  234  LKEKAKGSTNARA--TGFNVITAHLWRCKALS---APYDPSRSSIILYAMDIRPRLKPPL  288

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P S++GNAVLT Y  AKC ELE+  F + V+MV EGA RM+DEYARS IDWGE++ GFPH
Sbjct  289  PKSFAGNAVLTAYAIAKCEELEKEEFSRLVEMVTEGAKRMSDEYARSMIDWGEVHSGFPH  348

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+FP        + G+N++VALP
Sbjct  349  GEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILVFPPFGGSSGDDDGINIIVALP  408

Query  146  PKEMEKFKSLFHKFL  102
            PKEM+KF++LF+ FL
Sbjct  409  PKEMDKFENLFYMFL  423



>ref|XP_011466087.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase [Fragaria vesca subsp. vesca]
Length=521

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 149/188 (79%), Gaps = 7/188 (4%)
 Frame = -2

Query  644  VTGFNVLTAAIWRCKAL-SC---LGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVL  477
            VT FNV+TA IWRCKAL +C    G ++  DR S +L+AVDIR RL PPLP SY+GNAVL
Sbjct  331  VTSFNVVTALIWRCKALPACDDQYGDDDGMDRESRILYAVDIRPRLTPPLPRSYTGNAVL  390

Query  476  TGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWR  297
              Y SA+C ELE+ PF +TV+MV+EGA RMT+EY RS IDWGEL+KGFPHG+ LVSSWW+
Sbjct  391  IAYASARCRELEQAPFSRTVEMVHEGAERMTNEYVRSVIDWGELHKGFPHGDVLVSSWWK  450

Query  296  LGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD--IDNG-GKSNSGVNVLVALPPKEMEKF  126
            LGF  V++PW KP+YSCPV YHRKD+ILLFPD  ID G G  N GVN+LVALP  EM+KF
Sbjct  451  LGFAEVEYPWRKPRYSCPVAYHRKDVILLFPDEQIDAGCGGRNGGVNILVALPCDEMQKF  510

Query  125  KSLFHKFL  102
            ++LF KFL
Sbjct  511  QTLFLKFL  518



>ref|XP_003548796.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=447

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 149/195 (76%), Gaps = 5/195 (3%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   N +   TGFNV+TA +WRCKALS      +  R S +L+A+DIR RL PPL
Sbjct  257  LKEKAKGSTNARA--TGFNVITAHLWRCKALS---APYDPSRSSIILYAMDIRPRLKPPL  311

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P S++GNAVLT Y  AKC ELE+  F + V+MV EGA RM+DEYARS IDWGE++ GFPH
Sbjct  312  PKSFAGNAVLTAYAIAKCEELEKEEFSRLVEMVTEGAKRMSDEYARSMIDWGEVHSGFPH  371

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GE LVSSWWRLGFE V++PWGKPKY CPVVYHRKDIIL+FP        + G+N++VALP
Sbjct  372  GEVLVSSWWRLGFEEVEYPWGKPKYCCPVVYHRKDIILVFPPFGGSSGDDDGINIIVALP  431

Query  146  PKEMEKFKSLFHKFL  102
            PKEM+KF++LF+ FL
Sbjct  432  PKEMDKFENLFYMFL  446



>ref|XP_007205121.1| hypothetical protein PRUPE_ppa004875mg [Prunus persica]
 gb|EMJ06320.1| hypothetical protein PRUPE_ppa004875mg [Prunus persica]
Length=487

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 157/227 (69%), Gaps = 35/227 (15%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLS--------------T  552
            RLKDKAK+     T  + FNV+TA IWRCKALS     ++ + ++               
Sbjct  262  RLKDKAKS----TTASSSFNVVTALIWRCKALSSSSSSDDDEDVNYKRAASSSSSSRESR  317

Query  551  VLFAVDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYA  372
            +L+AVDIR RL PPLP +Y+GNAVLT Y SAKC ELEE PF + V+MV EGA RMTDEYA
Sbjct  318  ILYAVDIRPRLKPPLPKAYTGNAVLTAYASAKCRELEEVPFSRMVEMVSEGATRMTDEYA  377

Query  371  RSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDN  192
            RS IDWGEL+KGFPHGE LVSSWWRLGF  V++PWGKP+YSCPVVYHRKDIILLFP+  +
Sbjct  378  RSVIDWGELHKGFPHGEVLVSSWWRLGFADVEYPWGKPRYSCPVVYHRKDIILLFPEQRD  437

Query  191  -----------------GGKSNSGVNVLVALPPKEMEKFKSLFHKFL  102
                             G    +GVN+LVALP KEM+KF++LFHKFL
Sbjct  438  MHEYSSSATTTSTTTMAGRAGGAGVNILVALPHKEMQKFQALFHKFL  484



>gb|EYU39480.1| hypothetical protein MIMGU_mgv1a027110mg [Erythranthe guttata]
Length=399

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 151/196 (77%), Gaps = 18/196 (9%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            RLK++AKA     TK TGFNV+TA IWRCK LSC G     DR+STVL+AV IR RL PP
Sbjct  221  RLKEEAKA----ATKATGFNVVTAHIWRCKTLSCGGSR---DRVSTVLYAVVIRGRLEPP  273

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SY GNAVL+ Y SAKC+ LEE PF + V MVYEGA RM DEYARSA+DWGE+YKGFP
Sbjct  274  LPASYCGNAVLSAYTSAKCSALEEEPFSRVVDMVYEGAERMNDEYARSAVDWGEIYKGFP  333

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            +GEFL+SSWWRL          +P+YSCPVVYHRKDI+L+FP+I  GG  ++GVN+LVAL
Sbjct  334  NGEFLISSWWRL---------IRPRYSCPVVYHRKDIVLIFPEI--GGAGSNGVNILVAL  382

Query  149  PPKEMEKFKSLFHKFL  102
            P  EM+KF+SLF K+L
Sbjct  383  PANEMDKFESLFRKYL  398



>ref|XP_006301983.1| hypothetical protein CARUB_v10022464mg [Capsella rubella]
 gb|EOA34881.1| hypothetical protein CARUB_v10022464mg [Capsella rubella]
Length=451

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 147/199 (74%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL---STVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E     L   ST+L+AVDIR RL
Sbjct  255  KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEEEEANLERESTILYAVDIRGRL  314

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMT+EYARSAIDWGELYK
Sbjct  315  NPELPSSYTGNAVLTAYAKAKCNALLEEPFGEIVDMVGEGAKRMTNEYARSAIDWGELYK  374

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID  GK   GV VL
Sbjct  375  GFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDGK---GVYVL  431

Query  158  VALPPKEMEKFKSLFHKFL  102
             ALP KEM KF+  F   L
Sbjct  432  AALPSKEMIKFQHWFEDTL  450



>ref|XP_010415082.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=451

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL----STVLFAVDIRRR  522
            +LK++A    +   +V+GFNV+TA +WRCKALS    +   +      ST+L+AVDIR R
Sbjct  254  KLKERASETSSGYVRVSGFNVVTALVWRCKALSVTSEKEEEEANLERESTILYAVDIRGR  313

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
            LNP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELY
Sbjct  314  LNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGAKRITDEYARSAIDWGELY  373

Query  341  KGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
            KGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GV V
Sbjct  374  KGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYV  430

Query  161  LVALPPKEMEKFKSLFHKFL  102
            L ALP KEM KF+  F   L
Sbjct  431  LAALPSKEMTKFQHWFEDTL  450



>ref|XP_010511440.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Camelina sativa]
 ref|XP_010511441.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Camelina sativa]
Length=451

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL----STVLFAVDIRRR  522
            +LK++A    +   +V+GFNV+TA +WRCKALS    +   +      ST+L+AVDIR R
Sbjct  254  KLKERASETSSGYVRVSGFNVVTALVWRCKALSVTSEKEEEEANLERESTILYAVDIRGR  313

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
            LNP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELY
Sbjct  314  LNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGAKRITDEYARSAIDWGELY  373

Query  341  KGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
            KGFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GV V
Sbjct  374  KGFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYV  430

Query  161  LVALPPKEMEKFKSLFHKFL  102
            L ALP KEM KF+  F   L
Sbjct  431  LAALPSKEMTKFQHWFEDTL  450



>ref|XP_010470417.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=451

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL----STVLFAVDIRRR  522
            +LK++A    +   +V+GFNV+TA +WRCKALS    +   +      ST+L+AVDIR R
Sbjct  254  KLKERASETSSGYVRVSGFNVVTALVWRCKALSVTSEKEEEEANLERESTILYAVDIRGR  313

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
            LNP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELY
Sbjct  314  LNPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGAKRITDEYARSAIDWGELY  373

Query  341  KGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
            KGFPHG+ LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GV V
Sbjct  374  KGFPHGQVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVYV  430

Query  161  LVALPPKEMEKFKSLFHKFL  102
            L ALP KEM KF+  F   L
Sbjct  431  LAALPSKEMTKFQHWFEDTL  450



>emb|CDY07450.1| BnaA07g25290D [Brassica napus]
Length=298

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 150/200 (75%), Gaps = 8/200 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKT----KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRL  519
            L+ K KA +++ +    + TGFNV+TA +WRCKALS +  E + ++ ST+L+AVDIR RL
Sbjct  103  LRLKEKASESISSTGCVRATGFNVVTALVWRCKALSFVE-EEDLEKESTILYAVDIRGRL  161

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AK   L E PF + V+MV EG  R+TDEYARSAIDWGE+YK
Sbjct  162  NPQLPSSYTGNAVLTAYAKAKRKALLEEPFGRIVEMVGEGGNRITDEYARSAIDWGEMYK  221

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHGE LVSSWW+LGF  V++PWGKPKY CPVVYHRKDI+LLFPDI   G  + GV VL
Sbjct  222  GFPHGEVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHRKDIVLLFPDI---GGDSKGVYVL  278

Query  158  VALPPKEMEKFKSLFHKFLA  99
             ALP KEM KF++ F   L+
Sbjct  279  AALPSKEMAKFQNWFEDTLS  298



>ref|XP_006391555.1| hypothetical protein EUTSA_v10018535mg [Eutrema salsugineum]
 gb|ESQ28841.1| hypothetical protein EUTSA_v10018535mg [Eutrema salsugineum]
Length=452

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 148/196 (76%), Gaps = 6/196 (3%)
 Frame = -2

Query  689  RLKDKA-KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL--STVLFAVDIRRRL  519
            RLK+KA +   +   +VTGFNV+TA +WRCKALS +  E   D    ST+L+AVDIR RL
Sbjct  256  RLKEKASECLSSECVRVTGFNVVTALVWRCKALSLVEEEEEKDLERESTILYAVDIRGRL  315

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AK   L E PF + V+MV EG+ R+TDEYARSAIDWGE+YK
Sbjct  316  NPQLPSSYTGNAVLTAYAKAKRKALHEEPFGRIVEMVGEGSKRITDEYARSAIDWGEMYK  375

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHGE LVSSWW+LGF  V++PWGKPKYSCPVVYHRKDI+LLFPDID   K   GVNVL
Sbjct  376  GFPHGEVLVSSWWKLGFAEVEYPWGKPKYSCPVVYHRKDIVLLFPDIDGDSK---GVNVL  432

Query  158  VALPPKEMEKFKSLFH  111
             ALP KEM KF+  F 
Sbjct  433  AALPSKEMCKFQKWFE  448



>gb|EPS57259.1| hypothetical protein M569_17562, partial [Genlisea aurea]
Length=307

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 154/198 (78%), Gaps = 7/198 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNS--DRLSTVLFAVDIRRRLNP  513
            LK + ++      KV+GFN +TA +WRCKALSC G EN    DR S VL+AVDIR RL+P
Sbjct  114  LKKRVESSQPKPAKVSGFNAITAHVWRCKALSC-GAENGGGRDRESVVLYAVDIRNRLSP  172

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP SY GNAV+T Y +AKC ELEE P  K  + V EGAAR+TDEYARS IDWG++ KGF
Sbjct  173  PLPSSYCGNAVVTAYAAAKCWELEEEPLEKLTERVAEGAARITDEYARSVIDWGQINKGF  232

Query  332  PHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
            P+GEFL+SSWWRLGF+ V++PWG+PKYSCPVVY RKDIILLFPDI +    + GVNVL A
Sbjct  233  PNGEFLISSWWRLGFDEVEYPWGRPKYSCPVVYRRKDIILLFPDIGD----SHGVNVLAA  288

Query  152  LPPKEMEKFKSLFHKFLA  99
            LPP EM KF+SLF+K+LA
Sbjct  289  LPPNEMPKFESLFYKYLA  306



>emb|CDY16408.1| BnaA02g12120D [Brassica napus]
Length=451

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 150/199 (75%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKA-KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSD--RLSTVLFAVDIRRRL  519
            RLK+KA ++  +V  +VTGFNV+TA +WRCKALS +  E   D  + ST+L+AVDIR RL
Sbjct  255  RLKEKASESVSSVCVRVTGFNVVTALVWRCKALSLVEEEEVDDLEKESTILYAVDIRGRL  314

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            +P LP SY+GNAVLT YG AK   L E PF   V+MV EGA R+TDEYARSAIDWGE+YK
Sbjct  315  DPQLPSSYTGNAVLTAYGKAKRKALLEEPFGTIVEMVGEGANRITDEYARSAIDWGEMYK  374

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHG+ LVSSWW+LGF  V++PWGKPKY CPVVYHRKDI+LLFPDID   K   GV VL
Sbjct  375  GFPHGDVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHRKDIVLLFPDIDGDSK---GVYVL  431

Query  158  VALPPKEMEKFKSLFHKFL  102
             ALP KEM KF+  F   L
Sbjct  432  AALPSKEMTKFQKWFEDTL  450



>ref|XP_009127402.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=451

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 150/199 (75%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKA-KAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSD--RLSTVLFAVDIRRRL  519
            RLK+KA ++  +V  +VTGFNV+TA +WRCKALS +  E   D  + ST+L+AVDIR RL
Sbjct  255  RLKEKASESVSSVCVRVTGFNVVTALVWRCKALSLVEEEEVDDLEKESTILYAVDIRGRL  314

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            +P LP SY+GNAVLT YG AK   L E PF   V+MV EGA R+TDEYARSAIDWGE+YK
Sbjct  315  DPQLPSSYTGNAVLTAYGKAKRKALFEEPFGTIVEMVGEGANRITDEYARSAIDWGEMYK  374

Query  338  GFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            GFPHG+ LVSSWW+LGF  V++PWGKPKY CPVVYHRKDI+LLFPDID   K   GV VL
Sbjct  375  GFPHGDVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHRKDIVLLFPDIDGDSK---GVYVL  431

Query  158  VALPPKEMEKFKSLFHKFL  102
             ALP KEM KF+  F   L
Sbjct  432  AALPSKEMTKFQKWFEDTL  450



>emb|CDY39285.1| BnaC06g27060D [Brassica napus]
Length=451

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = -2

Query  689  RLKDKAKAPDNVK--TKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            RLK+KA    +     + TGFNV+TA +WRCKALS +  E + ++ ST+L+AVDIR RL+
Sbjct  257  RLKEKASESMSSTGCVRATGFNVVTALVWRCKALSYVE-EEDLEKESTILYAVDIRGRLD  315

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P LP SY+GNAVLT Y  AK   L E PF + V+MV EGA R+TDEYARSAIDWGE+YKG
Sbjct  316  PQLPSSYTGNAVLTAYAKAKRKALLEEPFGRIVEMVGEGANRITDEYARSAIDWGEMYKG  375

Query  335  FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
            FPHGE LVSSWW+LGF  V++PWGKPKY CPVVYHRKDI+LLFP+ID   K   GV VL 
Sbjct  376  FPHGEVLVSSWWKLGFAEVEYPWGKPKYCCPVVYHRKDIVLLFPEIDGDSK---GVYVLA  432

Query  155  ALPPKEMEKFKSLFHKFLA  99
            ALP +EM KF++ F   L+
Sbjct  433  ALPAEEMAKFQNWFEDTLS  451



>ref|XP_007161775.1| hypothetical protein PHAVU_001G097400g, partial [Phaseolus vulgaris]
 gb|ESW33769.1| hypothetical protein PHAVU_001G097400g, partial [Phaseolus vulgaris]
Length=294

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 149/195 (76%), Gaps = 7/195 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   N +   TGFNV+TA +WRCKALS      + +R ST+LFAVDIR +L PPL
Sbjct  104  LKEKAKGSTNARA--TGFNVITAHVWRCKALS---APYDPNRSSTILFAVDIRSKLIPPL  158

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  ++GNAVLT Y +A C ELE+G F + V+MV EGA RM+DEYARS ID GE++ GFP 
Sbjct  159  PKGFAGNAVLTAYAAATCEELEKGEFSRLVEMVKEGAERMSDEYARSIIDRGEVHDGFPR  218

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            G+ LVS+WWRLGFE V++PWGKPKY CPVV+HRKDIILL      GG  + G+N++VALP
Sbjct  219  GDVLVSTWWRLGFEEVEYPWGKPKYCCPVVHHRKDIILL--FPPFGGGGDDGINIIVALP  276

Query  146  PKEMEKFKSLFHKFL  102
            PKEM+KF++LF+ FL
Sbjct  277  PKEMQKFETLFYMFL  291



>ref|XP_010241521.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=459

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 143/184 (78%), Gaps = 6/184 (3%)
 Frame = -2

Query  641  TGFNVLTAAIWRCKALSC---LGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTG  471
            + FNV+TA +WRCKAL+    +   + S+++STVL+AVD+R +L PPLP SY+GNAVLT 
Sbjct  279  SSFNVVTAHVWRCKALAAAADITQNDISEKMSTVLYAVDVRSKLTPPLPPSYTGNAVLTA  338

Query  470  YGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEFLVSSWWRLG  291
            Y  A C ELE  PF   V+ V+EGA RMTDEY RSAIDWGELY+G+P  + L+SSWW+LG
Sbjct  339  YAMASCHELENAPFSSLVEKVFEGATRMTDEYIRSAIDWGELYQGYPLCDLLISSWWKLG  398

Query  290  FEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  111
            F  V++PWG+PKY CP+++H+KD+IL FPDI+ G    + +N+ VALP KEM+KF++LF+
Sbjct  399  FSEVKYPWGRPKYCCPIIHHKKDVILFFPDIERG---QNALNIFVALPHKEMDKFQALFN  455

Query  110  KFLA  99
            KFLA
Sbjct  456  KFLA  459



>ref|XP_010268237.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=458

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = -2

Query  689  RLKDKAKAPDN----VKTKVTGFNVLTAAIWRCKALSCLGGENNSDR-LSTVLFAVDIRR  525
             LK+KAK   +      T  T FNV+TA +WRC AL+   G++   +  STVL+A DIRR
Sbjct  258  HLKEKAKLGQSKNGPTPTHATSFNVVTAHVWRCMALAKDVGQSPEKKSTSTVLYAADIRR  317

Query  524  RLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGEL  345
            RL+PPLP SY GNAV+  Y +A  +E+E GPF   V+MV +GA R+ DEY RS IDWGEL
Sbjct  318  RLSPPLPPSYGGNAVVMAYATASFSEIEGGPFSHLVEMVSDGARRLEDEYIRSVIDWGEL  377

Query  344  YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVN  165
             KGFP G+ L+SSWWRLGF  V++PWG+PKY CP+V+H+KD+ILL PDI+   K N GVN
Sbjct  378  NKGFPMGDVLISSWWRLGFSQVEYPWGRPKYCCPIVHHKKDLILLLPDINEDTKGN-GVN  436

Query  164  VLVALPPKEMEKFKSLFHKFLA  99
            VLVALP KE++KF+SLF++ LA
Sbjct  437  VLVALPIKELKKFQSLFNELLA  458



>ref|XP_008802387.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=331

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 145/196 (74%), Gaps = 7/196 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LKDKAK   +     + FNV  A +WRCKAL+      +S++LSTVL+AVD+R RL PPL
Sbjct  138  LKDKAKT--SPPPAASSFNVAAAHLWRCKALA--SSTRSSNKLSTVLYAVDLRSRLKPPL  193

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SY+GNAVL+ Y +A C+ELE GPF + V++VY+GA RMTDEYARS IDWG+L +GFP 
Sbjct  194  PRSYAGNAVLSAYATAACSELEAGPFARIVELVYKGAERMTDEYARSVIDWGQLNQGFPR  253

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            G+ +VSSW RLGF  V++PWG+PK+S PV   + DIILLFP     GK   G+N LV LP
Sbjct  254  GDVVVSSWLRLGFGEVEYPWGRPKHSFPVGNPQWDIILLFP---ASGKEGKGMNALVPLP  310

Query  146  PKEMEKFKSLFHKFLA  99
             +++EKF+SLF+KFLA
Sbjct  311  TEDVEKFRSLFYKFLA  326



>ref|XP_010912121.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Elaeis 
guineensis]
Length=452

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 150/196 (77%), Gaps = 7/196 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK   +     + FNV+ A +WRCKAL+    + NS++ ST+L+AVD+R RL PPL
Sbjct  258  LKNKAKT--SSPPAASSFNVVAAHLWRCKALA--SSKCNSNKSSTILYAVDLRSRLKPPL  313

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P+SY+GNAVL+ Y +A C +LE+GPF + V++VY+GA RMTDEYARS IDWG+L +GFP 
Sbjct  314  PNSYAGNAVLSAYATAPCGDLEKGPFARIVELVYKGAERMTDEYARSVIDWGQLNQGFPW  373

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            G+ +VSSW RLGF  V++PWG+PK+SCPV   + DIILLFP I   GK   G+N LVALP
Sbjct  374  GDVVVSSWLRLGFSEVEYPWGRPKHSCPVGNPQWDIILLFPTI---GKEGKGMNALVALP  430

Query  146  PKEMEKFKSLFHKFLA  99
             +++EKF+SLF+KFLA
Sbjct  431  IEDVEKFRSLFYKFLA  446



>ref|XP_011075071.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=453

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 137/195 (70%), Gaps = 11/195 (6%)
 Frame = -2

Query  677  KAKAPDNVK---TKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            K KA +N+    TK+T FNV+ A IWRCKALS    E N DR+ST+L  VD+R RLNPPL
Sbjct  261  KGKAKENISYSTTKITSFNVVAALIWRCKALSN-DAEYNKDRVSTLLNVVDLRSRLNPPL  319

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            PDSYSGNAVL  Y SA C ++E+ PF K V+MV E   R++DEY++S IDW E+ KG P 
Sbjct  320  PDSYSGNAVLVAYSSATCEDIEKWPFSKLVEMVSEAPKRVSDEYSKSVIDWLEINKGLPC  379

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GE++VSSW RL F  V +PWGKP YS PVV HRKDI  +FP +D       GVN LV+LP
Sbjct  380  GEYMVSSWLRLRFGEVVYPWGKPVYSGPVVSHRKDICWIFPGVD-------GVNALVSLP  432

Query  146  PKEMEKFKSLFHKFL  102
             KEME+F +LF +F 
Sbjct  433  AKEMERFVALFREFF  447



>ref|XP_003624564.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES80782.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=435

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 128/182 (70%), Gaps = 20/182 (11%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK+KAK   N   +VT FNV+T  +WRCKALS   G  + +R ST+L+AVDIR RLNPP
Sbjct  256  KLKEKAKI--NSIARVTSFNVITTHLWRCKALS---GPYDPNRSSTILYAVDIRSRLNPP  310

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y+GN               EG F + V+MV+EG  RM DEYARS IDWGELY GFP
Sbjct  311  LPREYAGN---------------EGEFSRLVEMVWEGTKRMGDEYARSIIDWGELYNGFP  355

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            +GE LVSSWWRLGFE V++PWGKPKY CPVVYH+KDIILLFP        + GVN++VAL
Sbjct  356  NGELLVSSWWRLGFEEVEYPWGKPKYCCPVVYHKKDIILLFPSFHGVEGGDDGVNIIVAL  415

Query  149  PP  144
            PP
Sbjct  416  PP  417



>gb|EYU39979.1| hypothetical protein MIMGU_mgv1a005557mg [Erythranthe guttata]
Length=479

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 135/195 (69%), Gaps = 7/195 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KAK P+   T+++ FN     IW+CKALS    + + +R+ST L  VD+R RL+PPL
Sbjct  260  LKEKAKRPE---TRISSFNAAATLIWQCKALSYGENQKDEERVSTFLNVVDLRSRLSPPL  316

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P+ Y GNA+L  Y S KC  LE+ PF + V+MV E  AR++DEYARS IDW E+ +G P 
Sbjct  317  PEPYCGNAILVAYTSEKCQNLEKMPFSELVKMVAESPARVSDEYARSVIDWLEINRGLPC  376

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            GE++VSSW RLGFE V FPWGKP++S PVV HRKDI  +FP  +N G     +N LV+LP
Sbjct  377  GEYMVSSWLRLGFEEVVFPWGKPQHSGPVVNHRKDICWIFPSSNNDG----AINALVSLP  432

Query  146  PKEMEKFKSLFHKFL  102
             KEME+F+S F  F 
Sbjct  433  AKEMERFESHFCNFF  447



>ref|XP_010255141.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=465

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 149/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KAK   +     T FNV+ A IWRCKALS   GEN+ D++STVL+AVDIR R+ PP
Sbjct  258  KLKQKAKHEGSNPHVTTSFNVVAAHIWRCKALSEDVGENDLDQMSTVLYAVDIRPRIRPP  317

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SY+GNA+L GY +A   +++E PF + V+MV  GA RMTDEYARS IDW ELYKG P
Sbjct  318  LPPSYTGNAILPGYATASFRDIKEAPFSRLVEMVSVGARRMTDEYARSVIDWIELYKGIP  377

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSG---VNVL  159
            +G+ L+ SWWRL F  V++PWG+P YS P V +RK +ILL PDI+  G S+S    ++V 
Sbjct  378  YGDLLIVSWWRLRFSEVEYPWGRPSYSFPAVKYRKGLILLIPDIECEGASSSSDQELSVF  437

Query  158  VALPPKEMEKFKSLFHKFLA*SSSSS  81
            ++LP K+MEKF++LF +FL+  +S S
Sbjct  438  LSLPIKKMEKFQALFREFLSPDTSRS  463



>ref|XP_011100415.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=448

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 131/196 (67%), Gaps = 9/196 (5%)
 Frame = -2

Query  686  LKDKAK-APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            LKDKA+ +  +  TK+T F V+ A IWRCKALS    E N D +ST+   VDIR RLNPP
Sbjct  255  LKDKARESISSTSTKITSFIVVAALIWRCKALSNYT-EYNKDTVSTLFNIVDIRSRLNPP  313

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP+SY GNAVL  Y SA C ++E+ PF K V++V EG  RMTDEY +S IDW E+ KG P
Sbjct  314  LPNSYCGNAVLAAYSSATCDDIEKWPFSKLVELVAEGPKRMTDEYVKSTIDWLEINKGRP  373

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
             GE+ VSSW R+ F  V +PWGKP +S PVV +RKDI  +FP  D        VN LV+L
Sbjct  374  RGEYTVSSWLRMRFGEVVYPWGKPMHSGPVVSYRKDICWIFPGFDR-------VNALVSL  426

Query  149  PPKEMEKFKSLFHKFL  102
            P KEME+F + F +F 
Sbjct  427  PAKEMERFVACFREFF  442



>ref|XP_006858654.1| hypothetical protein AMTR_s00066p00062130 [Amborella trichopoda]
 gb|ERN20121.1| hypothetical protein AMTR_s00066p00062130 [Amborella trichopoda]
Length=549

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA+    +++  T FNV+ A +WRCK L+   G  N    ST+L+AVDIRR+L PPL
Sbjct  260  LKQKARQGGALES-CTSFNVVAAHLWRCKTLAT--GRGNEQ--STLLYAVDIRRKLKPPL  314

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y+GNAVL  Y  A+ +EL  G F   V+ V+EG  R+ DEYARS IDWGE ++G P 
Sbjct  315  PHEYAGNAVLAAYAIAELSELRYGTFSNIVEKVWEGPRRIDDEYARSVIDWGEEHRGVPR  374

Query  326  GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
            G+  VSSWWRLG   V + WG+PKY+CPVV+  KDIILLFPDI  G  S+ GVN LVALP
Sbjct  375  GDVFVSSWWRLGLSEVDYVWGRPKYTCPVVHATKDIILLFPDI-QGMSSSKGVNCLVALP  433

Query  146  PKEMEKFKSLF  114
             KEME     F
Sbjct  434  EKEMEGIPHPF  444



>gb|EYU20701.1| hypothetical protein MIMGU_mgv1a023965mg [Erythranthe guttata]
Length=460

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 124/184 (67%), Gaps = 6/184 (3%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            K T FNV  A +WRC+ALS    ++N DR+ST+L+ VD+R RLNPPLP  YSGNA+L  Y
Sbjct  278  KATTFNVAAALVWRCRALSAHDFDHNKDRVSTILYVVDLRSRLNPPLPAGYSGNALLVAY  337

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF-PHGEFLVSSWWRLG  291
             SAKC ++E+ PF K V+M+ +G  R++DEY +S  D+ E+ KG  P G+ +VSSW RLG
Sbjct  338  ASAKCEDIEKWPFRKMVEMISQGVTRISDEYVKSVTDFLEINKGMIPRGDCIVSSWLRLG  397

Query  290  FEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  111
            ++ V+FPWGKP    PVV   + I  +FPD+D     + GVNVLV  P  EME F+  FH
Sbjct  398  YDQVEFPWGKPVCCTPVVNKLERIFWIFPDVD-----SDGVNVLVQRPAAEMETFQFHFH  452

Query  110  KFLA  99
             F A
Sbjct  453  NFFA  456



>gb|EYU34262.1| hypothetical protein MIMGU_mgv1a025490mg [Erythranthe guttata]
Length=314

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 129/198 (65%), Gaps = 13/198 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       ++ +++   V+ A IWRCKA S     ++ +R+ST+L  +DIR R+NPP
Sbjct  124  HLKDNITKTSKIE-RISTLAVVAALIWRCKAFS-----DDKNRVSTLLSVIDIRPRVNPP  177

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E+  GPF K V+++ EGA  MT EY +SA DW EL +G P
Sbjct  178  LPYSYSANAVLPLGVSETCEEIRNGPFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIP  237

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVA  153
            HG+++VSSW R GF+ V++ WGKP YSCPVV HRKDI  +F D +DN      GV  +VA
Sbjct  238  HGDYMVSSWLRFGFDEVEYAWGKPMYSCPVVNHRKDICWVFRDAVDN------GVCAMVA  291

Query  152  LPPKEMEKFKSLFHKFLA  99
            LP +EM+ F+ +FH F A
Sbjct  292  LPSQEMDIFEGVFHDFFA  309



>ref|XP_011100416.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=448

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 131/196 (67%), Gaps = 9/196 (5%)
 Frame = -2

Query  686  LKDKAK-APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            LKDKA+ +  +  TK+T F V+ A IWRCKALS    E N DR+ST+   VD+R RLNP 
Sbjct  255  LKDKARESISSTSTKITSFIVVAALIWRCKALSNYT-EYNKDRVSTLFNIVDLRSRLNPS  313

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP+SY GNAVL  Y SA C ++++ PF K V++V E   RMTDEYA+S IDW E+ KG P
Sbjct  314  LPNSYCGNAVLGAYSSATCDDIKKWPFSKLVELVAEEPKRMTDEYAKSTIDWLEINKGLP  373

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
             GE+ VSSW R+ F  V +PWGKP +S PVV +RKDI  +FP +D        VN LV+L
Sbjct  374  RGEYTVSSWLRMRFGEVVYPWGKPMHSGPVVSYRKDICWIFPGVDR-------VNALVSL  426

Query  149  PPKEMEKFKSLFHKFL  102
            P KEME+F +   +F 
Sbjct  427  PAKEMERFVACCREFF  442



>gb|AAT72495.1| AT1G65450 [Arabidopsis lyrata subsp. petraea]
Length=185

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  47   KLKERASETSNGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  106

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  107  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVSEGANRITDEYARSAIDWGELYK  166

Query  338  GFPHGEFLVSSWWRLGF  288
            GFPHGE LVSSWW+LGF
Sbjct  167  GFPHGEVLVSSWWKLGF  183



>gb|EYU34269.1| hypothetical protein MIMGU_mgv1a006390mg [Erythranthe guttata]
Length=445

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 129/197 (65%), Gaps = 11/197 (6%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       +  +++ F V+ A IWRCKA S     ++ +R+ST+L  +DIR R+NP 
Sbjct  258  HLKDNITKTSKIH-RISTFAVVAALIWRCKAFS-----DDKNRVSTLLNVIDIRPRVNPQ  311

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E++ G F K V+++ EGA  MT EY +SA DW EL +G P
Sbjct  312  LPSSYSANAVLPLGVSETCEEIQNGAFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIP  371

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            HG+++VSSW RLGF+ V++ WGKP YSCPVV HRKDI  +F D  +G     GV+ +VAL
Sbjct  372  HGDYMVSSWLRLGFDEVEYAWGKPMYSCPVVNHRKDICWVFRDAVDG-----GVSAMVAL  426

Query  149  PPKEMEKFKSLFHKFLA  99
            P +EM  F+++FH F A
Sbjct  427  PSQEMNIFEAVFHDFFA  443



>gb|EYU17601.1| hypothetical protein MIMGU_mgv1a006316mg [Erythranthe guttata]
Length=448

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 7/197 (4%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            ++KD       +  K++ F V+ A IWRCKA S    E N DR+ST+L  +DIR R+NP 
Sbjct  257  QIKDNISKSSKI-AKISTFAVVAALIWRCKAFSG-NIEYNKDRVSTLLNVIDIRPRVNPQ  314

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E++ GPF K V+++ EGA  +T EY +SA D  EL +G P
Sbjct  315  LPSSYSANAVLPLGVSETCEEIKNGPFSKLVEIITEGAKEITHEYVKSAFDLLELNRGIP  374

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            HG+++VSSW RLGF+ V++ WGKP YSCPVV HRKDI  +F D  +G     GV  +VAL
Sbjct  375  HGDYMVSSWLRLGFDEVEYAWGKPMYSCPVVNHRKDICWVFRDAVDG-----GVGAMVAL  429

Query  149  PPKEMEKFKSLFHKFLA  99
            P  EM+ F++ FH F A
Sbjct  430  PAHEMDIFEAAFHDFFA  446



>ref|XP_011078800.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=452

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 125/189 (66%), Gaps = 9/189 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            +A A +    K+T FNV+ A IWRC+ALS    E N DR+ T+ +AVD+R RLNPPLP  
Sbjct  266  QAAADNATAVKITSFNVMAALIWRCRALSLCDVEGNKDRVFTMCYAVDLRSRLNPPLPPE  325

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGEF  318
            Y GNA+L  Y SAKC ++E+ P  K V+M+ EG  R++DEY +SAIDW E+ KG P+G+ 
Sbjct  326  YCGNAILPAYASAKCRDIEKWPLLKLVEMISEGIERLSDEYVKSAIDWLEINKGIPYGDC  385

Query  317  LVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKE  138
            +++SW RLG   V FPWGK  Y C VV + + +  +FP +D       GVN+L+  P +E
Sbjct  386  VLTSWLRLGLNEVVFPWGKSLYCCHVVNNLERLCWMFPYVD-------GVNILIQRPAEE  438

Query  137  MEKFKSLFH  111
            ME+F+  FH
Sbjct  439  MERFQ--FH  445



>gb|EYU17599.1| hypothetical protein MIMGU_mgv1a006131mg [Erythranthe guttata]
Length=450

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 132/197 (67%), Gaps = 12/197 (6%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LKD       +  K++ F V+ A IWRCKA S     ++ +++ST+L A+DIR  +NPPL
Sbjct  259  LKDNITKTSKID-KISTFAVVAALIWRCKAFS-----DDKNKVSTLLNAIDIRPIVNPPL  312

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SYS NAVL    S  C E++ GPF K V+++ EGA  MT EY +SA DW EL +G PH
Sbjct  313  PYSYSANAVLPLGVSETCEEIKNGPFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIPH  372

Query  326  GE-FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            G+ F VSSW RLGF+ V++ WGKP YSCPVV HRKDI  +F D  +G     GV+ +VAL
Sbjct  373  GDYFKVSSWLRLGFDEVEYAWGKPIYSCPVVNHRKDICWVFRDAVDG-----GVSAMVAL  427

Query  149  PPKEMEKFKSLFHKFLA  99
            P +EM+ F+++FH F+A
Sbjct  428  PSQEMDIFEAVFHDFIA  444



>gb|EYU17598.1| hypothetical protein MIMGU_mgv1a006131mg [Erythranthe guttata]
Length=456

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 132/197 (67%), Gaps = 12/197 (6%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LKD       +  K++ F V+ A IWRCKA S     ++ +++ST+L A+DIR  +NPPL
Sbjct  265  LKDNITKTSKID-KISTFAVVAALIWRCKAFS-----DDKNKVSTLLNAIDIRPIVNPPL  318

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P SYS NAVL    S  C E++ GPF K V+++ EGA  MT EY +SA DW EL +G PH
Sbjct  319  PYSYSANAVLPLGVSETCEEIKNGPFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIPH  378

Query  326  GE-FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            G+ F VSSW RLGF+ V++ WGKP YSCPVV HRKDI  +F D  +G     GV+ +VAL
Sbjct  379  GDYFKVSSWLRLGFDEVEYAWGKPIYSCPVVNHRKDICWVFRDAVDG-----GVSAMVAL  433

Query  149  PPKEMEKFKSLFHKFLA  99
            P +EM+ F+++FH F+A
Sbjct  434  PSQEMDIFEAVFHDFIA  450



>gb|EYU17596.1| hypothetical protein MIMGU_mgv1a021071mg [Erythranthe guttata]
Length=383

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 128/198 (65%), Gaps = 13/198 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       +  +++   V+ A IWRCKA       ++ +R+ST+L  +DIR R+NPP
Sbjct  193  HLKDNITKTSKID-RISTLAVVAALIWRCKAFF-----DDKNRVSTLLSVIDIRPRVNPP  246

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E++ GPF K V+++ EGA  MT E  +SA DW EL +G P
Sbjct  247  LPYSYSANAVLPLGVSETCEEIKNGPFSKLVEIITEGAKEMTHESVKSAFDWLELNRGIP  306

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVA  153
            HG+++VSSW RLGF+ V++ WGKP YSCPVV HRKDI  +F D +DN      GV  +VA
Sbjct  307  HGDYMVSSWLRLGFDEVEYAWGKPMYSCPVVNHRKDICWVFRDAVDN------GVCAMVA  360

Query  152  LPPKEMEKFKSLFHKFLA  99
            LP +EM+ F+ +FH F A
Sbjct  361  LPSQEMDIFEGVFHDFFA  378



>ref|XP_006858657.1| hypothetical protein AMTR_s00066p00063330 [Amborella trichopoda]
 gb|ERN20124.1| hypothetical protein AMTR_s00066p00063330 [Amborella trichopoda]
Length=493

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 120/192 (63%), Gaps = 18/192 (9%)
 Frame = -2

Query  641  TGFNVLTAAIWRCKALSCLGGEN-----------NSDRLSTVLFAVDIRRRLNPPLPDSY  495
            T F V+TA +WRC+A++    +            + D LS VLFAVDIR+R+ PPLP  Y
Sbjct  291  TSFEVVTAHLWRCRAIATSLSKTPDDLDISSDGVDLDSLSMVLFAVDIRKRVKPPLPTGY  350

Query  494  SGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGE  321
             GNAVL GYG A+  EL E     +V  V EG  RM DEY RS IDWGE++KG P   G 
Sbjct  351  CGNAVLAGYGRARVRELRERGLGFSVSKVREGVERMDDEYVRSVIDWGEIHKGVPGGKGS  410

Query  320  FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDI---DNGGKSNSGVNVLVAL  150
            F VSSWW+LGFE  ++PWGK  YS P V+ R D +LL PD     NGGK   GVN+ +AL
Sbjct  411  FFVSSWWKLGFEEAEYPWGKALYSGPSVHRRDDAVLLLPDTVSRRNGGK--EGVNIFMAL  468

Query  149  PPKEMEKFKSLF  114
            PP +M+KF+ L 
Sbjct  469  PPFQMDKFQELL  480



>gb|ACN57286.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57287.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57288.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57289.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57290.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57291.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57292.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57293.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57294.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57295.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57296.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57297.1| At1g65450-like protein, partial [Capsella rubella]
 gb|ACN57298.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEGEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMT+EYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCKALLEEPFGEIVDMVGEGAKRMTNEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57299.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCXALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57300.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCKALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57301.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y   KC  L E PF + V MV EGA RMT+EYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKXKCKALLEEPFGEIVDMVGEGAKRMTBEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57307.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEXEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L   PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCKALLXEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57306.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGEN---NSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTXEEXEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCXALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|EYU17594.1| hypothetical protein MIMGU_mgv1a006220mg [Erythranthe guttata]
Length=452

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 132/202 (65%), Gaps = 17/202 (8%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       +  +++ F V+ A IWRCKA S     ++ +++ST+L A+DIR  +NPP
Sbjct  258  HLKDNITKTSKID-RISTFAVVAALIWRCKAFS-----DDKNKVSTMLNAIDIRPIVNPP  311

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E+++GPF K V+++ +GA  MT EY +SA DW EL +G P
Sbjct  312  LPYSYSANAVLPLGVSETCEEIKKGPFSKFVEIITKGAKEMTHEYMKSAFDWLELNRGIP  371

Query  329  HGEFL-VSS---WWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVN  165
             G++  VSS   W RLGF+ V++ WGKP YSCPVV HRK+I  +F D +DN      GV 
Sbjct  372  QGDYYKVSSDIKWLRLGFDEVEYAWGKPIYSCPVVNHRKNICWVFRDAVDN------GVC  425

Query  164  VLVALPPKEMEKFKSLFHKFLA  99
             +VALP +EM+ F+++FH F+A
Sbjct  426  AMVALPSQEMDIFEAVFHDFIA  447



>gb|ACN57305.1| At1g65450-like protein, partial [Capsella grandiflora]
 gb|ACN57308.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL---STVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E     L   ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDVRVTGFNVVTALVWRCKALSVTTEEEEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCKALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57304.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL---STVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E     L   ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDXRVTGFNVVTALVWRCKALSVTTEEEEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCKALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ACN57302.1| At1g65450-like protein, partial [Capsella grandiflora]
 gb|ACN57303.1| At1g65450-like protein, partial [Capsella grandiflora]
Length=169

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL---STVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E     L   ST+L+AVDIR RL
Sbjct  38   KLKERASETSSGDDRVTGFNVVTALVWRCKALSVTTEEEEEANLERESTILYAVDIRGRL  97

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V MV EGA RMTDEYARSAIDWGELYK
Sbjct  98   NPELPSSYTGNAVLTAYAKAKCKALLEEPFGEIVDMVGEGAKRMTDEYARSAIDWGELYK  157

Query  338  GFPHGEFLVSSW  303
            GFPHGE LVSSW
Sbjct  158  GFPHGEVLVSSW  169



>gb|ADL37203.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37218.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37226.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37227.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37228.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37240.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37242.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37245.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37252.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37256.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37259.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37261.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37262.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37263.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37264.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37265.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37266.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37267.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37268.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37269.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37270.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37271.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37272.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37274.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37275.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37276.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37280.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37285.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37286.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37298.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37302.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37304.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37305.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37306.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37308.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37309.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37310.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37319.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37320.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37323.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37324.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37325.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37326.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37327.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37328.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37329.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37330.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37331.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37335.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37338.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37339.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37340.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37341.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37344.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37345.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37348.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37349.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37350.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37352.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37353.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37357.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37361.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37362.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37365.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37367.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37372.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37375.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSNGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37205.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37206.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNHERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37207.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSNGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GN VLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNVVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37212.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37219.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37222.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37223.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37224.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37225.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37229.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37230.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37231.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37232.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37233.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37234.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37235.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37236.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37237.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37238.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37241.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37246.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37247.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37248.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37249.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37250.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37251.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37253.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37254.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37255.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37257.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37258.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37260.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37273.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37281.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37282.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37283.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37287.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37288.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37289.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37290.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37291.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37292.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37293.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37294.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37297.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37299.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37311.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37312.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37313.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37314.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37315.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37316.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37317.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37318.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37321.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37322.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37337.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37342.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37343.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37347.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37354.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37355.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37356.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37360.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37363.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37366.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37368.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37371.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37373.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37208.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSNGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GN VLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNXVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37221.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVD R RL
Sbjct  44   KLKERASETSNGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDXRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ACB41562.1| At1g65450-like protein, partial [Arabidopsis arenosa]
Length=151

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  27   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  86

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  87   NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  146

Query  338  GFPHG  324
            GFPHG
Sbjct  147  GFPHG  151



>gb|ACB41560.1| At1g65450-like protein, partial [Arabidopsis arenosa]
Length=151

 Score =   161 bits (407),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSC---LGGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  27   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEXGEETNLERESTILYAVDIRGRL  86

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  87   NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  146

Query  338  GFPHG  324
            GFPHG
Sbjct  147  GFPHG  151



>gb|ADL37204.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37216.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37239.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37243.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37244.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37277.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37278.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37279.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37284.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37295.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37296.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37300.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37301.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37303.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37332.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37333.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37334.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37346.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37351.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37358.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37359.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37364.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37369.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37370.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37374.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A        +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSXGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|EYU17590.1| hypothetical protein MIMGU_mgv1a026424mg [Erythranthe guttata]
Length=265

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 26/197 (13%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       +  +++ F V+ A IWRCKA S     ++ +R+ST+L  +DIR R+NP 
Sbjct  93   HLKDNITKTSKIH-RISTFAVVAALIWRCKAFS-----DDKNRVSTLLNVIDIRPRVNPQ  146

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E++ G F K V+++ EGA  MT EY +SA DW EL +G P
Sbjct  147  LPSSYSANAVLPLGVSETCEEIQNGAFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIP  206

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
            HG+++VSSW RLGF+ V++ WGKP YS  V                    + GV+ +VAL
Sbjct  207  HGDYMVSSWLRLGFDEVEYAWGKPMYSYAV--------------------DGGVSAMVAL  246

Query  149  PPKEMEKFKSLFHKFLA  99
            P +EM  F+++FH F A
Sbjct  247  PSQEMNIFEAVFHDFFA  263



>gb|ACB41561.1| At1g65450-like protein, partial [Arabidopsis arenosa]
 gb|ACB41563.1| At1g65450-like protein, partial [Arabidopsis arenosa]
Length=151

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  27   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  86

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V +GA R+TDEYARSAIDWGELYK
Sbjct  87   NPELPSSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGDGANRITDEYARSAIDWGELYK  146

Query  338  GFPHG  324
            GFPHG
Sbjct  147  GFPHG  151



>gb|ADL37211.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GN VLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNVVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ACB41559.1| At1g65450-like protein, partial [Arabidopsis arenosa]
Length=151

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A        +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  27   KLKERASETSXGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  86

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  87   NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  146

Query  338  GFPHG  324
            GFPHG
Sbjct  147  GFPHG  151



>gb|ADL37213.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GN VLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNXVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37209.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37210.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37214.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCL---GGENNSDRLSTVLFAVDIRRRL  519
            +LK++A        +VTGFNV+TA +WRCKALS     G E N +R ST+L+AVDIR RL
Sbjct  44   KLKERASETSXGYVRVTGFNVVTALVWRCKALSVAAEEGEETNLERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GN VLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNVVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ADL37307.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE---NNSDRLSTVLFAVDIRRRL  519
            +LK++A    +   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR R 
Sbjct  44   KLKERASETSSGYVRVTGFNVVTALVWRCKALSVAAEEGEXTNLERESTILYAVDIRGRX  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ACB41564.1| At1g65450-like protein, partial [Arabidopsis suecica]
 gb|ACB41565.1| At1g65450-like protein, partial [Arabidopsis suecica]
 gb|ACB41566.1| At1g65450-like protein, partial [Arabidopsis suecica]
 gb|ACB41567.1| At1g65450-like protein, partial [Arabidopsis suecica]
 gb|ACB41568.1| At1g65450-like protein, partial [Arabidopsis suecica]
Length=151

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE---NNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  27   KLKERASETSNGXVRVTGFNVVTALVWRCKALSVXAEEXEETNLERESTILYAVDIRGRL  86

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y   KC  L E PF + V+ V  G  R+TDEYARSAIDWGELYK
Sbjct  87   NPELPPSYTGNAVLTAYAKXKCKALLEEPFGRIVEXVGXGXXRITDEYARSAIDWGELYK  146

Query  338  GFPHG  324
            GFPHG
Sbjct  147  GFPHG  151



>gb|ADL37215.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37217.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37220.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ADL37336.1| At1g65450-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 3/126 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRL---STVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS    E         ST+L+AVDIR RL
Sbjct  44   KLKERASETSNGYVRVTGFNVVTALVWRCKALSVAAEEGEEXNXERESTILYAVDIRGRL  103

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT Y  AKC  L E PF + V++V EGA R+TDEYARSAIDWGELYK
Sbjct  104  NPELPPSYTGNAVLTAYAKAKCKALLEEPFGRIVEIVGEGANRITDEYARSAIDWGELYK  163

Query  338  GFPHGE  321
            GFPHGE
Sbjct  164  GFPHGE  169



>gb|ACB41569.1| At1g65450-like protein, partial [Arabidopsis suecica]
 gb|ACB41570.1| At1g65450-like protein, partial [Arabidopsis suecica]
Length=151

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGE---NNSDRLSTVLFAVDIRRRL  519
            +LK++A    N   +VTGFNV+TA +WRCKALS    E    N +R ST+L+AVDIR RL
Sbjct  27   KLKERASETSNGXVRVTGFNVVTALVWRCKALSVXAEEXEETNLERESTILYAVDIRGRL  86

Query  518  NPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYK  339
            NP LP SY+GNAVLT     KC  L E PF + V+ V  G  R+TDEYARSAIDWGELYK
Sbjct  87   NPELPPSYTGNAVLTAXAKXKCKALLEEPFGRIVEXVGXGXXRITDEYARSAIDWGELYK  146

Query  338  GFPHG  324
            GFPHG
Sbjct  147  GFPHG  151



>ref|XP_007035554.1| BAHD family acyltransferase, clade V, putative [Theobroma cacao]
 gb|EOY06480.1| BAHD family acyltransferase, clade V, putative [Theobroma cacao]
Length=451

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 117/185 (63%), Gaps = 9/185 (5%)
 Frame = -2

Query  650  TKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTG  471
            T+ + F  + A IWR ++ +      N D LSTVLFAVDIR +++PPLP+ ++GNA++T 
Sbjct  271  TRCSSFEAIVAHIWRARSKAIF---TNLDDLSTVLFAVDIRSKISPPLPNGFAGNAIITA  327

Query  470  YGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP---HGEFLVSSWW  300
            +  AK  +L E PF   V+ + EG  R+TDEYARS IDW E+++GFP   +G F VS+WW
Sbjct  328  FADAKVVDLIEKPFSFCVEKIKEGRERITDEYARSVIDWLEVHRGFPATCNGTFYVSAWW  387

Query  299  RLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKS  120
            +LGF  + F +GKP +  PVV    + +LL  D    G S  G+NV + L P++M++   
Sbjct  388  KLGFNELDFGYGKPAHGGPVVSGNDEFVLLLSD-AKCGDSGGGINVWLGLEPEKMKRL--  444

Query  119  LFHKF  105
            + H F
Sbjct  445  ILHIF  449



>gb|EYU24129.1| hypothetical protein MIMGU_mgv1a020263mg [Erythranthe guttata]
Length=447

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 122/199 (61%), Gaps = 14/199 (7%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALS--CLGGENNSDRLSTVLFAVDIRRRLNP  513
            LKDKA      + K+T +NV+ A IWRCKALS  C+  E    R+ST+L ++DIR+RLNP
Sbjct  257  LKDKANNGTRTEGKITTYNVVAALIWRCKALSSNCMDRE----RVSTLLTSIDIRQRLNP  312

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG-  336
            PLP SY GNAVL    SA+C  LE  PF + V++V +G     DEYARS ID   + +G 
Sbjct  313  PLPASYCGNAVLFAPASAECKHLENWPFLELVKVVSDGIKGFNDEYARSMIDLLGINRGK  372

Query  335  -FPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
              P+ E+ VSSW +LGF+ V +PWGKP    P +    +   LFP + +G      VN L
Sbjct  373  VQPYIEYNVSSWMKLGFDEVVYPWGKPICFGP-LRTVTETCFLFPGVVDG-----DVNAL  426

Query  158  VALPPKEMEKFKSLFHKFL  102
            V+LP  EME+F++ F  F 
Sbjct  427  VSLPTVEMERFQAYFLDFF  445



>ref|XP_010930413.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=452

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 116/190 (61%), Gaps = 13/190 (7%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KA       TK + F  + A IWR +  +     +N D +S+VLFAVDIR R++PPL
Sbjct  266  LKEKAM------TKCSSFEAIVAHIWRARTKAIF---DNLDEISSVLFAVDIRSRMSPPL  316

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP-  330
            P  +SGNAV+T   SAK A+L E PF   V+MV E   R+TDEY RS IDW E+YKG P 
Sbjct  317  PQGFSGNAVITASASAKVADLGEKPFSFCVEMVKEAIERVTDEYVRSGIDWLEVYKGMPS  376

Query  329  --HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
              +G F +S+WW+L F  + F +GKP Y  PV     + +LL    ++ GK   GVNV +
Sbjct  377  TLNGNFFLSAWWKLPFYELDFGYGKPLYGGPVAGGMGEFVLLLSSGNDMGK-RGGVNVWI  435

Query  155  ALPPKEMEKF  126
            AL   +ME+F
Sbjct  436  ALEKDKMERF  445



>gb|EYU34268.1| hypothetical protein MIMGU_mgv1a005307mg [Erythranthe guttata]
Length=489

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 6/152 (4%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       ++ +++   V+ A IWRCKA S     ++ +R+ST+L  +DIR R+ PP
Sbjct  258  HLKDDITKNSKIE-RISTLAVVAALIWRCKAFS-----DDKNRVSTLLNVIDIRPRVKPP  311

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL       C E++ GPF K V+++ EGA  MT EY +SA DW EL +G P
Sbjct  312  LPYSYSANAVLPLGVLETCDEIKNGPFSKLVEIITEGAKEMTHEYVKSAFDWLELNRGIP  371

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVY  234
            HG+++VSSW RLGF+ V++ WGKP YSCPV++
Sbjct  372  HGDYMVSSWLRLGFDEVEYAWGKPMYSCPVLH  403



>gb|ABK24776.1| unknown [Picea sitchensis]
Length=463

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 111/195 (57%), Gaps = 6/195 (3%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            RLK+KA   D    K T F V+TA +WR ++ +    E  S+  STVLF V+ R RL PP
Sbjct  270  RLKEKAME-DGKIMKCTSFEVVTAHLWRARSQAL---EMQSNETSTVLFPVECRSRLEPP  325

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +   Y+GNAV+ GY  A   EL + PF   VQ V +G +R+ ++Y RS IDW E++KG P
Sbjct  326  ISREYAGNAVVPGYARATVKELRDEPFSVLVQKVQQGLSRLGNDYVRSMIDWLEVHKGIP  385

Query  329  HG--EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                 F V +WWRLG E  ++PWG P +  P + H  ++++L  +    G    G NV +
Sbjct  386  CAVNSFSVVAWWRLGLEDAEYPWGNPLHLSPAISHCAELVMLLHNPSQQGGGGGGFNVAI  445

Query  155  ALPPKEMEKFKSLFH  111
            AL P +  +F  LF 
Sbjct  446  ALQPHQFPRFHQLFQ  460



>ref|XP_008786402.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=452

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 116/197 (59%), Gaps = 15/197 (8%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK+KA       TK + F  + A IWR +  +     ++ D +S+VLFA DIR R++PPL
Sbjct  266  LKEKAA------TKCSSFEAIVAHIWRARTKAVF---DDPDGISSVLFAADIRSRVSPPL  316

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP-  330
            P  + GNAV+T   SAK A L E PF   V MV E   R+TDEY RS IDW E+Y+G P 
Sbjct  317  PHGFGGNAVITASASAKVAVLGEKPFSFCVGMVKEAIERVTDEYVRSVIDWLEVYRGVPS  376

Query  329  --HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
              +G F +S+WW+L F  + F +GKP Y  PVV    + +LL    ++ G+   GVNV +
Sbjct  377  TVNGNFFLSAWWKLPFHELDFGYGKPLYGGPVVGGMGEFVLLLSSGNDMGR-RGGVNVWI  435

Query  155  ALPPKEMEKFKSLFHKF  105
            AL   +ME+F  L H F
Sbjct  436  ALEKDKMERF--LCHVF  450



>gb|EYU34266.1| hypothetical protein MIMGU_mgv1a023386mg, partial [Erythranthe 
guttata]
Length=403

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 110/191 (58%), Gaps = 23/191 (12%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LKD       +  +++ F V+ A IWRCKA S      NS+                PP
Sbjct  235  HLKDNITKTSKID-RISTFAVVAALIWRCKAFSDDKNRANSE----------------PP  277

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP SYS NAVL    S  C E+  G F K V+++ EGA  MT +YA+SA DW EL +G P
Sbjct  278  LPYSYSANAVLPLGVSETCEEIINGLFSKLVEIITEGAKEMTHDYAKSAFDWLELNRGIP  337

Query  329  HGE-FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
            HG+ F VSSW RLGF+ V++ WGKP YSCPVV HRK I  +F D  +G     GV  +VA
Sbjct  338  HGDYFKVSSWLRLGFDEVEYAWGKPIYSCPVVNHRKAISWVFRDAVDG-----GVCAMVA  392

Query  152  LPPKEMEKFKS  120
            LP +EM+ F++
Sbjct  393  LPAQEMDIFEA  403



>ref|XP_011071659.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Sesamum indicum]
Length=463

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 109/181 (60%), Gaps = 8/181 (4%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGE--NNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  474
            + + F  + A IWR +  + LG +   + D+ STVLFAVDIR  ++PPLP S+ GNAV+T
Sbjct  277  ECSTFEAILAHIWRARTRAILGHDCDQHQDQDSTVLFAVDIRDTISPPLPSSFIGNAVIT  336

Query  473  GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHG---EFLVSSW  303
            GY   K  +L  GP    V+MV EG  R+T EY RS IDW E+YKG P      F VS+W
Sbjct  337  GYARTKARDLVGGPLSYGVEMVREGRERVTSEYIRSVIDWLEVYKGTPATCGCAFYVSAW  396

Query  302  WRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFP--DIDNGGKSNSGVNVLVALPPKEMEK  129
            W+LGF  V   +G+ K++ P+V    + +LL    D D GGK   G+NV + L   +ME+
Sbjct  397  WKLGFGEVDLGFGRAKHAGPIVSGNDEFVLLLDGGDCDEGGK-GLGINVWIGLEKDKMER  455

Query  128  F  126
            F
Sbjct  456  F  456



>ref|XP_009415665.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=451

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -2

Query  662  DNVKTKVTG----FNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSY  495
            D +K + T     F  + A +WR +  +     ++    S+VLFAVD+R ++ P +PD +
Sbjct  268  DGLKERATAGCSSFQAVVAHLWRARTRAVF---DDPSETSSVLFAVDVRSKMTPRVPDGF  324

Query  494  SGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP---HG  324
             GNAV+    SA+ AEL E P    V+ V E   R+TDEY RSA+DW E  KG P   HG
Sbjct  325  VGNAVVMAMASARVAELTEQPLGFAVKRVREAIERVTDEYIRSAVDWLEANKGMPAIGHG  384

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F+VS+WW+L F  + F WGKP Y+ PVV    + +LL  D    GK   G+N+ +AL  
Sbjct  385  NFIVSAWWKLPFHELDFGWGKPIYAGPVVSVMHECVLLLSD----GK--GGINIWLALEE  438

Query  143  KEMEKFKSLFHKF  105
            ++M+ F S  ++ 
Sbjct  439  EKMKSFLSYVYEL  451



>gb|EYU24114.1| hypothetical protein MIMGU_mgv1a018501mg [Erythranthe guttata]
Length=143

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 94/149 (63%), Gaps = 8/149 (5%)
 Frame = -2

Query  539  VDIRRRLNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAI  360
            +DIR RL PPLPDSY GNAVL    SAK  ++E+ PF K V++V+EG  R +DEYARS I
Sbjct  1    MDIRSRLIPPLPDSYCGNAVLYAEASAKGGDIEKLPFSKLVELVWEGPRRFSDEYARSVI  60

Query  359  DWGEL--YKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGG  186
            D  E+  +K  P  E+ V+SW +LG + V +PWGKP    P+         LFP ++   
Sbjct  61   DLLEIEKWKLRPRIEYNVTSWLKLGLDQVVYPWGKPFCVGPICTVLAHACFLFPSVEG--  118

Query  185  KSNSGVNVLVALPPKEMEKFKSLFHKFLA  99
                GVN LV+LP +EM++F++ FH+F  
Sbjct  119  ----GVNALVSLPSEEMQRFQAYFHQFFT  143



>ref|XP_002992378.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06528.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=450

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            K + F V+ A +W+ +  +    E + D  S + FAVDIR +++PPLP  ++GN VL   
Sbjct  275  KCSSFEVIVAHLWQARTRAV---EMDPDSPSKLFFAVDIRNKVDPPLPKGFAGNGVL---  328

Query  467  GSAKCA-----ELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVS  309
             SA C      ++ E      V+ V E  A +TDEY RS+ID GELY+G P  HG   +S
Sbjct  329  -SAPCVKTLARDVRENSLGYCVRKVQEAIASVTDEYVRSSIDHGELYRGVPALHGGIFIS  387

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
             WW++ F+ + F WG+P Y+ PVV  R + +LL     + GK + G+N  +AL P EM+K
Sbjct  388  PWWKIPFQELDFGWGRPLYAGPVVNDRVEFVLLL----HNGKQDGGLNAYLALEPAEMDK  443

Query  128  FKSLFH  111
            F+ L  
Sbjct  444  FEKLLQ  449



>ref|XP_002967754.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ31101.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=450

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            K + F V+ A +W+ +  +    E + D  S + FAVDIR +++PPLP  ++GN VL   
Sbjct  275  KCSSFEVIVAHLWQARTRAV---EMDPDSPSKLFFAVDIRNKVDPPLPKGFAGNGVL---  328

Query  467  GSAKCA-----ELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVS  309
             SA C      ++ E      V+ V E  A +TDEY RS+ID GELY+G P  HG   +S
Sbjct  329  -SAPCVKTLARDVRENSLGYCVRKVQEAIAAVTDEYVRSSIDHGELYRGVPALHGGIFIS  387

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
             WW++ F+ + F WG+P Y+ PVV  R + +LL     + GK + G+N  +AL P EM+K
Sbjct  388  PWWKIPFQELDFGWGRPLYAGPVVNDRVEFVLLL----HNGKQDGGLNAYLALEPAEMDK  443

Query  128  FKSLFH  111
            F+ L  
Sbjct  444  FEKLLQ  449



>ref|XP_010666009.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 109/192 (57%), Gaps = 7/192 (4%)
 Frame = -2

Query  683  KDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  504
            K  ++   N     + F  + A IW+ +        N+ +  STVLFAVDIR +++P LP
Sbjct  258  KSISRLKANAIVNCSTFEAIVAHIWKERTKVIF---NDPNDFSTVLFAVDIRSKISPTLP  314

Query  503  DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--  330
            D + GNA++T + +++  +L   P    V+++  G  R+T+EY RS IDW ELYKG P  
Sbjct  315  DEFVGNAIITAFATSRVIDLVSNPISFGVKLIKGGKERVTEEYVRSVIDWLELYKGIPAT  374

Query  329  -HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSN-SGVNVLV  156
             +G F VS+WW+L F  + F +G P +  P+V    + +LL  + +N       GVN  +
Sbjct  375  SNGNFYVSAWWKLPFGDLDFGYGMPTHVSPIVSGNDEFVLLLSEGNNCQHGEGGGVNAWI  434

Query  155  ALPPKEMEKFKS  120
            +L P++M +F++
Sbjct  435  SLEPEKMNQFET  446



>ref|XP_010259678.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=447

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = -2

Query  650  TKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTG  471
             K + F  + A +WR ++ +     ++ D  ST+LFAVDIR +++PPLP  ++GNAV+T 
Sbjct  269  VKCSNFEAIVAHLWRARSKAVF---DDPDETSTILFAVDIRSKISPPLPHGFTGNAVVTA  325

Query  470  YGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP---HGEFLVSSWW  300
            + +AK  +L E P    V++V     R++D+Y RS IDW E++KG P   +G F +S+WW
Sbjct  326  FANAKVVDLAEKPLSFCVELVKGAMDRVSDDYVRSVIDWLEIHKGVPATINGNFYLSAWW  385

Query  299  RLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPD-IDNGGKSNSGVNVLVALPPKEMEKF  126
            +L F  + F  GK  +  P+V    + +LL  D + NGG    G+NV + L  ++M++F
Sbjct  386  KLPFHDLNFGCGKLIHCGPIVSGTDEFVLLLSDFMGNGG----GINVWMGLEKEKMQRF  440



>gb|EYU45561.1| hypothetical protein MIMGU_mgv1a005829mg [Erythranthe guttata]
Length=468

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 107/187 (57%), Gaps = 12/187 (6%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            K + F+ + A IW+ +  +      + D+ S VLFAVDIR +++PPL +S++GNAV+TG+
Sbjct  278  KCSTFDAILAHIWKARTKANFN-HKDQDQESRVLFAVDIRDKISPPLLNSFTGNAVVTGF  336

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH---GEFLVSSWWR  297
             +AK  +L E P    V MV EG  R+T EY RS IDW E+YKG P    G F  S+WW+
Sbjct  337  ATAKARDLIEKPLSFGVGMVKEGVERVTSEYVRSVIDWLEVYKGIPATSGGGFYASAWWK  396

Query  296  LGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGK--------SNSGVNVLVALPPK  141
            L F  V F +GKP++  PVV    + +L   D D               G+NV + L  +
Sbjct  397  LPFGEVDFGFGKPRHVGPVVSGNDEFVLFLSDYDYDYDYDYDKSCCEGKGINVWMGLEKE  456

Query  140  EMEKFKS  120
            +M+KF S
Sbjct  457  KMDKFLS  463



>ref|XP_004491723.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=437

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 113/187 (60%), Gaps = 11/187 (6%)
 Frame = -2

Query  677  KAKAPDNVKTK-VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPD  501
            K KA +N   K +T F V+ A IW+ +AL+    + + +++ST+LF VD+R+R+ P LP+
Sbjct  252  KKKALENTALKNITTFQVVAAKIWKARALA---TKMSHEKVSTMLFPVDVRKRVVPELPN  308

Query  500  SYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  321
            S++GNA++ G+  A   EL E      ++ V EG  R+ DEY +S IDW EL +G P  E
Sbjct  309  SFAGNALVPGFARATVKELMELEDDFHIRKVQEGIERLDDEYIKSGIDWLELNRGVPCKE  368

Query  320  --FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
              F + +WWRLG E   F WG+ K + P++  +  +++L P    G     G+N+ ++LP
Sbjct  369  DSFSLVAWWRLGLENEVFAWGRLKCATPLIV-KPGLVMLLP----GANDEGGLNICLSLP  423

Query  146  PKEMEKF  126
              ++++F
Sbjct  424  QDQLQEF  430



>gb|KDP26368.1| hypothetical protein JCGZ_17526 [Jatropha curcas]
Length=451

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 106/190 (56%), Gaps = 10/190 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D      T F V+ A IW+ + ++    E  +   +T+LF V++RR ++PP P  
Sbjct  268  KAVLQDGNLENCTTFQVVAAKIWKARTIAVKMKEETN---TTMLFPVNVRRIISPPAPSG  324

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-  321
            ++GNA++ G+   K  E++E      V+ V EG  R+ DEY RS+IDW E+YKG P  E 
Sbjct  325  FAGNALIPGFARVKVKEVKEREVSYLVKKVQEGVKRLDDEYVRSSIDWLEVYKGVPCREN  384

Query  320  -FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F + +W+RLG EG  F WGK K + PVV  +  ++ L P    G     G++V + LP 
Sbjct  385  SFSLVAWFRLGLEGEVFSWGKIKCTAPVVV-KPGLVFLLP----GTLEEGGIHVCLELPD  439

Query  143  KEMEKFKSLF  114
            +EM +F  L 
Sbjct  440  EEMNEFCRLL  449



>gb|EYU20679.1| hypothetical protein MIMGU_mgv1a006412mg [Erythranthe guttata]
Length=445

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 116/202 (57%), Gaps = 13/202 (6%)
 Frame = -2

Query  686  LKDKAKAPDNVKT-KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            LK KA A DN+++ K++ FNV+ A +WRC+ALS     +N D  ST++  +D+R R+ PP
Sbjct  247  LKAKAAA-DNIESGKISTFNVVAALLWRCRALSSPCINDNKD--STIVTVLDVRSRVKPP  303

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSA----IDWGELY  342
            LP  Y GNAV   Y SAKC ++E+  F K V+MV EG  R  +EY   +    IDW E+ 
Sbjct  304  LPPEYCGNAVGVAYASAKCEDIEKWAFSKLVEMVGEGINRANEEYGVESGGVTIDWWEIK  363

Query  341  KGFPHGE-FLVSSWWRLGFEGVQFPWGKPKYSCPVVYH-RKDIILLFPDIDNGGKSNSGV  168
            +    GE  L++ W  LGF+ V FPWGK  +  P+V   +   ++L  + D+ G    GV
Sbjct  364  RKVLCGEDVLLTPWSGLGFDRVVFPWGKSVHFGPLVDPLQMCFVILNGEADDDG---VGV  420

Query  167  NVLVALPPKEMEKFKSLFHKFL  102
            NVL   P + M++     H F 
Sbjct  421  NVLCVQPAQLMDRILFHLHHFF  442



>ref|XP_010248037.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010248038.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Nelumbo nucifera]
Length=443

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 112/194 (58%), Gaps = 12/194 (6%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D      + F  + A IW+ ++L+ +G ++  +R+STVLF VD+RRR+ PP P+ 
Sbjct  257  KAALKDGQLMSCSSFQAVAAKIWKARSLA-MGLQD--ERISTVLFPVDVRRRIAPPAPNG  313

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  324
            + GNA++ G+  A+  EL++      V  V EG  R+ DEY RS  DW E+++G P    
Sbjct  314  FVGNALVPGFARARVEELKKAEDSFLVGKVKEGLERLDDEYIRSGNDWLEVHRGIPCCVD  373

Query  323  EFLVSSWWRLGFEG--VQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
             F V SWWRLG EG  ++F WG  K   P++  +  +++L PD     K + G+N+ + L
Sbjct  374  SFSVVSWWRLGLEGEELEFKWGAVKCVTPIMV-KPGLVILLPD----SKDDGGINICLEL  428

Query  149  PPKEMEKFKSLFHK  108
            P  ++++F  L  +
Sbjct  429  PSDQIKEFHKLMME  442



>gb|KDO64448.1| hypothetical protein CISIN_1g013997mg [Citrus sinensis]
Length=432

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 99/188 (53%), Gaps = 13/188 (7%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  489
            D V  K T F  L+A +WR  C+AL         D+ + +LFAVD R R  PPLP+ + G
Sbjct  253  DKVLNKCTTFEALSAFVWRARCEALGM-----QPDQQTKLLFAVDGRSRFEPPLPEGFFG  307

Query  488  NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFL  315
            N ++  Y  +K  EL   P   TV +V    + +TD Y RSAID+ E+ +  P      L
Sbjct  308  NGIVLTYSLSKAGELLTNPLSFTVGLVQNAVSMVTDSYMRSAIDYFEITRARPSLAATML  367

Query  314  VSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEM  135
            +++W+RL F  + F WG+P +S PV    K++IL      + G     +NVL+ LP   M
Sbjct  368  ITTWYRLSFHTIDFGWGEPIFSGPVALPEKEVILFL----SHGTQRKNINVLLGLPASAM  423

Query  134  EKFKSLFH  111
            + F+ L  
Sbjct  424  KIFEQLME  431



>ref|XP_006436888.1| hypothetical protein CICLE_v10031592mg [Citrus clementina]
 ref|XP_006493245.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
 gb|ESR50128.1| hypothetical protein CICLE_v10031592mg [Citrus clementina]
Length=432

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 99/188 (53%), Gaps = 13/188 (7%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  489
            D V  K T F  L+A +WR  C+AL         D+ + +LFAVD R R  PPLP+ + G
Sbjct  253  DKVLNKCTTFEALSAFVWRARCEALGM-----QPDQQTKLLFAVDGRSRFEPPLPEGFFG  307

Query  488  NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFL  315
            N ++  Y  +K  EL   P   TV +V    + +TD Y RSAID+ E+ +  P      +
Sbjct  308  NGIVLTYSLSKAGELLTNPLSFTVGLVQNAVSMVTDSYMRSAIDYFEITRARPSLAATMV  367

Query  314  VSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEM  135
            +++W+RL F  + F WG+P +S PV    K++IL      + G     +NVL+ LP   M
Sbjct  368  ITTWYRLSFHTIDFGWGEPIFSGPVALPEKEVILFL----SHGTQRKNINVLLGLPASAM  423

Query  134  EKFKSLFH  111
            + F+ L  
Sbjct  424  KIFEQLME  431



>ref|XP_007140651.1| hypothetical protein PHAVU_008G130300g [Phaseolus vulgaris]
 gb|ESW12645.1| hypothetical protein PHAVU_008G130300g [Phaseolus vulgaris]
Length=440

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 109/190 (57%), Gaps = 10/190 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D     +T F V+ A IW+ ++++    E   +++ST+LF VD+R+R+ P LP+S
Sbjct  256  KKALEDKTLKSITTFQVVAAKIWKARSIAIGMSE---EKVSTMLFPVDVRKRVVPELPNS  312

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-  321
            ++GNA++ G+  A   EL+E      ++ V EG  R+ DEY +S IDW E+ KG P  E 
Sbjct  313  FAGNALVPGFARATVKELKELEDGCHIRKVQEGVERLDDEYIKSGIDWLEVNKGAPCMED  372

Query  320  -FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F + +WWRLG E   F WG+ K + P+   +  +++L P    G +   G+N+ + LP 
Sbjct  373  SFSLVAWWRLGLEEQLFAWGRLKSATPLEV-KPGLVMLLP----GPQDQGGINISLDLPQ  427

Query  143  KEMEKFKSLF  114
             +M++F  + 
Sbjct  428  DQMQEFSRIM  437



>ref|XP_004511192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cicer arietinum]
Length=1049

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 113/187 (60%), Gaps = 11/187 (6%)
 Frame = -2

Query  677  KAKAPDNVKTK-VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPD  501
            K KA +N   K +T F V+ A IW+ +AL+    + + +++ST+LF VD+R+R+ P LP+
Sbjct  252  KKKALENTALKNITTFQVVAAKIWKARALA---TKMSHEKVSTMLFPVDVRKRVVPELPN  308

Query  500  SYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  321
            S++GNA++ G+  A   EL E      ++ V EG  R+ +EY +S IDW EL +G P  E
Sbjct  309  SFAGNALVPGFARATVKELMELEDDFHIRKVQEGIERLDNEYIKSGIDWLELNRGVPCKE  368

Query  320  --FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
              F + +WWRLG E   F WG+ K + P++  +  +++L P    G     G+N+ ++LP
Sbjct  369  DSFSLVAWWRLGLENEVFAWGRLKCATPLIV-KPGLVMLLP----GANDEGGLNICLSLP  423

Query  146  PKEMEKF  126
              ++++F
Sbjct  424  QDQLQEF  430



>gb|EYU39478.1| hypothetical protein MIMGU_mgv1a022672mg [Erythranthe guttata]
Length=81

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 16/96 (17%)
 Frame = -2

Query  389  MTDEYARSAIDWGELYKGFPHGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILL  210
            M DEYARSA+DWGE+Y                GF+ V +PWGKP+YSCPVVYHRKDI+L+
Sbjct  1    MNDEYARSAVDWGEIYSK--------------GFDEVAYPWGKPRYSCPVVYHRKDIVLI  46

Query  209  FPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFHKFL  102
            FP+I  GG  ++GVN+LVALP  EM+KF+SLF K+L
Sbjct  47   FPEI--GGAGSNGVNILVALPANEMDKFESLFRKYL  80



>ref|XP_003551391.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=441

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 109/193 (56%), Gaps = 10/193 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
             K KA   +     +T F V+ A IW+ ++++    E   +++ST+LF VD+R+R+ P L
Sbjct  254  FKKKALKENTTLKNITTFQVVAAKIWKARSIATKMLE---EKVSTMLFPVDVRKRVVPEL  310

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P+ ++GNA++ G+  A   +L E      ++ V EG  R+ DEY +S IDW E+ KG P 
Sbjct  311  PNGFAGNALVPGFARASVRDLIELEDACHIRKVQEGVERLDDEYIKSGIDWLEVNKGAPC  370

Query  326  GE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
             E  F + +WWRLG E   F WG+ K + P+   +  +++L P    G +   G+N+ + 
Sbjct  371  MEDSFSLVAWWRLGLEEQLFAWGRLKCATPLAV-KAGLVMLLP----GPQDEGGLNICLD  425

Query  152  LPPKEMEKFKSLF  114
            LP  +M++F  + 
Sbjct  426  LPEDQMQEFSRIM  438



>gb|ADL62856.1| acyltransferase [Cynara cardunculus var. scolymus]
Length=438

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 101/194 (52%), Gaps = 10/194 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            RLK KA A  ++ T  T F  L+A +W+ +  +    +   D+ + +LFAVD R R  PP
Sbjct  250  RLKIKATADGDMPT-CTSFEALSAFVWKARTEAL---QMKPDQKTKLLFAVDGRSRFEPP  305

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP+ YSGN ++      K  E  E P   TV++V+E     TD Y RSAID+ E+    P
Sbjct  306  LPEGYSGNGIVLTNSICKAGEQIENPLSFTVKLVHEAVKMTTDGYMRSAIDYFEVTGARP  365

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W +L F    F WG+P  S PV    K++IL      + GK    VNVL+
Sbjct  366  SLASTLLITTWSKLSFHAQDFGWGEPIMSGPVALPEKEVILFL----SHGKQRKSVNVLL  421

Query  155  ALPPKEMEKFKSLF  114
             LP   M+ F+ L 
Sbjct  422  GLPVSAMKTFEELM  435



>ref|XP_004503772.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=430

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 100/194 (52%), Gaps = 10/194 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+  IWR +  +     N   +L   LFAVD R +  P +
Sbjct  244  LKKKA-TEDGVLKKCSTFEALSGFIWRARTKASKLHPNQEVKL---LFAVDGRSKFVPEI  299

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++      K +EL + P   +V ++      +TDEY RSAID+ E+ +  P 
Sbjct  300  PKGYFGNAIVLSNAMCKASELLKNPLSFSVGLIERAIEMVTDEYVRSAIDYFEVQRSKPS  359

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W RL F    F WGKPK  CPV    K+++L  P     G++N  VNVL+ 
Sbjct  360  LTATLLITTWTRLSFHEADFGWGKPKCFCPVTLPEKEVVLFLPH----GENNKSVNVLLG  415

Query  152  LPPKEMEKFKSLFH  111
            LP   M++F+ L  
Sbjct  416  LPASVMKRFEMLLE  429



>ref|XP_010086996.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXB25275.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=428

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 101/194 (52%), Gaps = 10/194 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA   D V  K T F  L+A +WR +  +        D+ + +LFAVD R R  PP
Sbjct  241  QLKKKAMT-DGVLQKCTTFQALSAFVWRARTEAL---RMQPDQKTKLLFAVDGRPRFEPP  296

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P+ Y GNA++      +  EL E P    V++V +    + D Y RSAID+ E+ +  P
Sbjct  297  IPEGYCGNAIVLTNSLCRAGELVENPLSYAVELVQKAVNMVNDSYMRSAIDYFEITRARP  356

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  ++++W RL F    F WG+P+ S PV    K++IL      + GK    +NVL+
Sbjct  357  SLAATLVITTWSRLSFHTTDFGWGEPRLSGPVALPEKEVILFL----SHGKERKSINVLL  412

Query  155  ALPPKEMEKFKSLF  114
             LP   M+ F++L 
Sbjct  413  GLPESAMKIFENLM  426



>gb|KEH22614.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=438

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 109/187 (58%), Gaps = 11/187 (6%)
 Frame = -2

Query  677  KAKAPDNVKTK-VTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPD  501
            K KA +N   K +T F V+ A IW+ + ++    + + D++ST+LF VD+R+ + P L +
Sbjct  253  KKKAQENKTLKNITTFQVVAAKIWKARTIAT---KMDDDKVSTMLFPVDVRKMVVPELQN  309

Query  500  SYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE  321
             ++GNA++ G+  A   EL E      ++ V EG  R+ DEY +S IDW E+ +G P  E
Sbjct  310  GFAGNALVPGFARATVKELIELEDDFLIRKVQEGIERLNDEYIKSGIDWLEVNRGVPCKE  369

Query  320  --FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALP  147
              F + +WWRLG E   F WG  K + P++  +  ++++ P    G K   G+N+ ++LP
Sbjct  370  DGFSLVAWWRLGLENEVFAWGTLKCATPLIV-KPGLVIMLP----GTKDEGGINICLSLP  424

Query  146  PKEMEKF  126
              ++++F
Sbjct  425  QDQLQEF  431



>ref|XP_011073101.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
 ref|XP_011073102.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
Length=432

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 96/191 (50%), Gaps = 9/191 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D    K T F  L+A +WR ++ +    +   D+ + +LFAVD R R  PP+P  
Sbjct  248  KQALEDRTLEKCTTFEALSAFVWRARSEAL---DLKPDQQTKLLFAVDGRSRFEPPIPQK  304

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  324
            Y GNA++         EL E P   TV++V E    +TD Y RSAID+ E  +  P    
Sbjct  305  YFGNAIVLTNSLCNSGELVENPLSFTVKLVQEAVKMVTDGYMRSAIDYFEATRARPSLAA  364

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+ LP 
Sbjct  365  TLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVLLGLPA  420

Query  143  KEMEKFKSLFH  111
              M+KF+ L  
Sbjct  421  PAMKKFEQLME  431



>ref|XP_011073100.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Sesamum indicum]
Length=490

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 96/191 (50%), Gaps = 9/191 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D    K T F  L+A +WR ++ +    +   D+ + +LFAVD R R  PP+P  
Sbjct  306  KQALEDRTLEKCTTFEALSAFVWRARSEAL---DLKPDQQTKLLFAVDGRSRFEPPIPQK  362

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  324
            Y GNA++         EL E P   TV++V E    +TD Y RSAID+ E  +  P    
Sbjct  363  YFGNAIVLTNSLCNSGELVENPLSFTVKLVQEAVKMVTDGYMRSAIDYFEATRARPSLAA  422

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+ LP 
Sbjct  423  TLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVLLGLPA  478

Query  143  KEMEKFKSLFH  111
              M+KF+ L  
Sbjct  479  PAMKKFEQLME  489



>ref|XP_010250620.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=432

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 100/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA   D V  K T F VL+A +WR +  S        D+ + +LFAVD R + NPP
Sbjct  245  QLKLKAMK-DGVLEKCTTFEVLSAFVWRARTKSL---RLQPDQQTKLLFAVDGRSKFNPP  300

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++         +L E P   TV++V +    +TD Y RSAID+ E+ +  P
Sbjct  301  LPKGYFGNGIVLTNSLCSAGQLLENPLSFTVELVQKAVKMVTDGYMRSAIDYFEVTRARP  360

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+
Sbjct  361  SLAATLLITTWSRLSFHITDFGWGEPLLSGPVSLPEKEVILFL----SHGKERKSINVLL  416

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  417  GLPASAMKVFEELMQ  431



>ref|XP_003602785.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase-like 
protein [Medicago truncatula]
 gb|AES73036.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=435

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 102/192 (53%), Gaps = 10/192 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+A +WR +  +     N   +L   LFAVD R R  PP+
Sbjct  248  LKKKA-TEDGVLKKCSTFEALSAFVWRTRTSALKMHPNQQTKL---LFAVDGRPRFIPPI  303

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++      K  EL E PF  +V +V++    +TD Y RSAID+ E+ +  P 
Sbjct  304  PKGYFGNAIVLTNSLCKANELLENPFSFSVGLVHKAIDMVTDSYMRSAIDYFEVTRARPS  363

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
              G  L+++W +L F+   F WG+P  S PV     ++IL      + G+   G++VL+ 
Sbjct  364  LTGTLLITTWTKLSFDTTDFGWGEPLCSGPVTLPNTEVILFL----SHGQGRKGISVLLG  419

Query  152  LPPKEMEKFKSL  117
            LP   ME+F+ L
Sbjct  420  LPASAMERFEEL  431



>ref|XP_007031933.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY02859.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=506

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 101/193 (52%), Gaps = 14/193 (7%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
            LK KA   D V  K T F  L+A +WR   KALS L     SD+ + +LFAVD R + NP
Sbjct  257  LKKKA-MEDGVLEKCTTFEALSAFVWRARTKALSML-----SDQQTKLLFAVDGRPKFNP  310

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP+ Y GN ++      +  EL + PF   V ++ +    +TD Y RSAID+ E+ +  
Sbjct  311  PLPNGYFGNGIVLTNSICQAGELLDKPFSHAVGLIQDAIKMVTDGYMRSAIDYFEVTRAR  370

Query  332  P--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL
Sbjct  371  PSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVL  426

Query  158  VALPPKEMEKFKS  120
            + LP   M+   +
Sbjct  427  LGLPASSMKSMAT  439



>emb|CBI33005.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 103/190 (54%), Gaps = 10/190 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D      T F  + A IW+ ++++    E    ++ST+LF VD R R+ P  P  
Sbjct  273  KAALRDGKLKNCTTFQAVAAKIWKARSIAV---EMAEGKISTMLFPVDTRTRVVPQAPVG  329

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-  321
            ++GNA++ G+  A   EL+E  +   V+ V EG  R+ DEY RS IDW E+ +G P  E 
Sbjct  330  FAGNALVPGFARASVKELKEEEYSSLVRRVQEGIERLDDEYVRSGIDWLEVNRGVPCRED  389

Query  320  -FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F + +WWRLG E  +F WG+ K + PVV  +  I+ L P    G  +  G+N+ + L  
Sbjct  390  SFSLVAWWRLGLEEEEFAWGRLKCASPVVV-KPGIVFLLP----GPTAEGGLNIFLELEG  444

Query  143  KEMEKFKSLF  114
             ++ +F+ L 
Sbjct  445  DQVVEFRRLM  454



>ref|XP_003580168.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brachypodium distachyon]
Length=455

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 95/190 (50%), Gaps = 9/190 (5%)
 Frame = -2

Query  668  APDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  489
            A    +   T F  L+  +WR +  + LG     ++ + +LFAVD RRRL+PPLP  Y G
Sbjct  273  AQSQAQASFTTFEALSGLVWRART-AALG--LAPEQQTKLLFAVDARRRLSPPLPRGYFG  329

Query  488  NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFL  315
            N ++     A   +L   P      MV +    +TDEY RSA+D+ E  +  P      L
Sbjct  330  NGIVLTNALATAGDLLASPVSSAAAMVQDAVRMVTDEYVRSAVDYFEATRARPSLASTLL  389

Query  314  VSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEM  135
            +++W RL F+G  F WG+P  S PV    K++IL        G+    +NVL+ LP   M
Sbjct  390  ITTWSRLAFDGADFGWGQPAMSGPVTLPEKEVILFLAH----GQERKSINVLLGLPASAM  445

Query  134  EKFKSLFHKF  105
            + F+ L  + 
Sbjct  446  DAFQELMDEI  455



>ref|XP_010249109.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
 ref|XP_010249110.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=432

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 99/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            ++K KA   D V  K T F  L+A +WR +  S        D+ + +LFAVD R R +PP
Sbjct  245  QIKMKAMQ-DGVLEKCTTFEALSAFVWRARTQSL---RMEPDQKTKLLFAVDGRSRFDPP  300

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++         EL E P   TV++V +    +TD Y RSAID+ E+ +  P
Sbjct  301  LPKGYFGNGIVLTNSLCSAGELLENPLSFTVELVQKAVKMVTDGYMRSAIDYFEVTRERP  360

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+
Sbjct  361  SLAATLLITTWSRLSFHTTDFGWGEPLLSGPVALPEKEVILFL----SHGKERKSINVLL  416

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  417  GLPASAMKMFEELVQ  431



>ref|XP_010652628.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Vitis vinifera]
Length=454

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 104/192 (54%), Gaps = 10/192 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D      T F  + A IW+ ++++    E    ++ST+LF VD R R+ P  P  
Sbjct  270  KAALRDGKLKNCTTFQAVAAKIWKARSIAV---EMAEGKISTMLFPVDTRTRVVPQAPVG  326

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-  321
            ++GNA++ G+  A   EL+E  +   V+ V EG  R+ DEY RS IDW E+ +G P  E 
Sbjct  327  FAGNALVPGFARASVKELKEEEYSSLVRRVQEGIERLDDEYVRSGIDWLEVNRGVPCRED  386

Query  320  -FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F + +WWRLG E  +F WG+ K + PVV  +  I+ L P    G  +  G+N+ + L  
Sbjct  387  SFSLVAWWRLGLEEEEFAWGRLKCASPVVV-KPGIVFLLP----GPTAEGGLNIFLELEG  441

Query  143  KEMEKFKSLFHK  108
             ++ +F+ L  +
Sbjct  442  DQVVEFRRLMME  453



>emb|CAN63569.1| hypothetical protein VITISV_043430 [Vitis vinifera]
Length=392

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 86/143 (60%), Gaps = 6/143 (4%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            +    K +    + A +WR +  +      N D  STVLFAVDIR +L+PPLP  +SGNA
Sbjct  253  EKTMNKYSTLEAIVAHLWRARTRAVF---ENPDDFSTVLFAVDIRSKLSPPLPHGFSGNA  309

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP---HGEFLV  312
            V+T + +A+ + L + PF   V+MV E   R+TD+Y +SAIDW E+ KG P   +G F +
Sbjct  310  VITAFATAQVSHLVQKPFSFCVEMVKEAVDRVTDDYVKSAIDWLEVSKGIPATCNGNFYI  369

Query  311  SSWWRLGFEGVQFPWGKPKYSCP  243
            S+W +L F  + F +GKP +  P
Sbjct  370  SAWRKLPFGELDFGFGKPIHGGP  392



>ref|XP_007038058.1| HXXXD-type acyl-transferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY22559.1| HXXXD-type acyl-transferase family protein isoform 2 [Theobroma 
cacao]
Length=433

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK+KA   D V ++ T F VL   +WR  C+AL+ L      ++L+ +LFAVD R+R  
Sbjct  246  QLKEKA-TEDGVVSQCTTFEVLAGFVWRARCQALNLL-----PEQLTKLLFAVDGRKRFI  299

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y+GN ++     A   EL E P    V ++ +     TD Y RSAID+ E+ + 
Sbjct  300  PPLPQGYAGNGIVLTNSIATAGELIEKPLSFAVGLIQQAVGLATDSYMRSAIDYFEVTRA  359

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P   G  L+++W +L F  + F WG+   S PV    K +IL  P      K    +N+
Sbjct  360  RPSLAGTVLLTTWAKLSFYSIDFGWGETISSGPVALPEKPVILFLPS----QKDKKSINL  415

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M  F+ L  
Sbjct  416  LLGLPASAMNIFEELMQ  432



>ref|XP_004235315.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=433

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 100/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KAK   NV TK T F VL+A IW+ +  +    +   D+ + +LFAVD R R +P 
Sbjct  246  QLKAKAKEDGNV-TKCTSFEVLSAFIWKARTQAL---QMKPDQKTKLLFAVDGRSRFDPS  301

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P  Y GN ++        AE+ E P    V++V E    +TD Y +SAID+ E  +  P
Sbjct  302  IPRGYFGNGIVLTNALCTAAEIVENPLSVAVKLVQEAVKLVTDSYMKSAIDYFETTRARP  361

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    VNVL+
Sbjct  362  SLTATLLITTWSRLSFHTTDFGWGEPIVSGPVALPEKEVSLFL----SHGKERRSVNVLL  417

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  418  GLPASAMKTFEELME  432



>ref|XP_007038057.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY22558.1| HXXXD-type acyl-transferase family protein, putative isoform 
1 [Theobroma cacao]
Length=519

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK+KA   D V ++ T F VL   +WR  C+AL+ L      ++L+ +LFAVD R+R  
Sbjct  332  QLKEKA-TEDGVVSQCTTFEVLAGFVWRARCQALNLL-----PEQLTKLLFAVDGRKRFI  385

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y+GN ++     A   EL E P    V ++ +     TD Y RSAID+ E+ + 
Sbjct  386  PPLPQGYAGNGIVLTNSIATAGELIEKPLSFAVGLIQQAVGLATDSYMRSAIDYFEVTRA  445

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P   G  L+++W +L F  + F WG+   S PV    K +IL  P      K    +N+
Sbjct  446  RPSLAGTVLLTTWAKLSFYSIDFGWGETISSGPVALPEKPVILFLPS----QKDKKSINL  501

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M  F+ L  
Sbjct  502  LLGLPASAMNIFEELMQ  518



>ref|XP_006347627.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
tuberosum]
Length=433

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 100/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA+   NV TK T F VL+A +W+ +  +    +   D+ + +LFAVD R R +P 
Sbjct  246  QLKAKAREDGNV-TKCTSFEVLSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFDPS  301

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P  Y GN ++        AE+ E P    V++V E    +TD Y +SAID+ E  +  P
Sbjct  302  IPQGYFGNGIVLTNALCTAAEIVENPLSVAVKLVQEAVKLVTDSYIKSAIDYFEATRARP  361

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    VNVL+
Sbjct  362  SLTATLLITTWSRLSFHTTDFGWGEPIVSGPVALPEKEVSLFL----SHGKERRSVNVLL  417

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  418  GLPASAMKTFEELME  432



>gb|KHN28276.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=369

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 101/197 (51%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA   D    K T F VL+A +W  R KAL  L      D+ + +LFAVD R + N
Sbjct  182  QLKMKAME-DGALEKCTTFEVLSAFVWIARTKALKLL-----PDQQTKLLFAVDGRAKFN  235

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E PF   V+++ +    +TD Y RSAID+ E+ + 
Sbjct  236  PPLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSYMRSAIDYFEVTRA  295

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG P  S PV    K++IL      + G+    +NV
Sbjct  296  RPSLACTLLITTWSRLSFHTTDFGWGDPVLSGPVSLPEKEVILFL----SHGQERRNINV  351

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  352  LLGLPAPVMKIFQDLMQ  368



>ref|XP_003549071.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=434

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 101/197 (51%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA   D    K T F VL+A +W  R KAL  L      D+ + +LFAVD R + N
Sbjct  247  QLKMKAME-DGALEKCTTFEVLSAFVWIARTKALKLL-----PDQQTKLLFAVDGRAKFN  300

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E PF   V+++ +    +TD Y RSAID+ E+ + 
Sbjct  301  PPLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSYMRSAIDYFEVTRA  360

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG P  S PV    K++IL      + G+    +NV
Sbjct  361  RPSLACTLLITTWSRLSFHTTDFGWGDPVLSGPVSLPEKEVILFL----SHGQERRNINV  416

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  417  LLGLPAPVMKIFQDLMQ  433



>gb|EYU31840.1| hypothetical protein MIMGU_mgv1a019044mg [Erythranthe guttata]
Length=436

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 95/185 (51%), Gaps = 9/185 (5%)
 Frame = -2

Query  656  VKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVL  477
            V  K T F VL+A +WR +  +        D+ + +LFAVD R +  PPLP  Y GNA++
Sbjct  258  VLKKCTSFEVLSAFVWRARTRAL---NFPDDQETKLLFAVDGRNKFKPPLPKGYFGNAIV  314

Query  476  TGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVSSW  303
                  K  EL E P    V++V E    + D Y RSAID+ E  +  P  +   L+++W
Sbjct  315  LTNCICKAGELLEKPLSHGVRLVQESIKTVNDGYMRSAIDYFEATRARPSLNSTLLITTW  374

Query  302  WRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFK  123
             +L F    F WG+P +S PV    K++IL      + GK   GV VLV LP   M KF+
Sbjct  375  CQLSFNTTDFGWGEPFFSGPVGLPEKEVILFL----SNGKDRKGVTVLVGLPVSAMNKFQ  430

Query  122  SLFHK  108
             L  +
Sbjct  431  ELLQE  435



>gb|KHG11495.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=433

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK++A   D V +K T F VL   +WR  CKAL+ +  +      + +LFA D R+R  
Sbjct  246  QLKEQA-LEDGVLSKCTTFEVLAGFVWRARCKALNLVPQQK-----TKLLFAADGRKRFI  299

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP+ ++GN ++  Y  +   EL E P    V ++ +     TD + RSAID+ E+ + 
Sbjct  300  PPLPEGFAGNGIVLTYSISTAGELAEKPLSFAVGLIQQAVKLATDSFMRSAIDYFEVTRA  359

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P   G  L+++W +L F  + F WG+P  + PV    K ++L  P      K    +N+
Sbjct  360  RPSLDGTVLITTWSKLSFHTIDFGWGEPISTGPVALPEKPVLLFLPH----QKDKKSINL  415

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M  F+ L  
Sbjct  416  LLGLPASAMNSFEELMQ  432



>gb|KHN41391.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=442

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 109/194 (56%), Gaps = 11/194 (6%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
             K KA   +     +T F V+ A IW+ ++++    E   +++ST+LF VD+R+R+ P L
Sbjct  254  FKKKALKENTTLKNITTFQVVAAKIWKARSIATKMLE---EKVSTMLFPVDVRKRVVPEL  310

Query  506  PDSYSG-NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            P+ ++G NA++ G+  A   +L E      ++ V EG  R+ DEY +S IDW E+ KG P
Sbjct  311  PNGFAGSNALVPGFARASVRDLIELEDACHIRKVQEGVERLDDEYIKSGIDWLEVNKGAP  370

Query  329  HGE--FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
              E  F + +WWRLG E   F WG+ K + P+   +  +++L P    G +   G+N+ +
Sbjct  371  CMEDSFSLVAWWRLGLEEQLFAWGRLKCATPLAV-KAGLVMLLP----GPQDEGGLNICL  425

Query  155  ALPPKEMEKFKSLF  114
             LP  +M++F  + 
Sbjct  426  DLPEDQMQEFSRIM  439



>ref|XP_002449535.1| hypothetical protein SORBIDRAFT_05g018060 [Sorghum bicolor]
 gb|EES08523.1| hypothetical protein SORBIDRAFT_05g018060 [Sorghum bicolor]
Length=420

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (51%), Gaps = 9/194 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            R++  A A  +   + T F  L+  +WR +  + LG     ++ + +LFAVD RRR  PP
Sbjct  231  RVRALALALADGGRRFTTFEALSGLVWRART-AALG--LAPEQRTKLLFAVDGRRRFAPP  287

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++     A   EL   P ++   +V +    +TDEY RSA+D+ E  +  P
Sbjct  288  LPRGYFGNGIVLTNAVATAGELLSAPVFRAAGLVQDAVRMVTDEYMRSAVDYFEATRARP  347

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+
Sbjct  348  SLASTLLITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKSINVLL  403

Query  155  ALPPKEMEKFKSLF  114
             LP   M+ F+ L 
Sbjct  404  GLPATAMDAFQELM  417



>ref|XP_007200675.1| hypothetical protein PRUPE_ppa015918mg [Prunus persica]
 gb|EMJ01874.1| hypothetical protein PRUPE_ppa015918mg [Prunus persica]
Length=439

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 102/190 (54%), Gaps = 10/190 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D      T F V+ A  W+ ++++    +   +++ST+L  VD+R+R+ PP P  
Sbjct  255  KAALKDGRLKSCTSFQVVAAMTWKARSIAV---DMPDEKISTILIPVDVRKRVVPPAPPG  311

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-  321
            ++GNA++  +  A   EL+E      V+ V EG  R+ DEY +S IDW E+ KG P  E 
Sbjct  312  FAGNALVPAFAHATVKELKEEDDSSLVRKVQEGVERLDDEYVKSGIDWLEVNKGVPCEEN  371

Query  320  -FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F + SWW+LG E  +F WGK K +  V+     ++LL      G +   G+++ + LP 
Sbjct  372  SFSLVSWWKLGIEHGEFSWGKVKCATSVLLKPGLVMLLL-----GPEGKGGLSICLELPD  426

Query  143  KEMEKFKSLF  114
             +ME F  L 
Sbjct  427  DQMELFCRLM  436



>ref|NP_001275190.1| feruloyl transferase [Solanum tuberosum]
 gb|ACS70946.1| feruloyl transferase [Solanum tuberosum]
Length=433

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 99/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA+   NV TK T F VL+A +W+ +  +    +   D+ + +LFAVD R R +P 
Sbjct  246  QLKAKAREDGNV-TKCTSFEVLSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFDPS  301

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P  Y GN ++        AE+ E P    V++V E    +TD Y +S ID+ E  +  P
Sbjct  302  IPQGYFGNGIVLTNALCTAAEIVENPLSVAVKLVQEAVKLVTDSYIKSTIDYFEATRARP  361

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    VNVL+
Sbjct  362  SLTATLLITTWSRLSFHTTDFGWGEPIVSGPVALPEKEVSLFL----SHGKERRSVNVLL  417

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  418  GLPASAMKTFEELME  432



>ref|XP_010112404.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC33399.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=504

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KAK  +    K T F  L+A +WR   KAL  L      ++ + +LFAVD R +  
Sbjct  317  KLKMKAKE-NGALEKCTTFEALSAFVWRGRTKALRML-----PEQETKLLFAVDGRPKFI  370

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E P    V++V E    + D Y RSAID+ E+ + 
Sbjct  371  PPLPKGYFGNGIVLTNSICQAGELMEKPLSFAVRLVQEAINIVNDRYMRSAIDYFEVTRA  430

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + GK  +G+NV
Sbjct  431  RPSLASTLLITTWSRLSFHKTDFGWGEPVLSGPVALPEKEVILFL----SHGKERNGINV  486

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L H
Sbjct  487  LLGLPAPAMKMFQQLMH  503



>ref|XP_002321725.2| hypothetical protein POPTR_0015s11290g [Populus trichocarpa]
 gb|EEF05852.2| hypothetical protein POPTR_0015s11290g [Populus trichocarpa]
Length=432

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK+KA   D V  K T F VL+A +WR  C+AL  +      D+   +LFA D R R  
Sbjct  245  QLKEKAME-DGVIAKCTTFQVLSAFVWRARCQALKMV-----PDQQIKLLFAADGRSRFE  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PP+P+ Y GNA++         E+ E      V++V E    + D Y RSAID+ E+ + 
Sbjct  299  PPIPEGYFGNAIVLTNSLCTAGEIMENQLSFAVRLVQEAVKMVDDSYMRSAIDYFEVTRA  358

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG P  S PV    K++IL      + G     +NV
Sbjct  359  RPSLTATLLITTWSRLSFHTTDFGWGVPILSGPVALPEKEVILFL----SHGIERKNINV  414

Query  161  LVALPPKEMEKFKSLFH  111
            LV LP   M+ F+ L  
Sbjct  415  LVGLPASSMKIFEELMQ  431



>gb|KHN17483.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=359

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 101/194 (52%), Gaps = 7/194 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK  A + D V  K + F  LTA +WR ++   LG   + ++ + +LFAVD R +  PP+
Sbjct  170  LKKMATSEDGVVKKCSTFEALTAFVWRARS-EALGMHMDPNQQTKLLFAVDGRSKFVPPI  228

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++      K  EL   P   +V +V +    +TD Y RSAID+ E+ +  P 
Sbjct  229  PKGYFGNAIVFSNALCKVEELVNNPLSFSVGLVGKAIDMVTDSYMRSAIDYFEVKRSRPS  288

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W R+ F    F WGKP +  PV    K++IL      +  + +  +NVL+ 
Sbjct  289  LTATLLITTWTRMPFRSADFGWGKPFFFGPVTLPGKEVILFL----SHNEESKSINVLLG  344

Query  152  LPPKEMEKFKSLFH  111
            LP   M++F+ L  
Sbjct  345  LPASAMKRFERLME  358



>gb|ACY79409.1| omega-hydroxyacid hydroxycinnamoyltransferase [Populus trichocarpa]
Length=432

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK+KA   D V  K T F VL+A +WR  C+AL  +      D+   +LFA D R R  
Sbjct  245  QLKEKAME-DGVIAKCTTFQVLSAFVWRARCQALRMV-----PDQQIKLLFAADGRSRFE  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PP+P+ Y GNA++         E+ E      V++V E    + D Y RSAID+ E+ + 
Sbjct  299  PPIPEGYFGNAIVLTNSLCTAGEIMENQLSFAVRLVQEAVKMVDDSYMRSAIDYFEVTRA  358

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG P  S PV    K++IL      + G     +NV
Sbjct  359  RPSLTATLLITTWSRLSFHTTDFGWGVPILSGPVALPEKEVILFL----SHGIERKNINV  414

Query  161  LVALPPKEMEKFKSLFH  111
            LV LP   M+ F+ L  
Sbjct  415  LVGLPASSMKIFEELMQ  431



>ref|XP_009600109.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana tomentosiformis]
Length=433

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 100/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KAK   N+ TK T F  L+A +W+ +  +    +   D+ + +LFAVD R R +P 
Sbjct  246  QLKAKAKEDGNI-TKCTTFEALSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFDPS  301

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P+ Y GN ++        AE+ E P    V++V E    +TD Y RSAID+ E  +  P
Sbjct  302  IPEGYFGNGIVLTNALCNAAEIVENPLSVAVKLVQEAVKMVTDSYMRSAIDYFEATRVRP  361

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    +NVL+
Sbjct  362  SLTATLLITTWSRLSFHTTDFGWGEPVVSGPVALPEKEVSLFL----SHGKERRNINVLL  417

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ ++ L  
Sbjct  418  GLPASAMKTYEELME  432



>ref|XP_002303052.1| hypothetical protein POPTR_0002s24610g [Populus trichocarpa]
 gb|EEE82325.1| hypothetical protein POPTR_0002s24610g [Populus trichocarpa]
Length=441

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            K T F+ + A +W+ ++++    + + +  ST+LF VD+RR + PP+   ++GNA++ G 
Sbjct  268  KCTTFHAIAAKVWKARSIAT---KIHDEVCSTMLFPVDVRRIVVPPVQIGFAGNALVPGC  324

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE--FLVSSWWRL  294
              A   EL++      V+ V EG  R  DEY RS IDW E+++G P  E  F + +W+RL
Sbjct  325  ARASLRELKDKEDSYIVRKVQEGVERFDDEYVRSGIDWLEVHRGTPCNENSFSLVAWFRL  384

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
            G E   F WGK KY+ PVV  +  ++ L P ++  G    G+N+ + LP  ++++F  L 
Sbjct  385  GLEEDVFSWGKLKYATPVVL-KPGLVFLLPGLEGDG----GLNICLDLPDDQVDEFHRLL  439



>ref|XP_003634222.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
Length=433

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 93/186 (50%), Gaps = 9/186 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  K T F  L+A +WR ++   LG     ++ + +LFAVD R R  PP+P  Y GN 
Sbjct  254  DGVLPKCTTFEALSAFVWRARS-KALG--MKPEQQTKLLFAVDGRSRFQPPIPTGYCGNG  310

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++         EL E P    V +V E    +TD + RSAID+ E+ +  P      LV+
Sbjct  311  IVLTNSLCSAGELLENPLSFAVGLVQEAVKMVTDSFMRSAIDYFEITRARPSLAATLLVT  370

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F    F WG+P  S PV    K++IL      + GK    +NVL+ LP   M+ 
Sbjct  371  TWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGKERKSINVLLGLPASAMKV  426

Query  128  FKSLFH  111
            F+ L  
Sbjct  427  FEELMQ  432



>ref|XP_002458822.1| hypothetical protein SORBIDRAFT_03g040950 [Sorghum bicolor]
 gb|EES03942.1| hypothetical protein SORBIDRAFT_03g040950 [Sorghum bicolor]
Length=415

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 93/188 (49%), Gaps = 9/188 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D    + T F  L+  +WR +    LG     ++ + +LFAVD RRR +PPLP  Y GN 
Sbjct  235  DGALGRCTTFEALSGLVWRART-KALG--LAPEQRTKLLFAVDGRRRFSPPLPRGYFGNG  291

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++     A   EL   P  +   +V E    +TD+Y RSA+D+ E  +  P      L++
Sbjct  292  IVLTNALATAGELLSAPVSRAAGLVQEAVRMVTDDYMRSAVDYFEATRARPSLASTLLIT  351

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ 
Sbjct  352  TWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPATAMDA  407

Query  128  FKSLFHKF  105
            F+ L  + 
Sbjct  408  FQELMDEI  415



>ref|XP_008235736.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Prunus mume]
Length=477

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 104/190 (55%), Gaps = 10/190 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D      T F V+ A  W+ ++++    +   +++ST+L  V++R+R+ PP P  
Sbjct  293  KAALKDGKLKSCTSFQVVAAMTWKARSIAV---DMPDEKISTILIPVNVRKRVVPPAPPG  349

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE-  321
            ++GNA++  +  A   EL+E      V+ V EG  R+ DEY RS IDW E+ KG P  E 
Sbjct  350  FAGNALVPAFAHATVKELKEEDDSSLVRKVQEGVERLDDEYVRSGIDWLEVNKGVPCEED  409

Query  320  -FLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F + SWW+LG E  +F WG+ K +  V+  +  +++L P    G +   G+++ + LP 
Sbjct  410  SFSLVSWWKLGIEHGEFSWGQVKCTTSVLL-KPGLVMLLP----GPEGKGGLSICLELPD  464

Query  143  KEMEKFKSLF  114
             +ME F  L 
Sbjct  465  DQMELFCRLM  474



>ref|XP_006856294.1| hypothetical protein AMTR_s00047p00102350 [Amborella trichopoda]
 gb|ERN17761.1| hypothetical protein AMTR_s00047p00102350 [Amborella trichopoda]
Length=433

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 88/179 (49%), Gaps = 9/179 (5%)
 Frame = -2

Query  641  TGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGYGS  462
            T F  L A +WR +  +     N   +L   LFAVD R + +PPLP  Y GNA++  Y  
Sbjct  261  TTFECLAALVWRARTKALQMKPNQQTKL---LFAVDGRSKFDPPLPKGYFGNAIVLTYCL  317

Query  461  AKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRLGF  288
                EL E P    V+MV+     + D Y RSAID+ E+ +  P      L+++W RL F
Sbjct  318  CNTEELTEKPLKLAVEMVHNAIQLVNDNYMRSAIDFFEVTRARPSLTATLLITAWNRLDF  377

Query  287  EGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLFH  111
            +   F WG P  S PV     +++L   D     K   G+NVL+ LP   M+ F+ L  
Sbjct  378  QSTNFGWGDPFQSGPVTLPADEVVLFLSD----KKQEKGINVLLGLPATAMKTFQDLMQ  432



>ref|XP_003525421.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Glycine max]
 ref|XP_006580617.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Glycine max]
Length=433

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 101/194 (52%), Gaps = 7/194 (4%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK  A + D V  K + F  LTA +WR ++   LG   + ++ + +LFAVD R +  PP+
Sbjct  244  LKKMATSEDGVVKKCSTFEALTAFVWRARS-EALGMHMDPNQQTKLLFAVDGRSKFVPPI  302

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++      K  EL   P   +V +V +    +TD Y RSAID+ E+ +  P 
Sbjct  303  PKGYFGNAIVFSNALCKVEELVNNPLSFSVGLVGKAIDMVTDSYMRSAIDYFEVKRSRPS  362

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W R+ F    F WGKP +  PV    K++IL      +  + +  +NVL+ 
Sbjct  363  LTATLLITTWTRIPFRSADFGWGKPFFFGPVTLPGKEVILFL----SHNEESKSINVLLG  418

Query  152  LPPKEMEKFKSLFH  111
            LP   M++F+ L  
Sbjct  419  LPASAMKRFERLME  432



>ref|XP_003553956.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=432

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 101/197 (51%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA   D    K T F VL+A +W  R KAL  L      D+ + +LFAVD R + N
Sbjct  245  QLKMKAME-DGALEKCTTFEVLSAFVWIARTKALKML-----PDQQTKLLFAVDGRAKFN  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P LP  Y GN ++      +  EL E PF   V+++ +    +TD Y RSAID+ E+ + 
Sbjct  299  PTLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSYMRSAIDYFEVTRA  358

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G+    +NV
Sbjct  359  RPSLACTLLITTWSRLSFHTTDFGWGEPALSGPVSLPEKEVILFL----SHGQERRNINV  414

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  415  LLGLPAPVMKIFQDLMQ  431



>ref|XP_008464403.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Cucumis 
melo]
Length=433

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 91/183 (50%), Gaps = 9/183 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  K T F  L+  +WR +  +        D+ + +LFAVD R +  P +P  YSGNA
Sbjct  254  DGVLKKCTTFEALSGFVWRARTEAL---RMKPDQQTKLLFAVDGRSKFQPTIPKGYSGNA  310

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++         EL E P    V +V +    +TD Y RSAID+ E  +  P      L++
Sbjct  311  IVLTNSICSAGELLENPLSYGVGLVQKAVEMITDSYMRSAIDFFETTRSRPSLAATLLIT  370

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RLGF    F WG+P +S PV    K++IL      + GK    +NVL+ LP   ME 
Sbjct  371  TWSRLGFHTTDFGWGEPVFSGPVALPEKEVILFL----SHGKERKSINVLLGLPASAMEI  426

Query  128  FKS  120
            F+ 
Sbjct  427  FQQ  429



>emb|CDY68497.1| BnaCnng59260D [Brassica napus]
Length=444

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 101/198 (51%), Gaps = 17/198 (9%)
 Frame = -2

Query  683  KDKAKAPDNVKT----KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRR  522
            K K +A +N ++      T F  L+A +WR   K+L  L     SD+ + +LFAVD R +
Sbjct  253  KLKLQATENSESLLGNSCTTFEALSAFVWRARTKSLKML-----SDQKTKLLFAVDGRAK  307

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
              PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ 
Sbjct  308  FEPPLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDRYMRSAIDYFEVT  367

Query  341  KGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  168
            +  P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +
Sbjct  368  RARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEERRSI  423

Query  167  NVLVALPPKEMEKFKSLF  114
            NVL+ LP   M+ F+ LF
Sbjct  424  NVLLGLPASAMDVFQELF  441



>ref|XP_009770247.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana sylvestris]
Length=433

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 100/195 (51%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KAK   N+ TK T F  L+A +W+ +  +    +   D+ + +LFAVD R R +P 
Sbjct  246  QLKAKAKEDGNI-TKCTIFEALSAFVWKARTQAL---QMKPDQKTKLLFAVDGRSRFDPS  301

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P+ Y GN ++        AE+ + P    V++V E    +TD Y RSAID+ E  +  P
Sbjct  302  IPEGYFGNGIVLTNALCNAAEIVDNPLSVAVKLVQEAVKMVTDSYMRSAIDYFEATRVRP  361

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    +NVL+
Sbjct  362  SLTATLLITTWSRLSFHTTDFGWGEPVVSGPVALPEKEVSLFL----SHGKERRNINVLL  417

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  418  GLPASAMKTFEELME  432



>ref|XP_004138033.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 gb|KGN63464.1| hypothetical protein Csa_1G001360 [Cucumis sativus]
Length=433

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 91/183 (50%), Gaps = 9/183 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  K T F  L+  +W+ +  +        D+ + +LFAVD R R  P +P  YSGNA
Sbjct  254  DGVLKKCTTFEALSGFVWKARTEAL---RMKPDQQTKLLFAVDGRSRFKPTIPKGYSGNA  310

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++         EL E P    V +V +    +TD Y RSAID+ E  +  P      L++
Sbjct  311  IVLTNSICSAGELLENPLSYGVGLVQKAVEMITDSYMRSAIDFFETTRSRPSLAATLLIT  370

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RLGF    F WG+P +S PV    K++IL      + GK    +NVL+ LP   ME 
Sbjct  371  TWSRLGFHTTDFGWGEPVFSGPVALPEKEVILFL----SHGKERKSINVLLGLPASAMEI  426

Query  128  FKS  120
            F+ 
Sbjct  427  FQQ  429



>ref|XP_009381343.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 97/194 (50%), Gaps = 10/194 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LK +A   D V    T F  L+A +WR +  + L  E+  D+ + +LFAVD R R +PP
Sbjct  255  HLKSRATG-DGVLHSCTTFEALSALVWRART-AALRVEH--DQQTKLLFAVDGRSRFDPP  310

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++         EL E PF   V +V +    +TD Y RSAID+ E+ +  P
Sbjct  311  LPKGYFGNGIVLTSALCDAGELLEKPFSFAVGLVQKAVRMITDGYMRSAIDYFEVTRVRP  370

Query  329  --HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WGKP  S PV    K++IL      + GK     NVL+
Sbjct  371  PLTATLLITTWSRLTFHATDFGWGKPVQSGPVALPEKEVILFL----SHGKERRSTNVLL  426

Query  155  ALPPKEMEKFKSLF  114
             LP   M  F+ L 
Sbjct  427  GLPDSAMVAFQELI  440



>ref|XP_002962552.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ36015.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=449

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 102/191 (53%), Gaps = 7/191 (4%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D   T+ + F+V+   +W+ +  + +G     +  +T+  AVD+ +++ PP+P  
Sbjct  260  KLAMSDGTITRCSTFDVVATYVWKLRT-AAMGMP--LEHQATMFMAVDVSKKVTPPIPRG  316

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HG  324
            + GN         K  EL + P    + +V E   R  DE+ RS IDW E+++G P  +G
Sbjct  317  FVGNRAFPVAVRMKTEELLKKPLSHCLTVVREALLRADDEFVRSWIDWSEIHRGIPRFNG  376

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F +SSWW+  F  + F WGKP Y  PV+  R + +L+ P   +  +   GV+VL+ + P
Sbjct  377  GFYISSWWKFPFYEMDFGWGKPIYMGPVLTQRVEFVLILP--VSPSRPEGGVDVLLTINP  434

Query  143  KEMEKFKSLFH  111
            + M +F++L +
Sbjct  435  QHMARFETLVN  445



>ref|XP_011024641.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=441

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 104/180 (58%), Gaps = 10/180 (6%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            + T F+ + A +W+ ++++    + + +  ST+LF VD+R+ + PP+   ++GNA++ G 
Sbjct  268  RCTTFHAIAAKVWKARSIAT---KIHDEVCSTMLFPVDVRKIVVPPVQIGFAGNALVPGC  324

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPHGE--FLVSSWWRL  294
              A   EL++      V+ V EG  R  DEY RS IDW E+++G P  E  F + +W+RL
Sbjct  325  ARASVRELKDKEDSYIVRKVQEGVERFDDEYVRSGIDWLEVHRGMPCNENSFSLVAWFRL  384

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
            G E   F WGK KY+ PVV  +  ++ L P ++  G    G+N+ + LP  ++++F  L 
Sbjct  385  GLEEDVFSWGKLKYATPVVL-KPGLVFLLPGLEGDG----GLNICLDLPDDQVDEFHRLL  439



>ref|XP_002992754.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
 gb|EFJ06140.1| BAHD family acyltransferase, clade V [Selaginella moellendorffii]
Length=449

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 102/191 (53%), Gaps = 7/191 (4%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D   T+ + F+V+   +W+ +  + +G     +  +T+  AVD+ +++ PP+P  
Sbjct  260  KLAMSDGTITRCSTFDVVATYVWKLRT-AAMGMP--LEHQATMFMAVDVSKKVTPPIPRG  316

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HG  324
            + GN         K  EL + P    + +V E   R  DE+ RS IDW E+++G P  +G
Sbjct  317  FVGNRAFPVAVRMKTEELLKKPLSHCLTVVREALLRADDEFVRSWIDWSEIHRGIPKFNG  376

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
             F +SSWW+  F  + F WGKP Y  PV+  R + +L+ P   +  +   GV+VL+ + P
Sbjct  377  GFYISSWWKFPFYEMDFGWGKPIYMGPVLTQRVEFVLILP--VSPSRPEGGVDVLLTINP  434

Query  143  KEMEKFKSLFH  111
            + M +F++L +
Sbjct  435  QHMARFETLVN  445



>ref|XP_001752413.1| predicted protein [Physcomitrella patens]
 gb|EDQ82652.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 10/184 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D   +KV+ F+ L+  +W+ +  +      +  +L    +AVDIR RL+PPLP  + GNA
Sbjct  231  DGKLSKVSTFDALSGHVWQARIKAIDAKPTDVAQLQ---YAVDIRDRLDPPLPKGFVGNA  287

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            + +    A C E+  G     V+ V +   R+T+++ RS IDW E+Y+G P       +S
Sbjct  288  IYSACARATCEEVRSGSLSFCVEQVQKANERVTNDFIRSGIDWWEVYRGIPAVPSGIFIS  347

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            SW ++ F  +   WGKP Y+ P V    + ++  P          G+NV++AL P+ M K
Sbjct  348  SWQKMPFYSIDLGWGKPMYAGPAVSPMVEFVVFLPT-----PEQQGLNVILALQPEVMTK  402

Query  128  FKSL  117
            F+  
Sbjct  403  FEEF  406



>ref|XP_007137866.1| hypothetical protein PHAVU_009G162300g [Phaseolus vulgaris]
 gb|ESW09860.1| hypothetical protein PHAVU_009G162300g [Phaseolus vulgaris]
Length=434

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 102/195 (52%), Gaps = 10/195 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V +K + F  L+A +WR +  +        D+ + +LFAVD R R  PP+
Sbjct  247  LKKKA-TEDGVLSKCSTFEALSAFVWRARTAAL---RMQPDQQTKLLFAVDGRSRFVPPI  302

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P+ Y GNA++      +  EL + P   +V ++ +    +TD Y RSAID+ E+ +  P 
Sbjct  303  PEGYFGNAIVLTNSLCEAGELLKNPLSYSVGLIQKAIDMVTDSYIRSAIDYFEVTRARPS  362

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W +L F    F WG+P  S PV    K+++L      + G+    +NVL+ 
Sbjct  363  LTATLLITTWTKLSFHTTDFGWGEPLCSGPVTLPEKEVVLFL----SHGQERKNINVLLG  418

Query  152  LPPKEMEKFKSLFHK  108
            LP   ME F++L  +
Sbjct  419  LPKSAMEIFEALMTQ  433



>gb|EPS64002.1| hypothetical protein M569_10778 [Genlisea aurea]
Length=431

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 100/196 (51%), Gaps = 10/196 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK++A   D +  K T F  L+  +W+ +  +    +   D+   +LFAVD RRR  P +
Sbjct  243  LKNRAME-DGILEKCTTFEALSGFVWKARTHAL---DLKPDQEVKLLFAVDGRRRFTPQI  298

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P++Y GNA++      K  E+   P    V++V +    + D Y RSAID+ E  +  P 
Sbjct  299  PENYFGNAIVLTNSLCKAGEIRRNPLSFAVRLVQQAVRMVDDRYMRSAIDYFEATRARPS  358

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
              G  L+++W RL F    F WG P  S PV    K++IL      + GK    +NVL+ 
Sbjct  359  LVGTLLITAWSRLPFHAADFGWGSPAISGPVGLPEKEVILFL----SHGKQRRNINVLLG  414

Query  152  LPPKEMEKFKSLFHKF  105
            LP   M +F++LF + 
Sbjct  415  LPKSAMAEFENLFSQI  430



>ref|XP_010110923.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC29146.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=393

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KAK  +    K T F  L+A +WR   KALS L      ++ + +LFAVD R R  
Sbjct  206  KLKVKAKE-NGALEKCTTFEALSAFVWRARTKALSML-----PEQETKLLFAVDGRPRFI  259

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E P    V++V +    + D Y RS+ID+ E+ + 
Sbjct  260  PPLPKGYFGNGIVITNSICQAGELLEKPLSFAVRLVQDAIKLVNDSYMRSSIDYFEITRT  319

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W+ + F    F WGKP  S PV   +K++IL   D    G+    VNV
Sbjct  320  RPSLACTLLITTWYSVAFRTTDFGWGKPVLSGPVALPQKEMILFLYD----GEETKSVNV  375

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L H
Sbjct  376  LLCLPAHAMKMFQELVH  392



>ref|XP_008672444.1| PREDICTED: uncharacterized protein LOC100273498 isoform X1 [Zea 
mays]
 tpg|DAA56669.1| TPA: hypothetical protein ZEAMMB73_966134 [Zea mays]
Length=446

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 92/190 (48%), Gaps = 13/190 (7%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  489
            D    + T F  L+  +WR   KAL    G+      + +LFAVD RRR  PPLP  Y G
Sbjct  266  DGALGRCTTFEALSGLVWRARTKALGLAPGQR-----TKLLFAVDGRRRFVPPLPRGYFG  320

Query  488  NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFL  315
            N ++     A   EL   P  +   +V E    +TD+Y RSA+D+ E  +  P      L
Sbjct  321  NGIVLTNALATAGELLSAPVSRAAGLVQEAVRMVTDDYMRSAVDYFEATRARPSLASTLL  380

Query  314  VSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEM  135
            +++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M
Sbjct  381  ITTWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPATAM  436

Query  134  EKFKSLFHKF  105
            + F+ L  + 
Sbjct  437  DAFQELVDEI  446



>ref|XP_011023948.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Populus 
euphratica]
Length=432

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK+KA   D V  K T F VL+A +W  RC+AL  +      D+   +LFA D R R  
Sbjct  245  QLKEKA-MEDGVIAKCTKFQVLSAFVWKARCQALRMV-----PDQQIKLLFAADGRSRFE  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P +P+ Y GNA++         E+ E      V++V E    + D Y RSAID+ E+ + 
Sbjct  299  PRIPEGYFGNAIVLTNSMCTAGEIMENQLSFAVRLVQEAVKMVDDSYMRSAIDYFEVTRA  358

Query  335  FP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P  +   L+++W RL F    F WG P  S PV    K++IL      + G     +NV
Sbjct  359  RPSLNATLLITTWSRLSFHTTDFGWGVPILSGPVALPEKEVILFL----SHGNERENINV  414

Query  161  LVALPPKEMEKFKSLFH  111
            LV LP   M+ F+ L  
Sbjct  415  LVGLPASSMKIFEELMQ  431



>gb|EMS51970.1| Omega-hydroxypalmitate O-feruloyl transferase [Triticum urartu]
Length=447

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 91/183 (50%), Gaps = 9/183 (5%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            K T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN ++   
Sbjct  272  KCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLPKGYFGNGIVLTN  328

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRL  294
              A   +L   P  +    V E    +TDEY RSA+D+ E  +  P      L+++W RL
Sbjct  329  AIATAEDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSLASTLLITTWSRL  388

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
             F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ F++L 
Sbjct  389  AFNGADFGWGEPTMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPASAMDAFQALM  444

Query  113  HKF  105
             + 
Sbjct  445  DEI  447



>gb|KJB19785.1| hypothetical protein B456_003G119000 [Gossypium raimondii]
 gb|KJB19786.1| hypothetical protein B456_003G119000 [Gossypium raimondii]
Length=433

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK++A   D V +K T F VL   +WR  CKAL+ +  +      + +LFA D R+R  
Sbjct  246  QLKEQA-LEDGVLSKCTTFEVLAGFVWRARCKALNLVPQQK-----TKLLFAADGRKRFI  299

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP+ ++GN ++  Y  +   EL E P    V ++ +     TD + RSAID+ E+ + 
Sbjct  300  PPLPEGFAGNGIVLTYSISTAGELAEKPLSFAVGLIQQAVKLATDSFMRSAIDYFEVTRA  359

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P   G  L+++W +L F  + F WG+P  + PV    K +++  P      K    +N+
Sbjct  360  RPSLDGTVLITAWSKLSFYTIDFGWGEPISTGPVALPEKPVLIFLPH----QKDKKSINL  415

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M  F+ L  
Sbjct  416  LLGLPVSAMNSFEELMQ  432



>ref|XP_010929588.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=438

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 93/195 (48%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             LK KA   D   +K T F  L+  +W+ +  +     N   +L   LFAVD R R NPP
Sbjct  251  HLKRKAME-DGALSKCTTFEALSGYVWKSRTEALKLQSNQKTKL---LFAVDGRSRFNPP  306

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++         EL E P    V +V +    +TDEY RSAID+ E  +  P
Sbjct  307  LPKGYFGNGIVLTNALCNAGELTENPLSFAVGLVQKAVHMVTDEYMRSAIDYFEATRARP  366

Query  329  --HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  + PV    K++ L      + GK    +NVL+
Sbjct  367  SLSSTLLITTWSRLSFHTTDFGWGEPIETGPVALPEKEVTLFL----SHGKERKSINVLL  422

Query  155  ALPPKEMEKFKSLFH  111
             LP   M KF+ L  
Sbjct  423  GLPTSAMLKFQELME  437



>gb|ABR16192.1| unknown [Picea sitchensis]
Length=440

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 94/191 (49%), Gaps = 9/191 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D V TK + F  L+A +WR ++ +     N   +L   LFAVD R +  PPLP  
Sbjct  256  KEAMEDGVLTKCSTFEALSALVWRSRSKALNMAPNQEAKL---LFAVDGRAKFEPPLPRG  312

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  324
            Y GN ++      K  EL E P    V  + +    +TD++ RSAID+ E+ +  P    
Sbjct  313  YFGNGIVLTSAIGKAGELAEKPLSFGVGRIQKAIGMITDKFMRSAIDYFEITRSRPSLTA  372

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W RL F    F WG+P  S PV    ++++L      + GK    +NVL+ LP 
Sbjct  373  TLLITTWSRLSFHTTDFGWGEPVQSVPVTLPAREVVLFL----SHGKERKSINVLLGLPE  428

Query  143  KEMEKFKSLFH  111
              M++F+    
Sbjct  429  SAMDRFQGFLQ  439



>ref|XP_002511135.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF51737.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=432

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 100/197 (51%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA   D V  K T F  L+A +WR  C+AL  L      D+   +LFAVD R R  
Sbjct  245  QLKRKATE-DGVLPKCTTFEALSAFVWRARCQALKML-----PDQQIKLLFAVDGRSRFV  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PP+P+ Y GNA++      +  EL +      V +V +    + D Y RSAID+ E+ + 
Sbjct  299  PPIPEGYFGNAIVLTNSLCQAGELLDNQLSFAVGLVQKAVNMVNDSYMRSAIDYFEVTRA  358

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NV
Sbjct  359  RPSLAATLLITTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGKERKNINV  414

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L +
Sbjct  415  LLGLPASAMKIFEELMN  431



>emb|CDY11732.1| BnaC06g13400D [Brassica napus]
Length=432

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 99/193 (51%), Gaps = 10/193 (5%)
 Frame = -2

Query  683  KDKAKAPDNVKT-KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            K K +A +N ++   T F  L+A +WR +  S    +  SD+ + +LFAVD R +  PPL
Sbjct  244  KLKLQATENSESLSCTTFEALSAFVWRARTKSL---KMLSDQRTKLLFAVDGRAKFEPPL  300

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP-  330
            P  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ +  P 
Sbjct  301  PKGYFGNGIVLTNSICEAGELTEKPLSYAVGLVREAIKMVTDGYMRSAIDYFEVTRSRPS  360

Query  329  -HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W RLGF    F WG+P  S PV    K++ L      + G+    +NVL+ 
Sbjct  361  LSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSINVLLG  416

Query  152  LPPKEMEKFKSLF  114
            LP   M+ F+  F
Sbjct  417  LPASAMDVFQEQF  429



>emb|CDX67482.1| BnaA07g15220D [Brassica napus]
Length=444

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 100/195 (51%), Gaps = 14/195 (7%)
 Frame = -2

Query  683  KDKAKAPDNVKT-KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
            K K +A +N ++   T F  L+A +WR   K+L  L     SD+ + +LFAVD R +  P
Sbjct  256  KLKLQATENSESLSCTTFEALSAFVWRARTKSLKML-----SDQKTKLLFAVDGRAKFEP  310

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ +  
Sbjct  311  PLPKGYFGNGIVLTNSICEAGELTEKPLGYAVGLVREAIKMVTDGYMRSAIDYFEVTRAR  370

Query  332  P--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +NVL
Sbjct  371  PSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSINVL  426

Query  158  VALPPKEMEKFKSLF  114
            + LP   M+ F+  F
Sbjct  427  LGLPASAMDVFQEQF  441



>ref|XP_009125170.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brassica rapa]
Length=452

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 100/195 (51%), Gaps = 14/195 (7%)
 Frame = -2

Query  683  KDKAKAPDNVKT-KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
            K K +A +N ++   T F  L+A +WR   K+L  L     SD+ + +LFAVD R +  P
Sbjct  264  KLKLQATENSESLSCTTFEALSAFVWRARTKSLKML-----SDQKTKLLFAVDGRAKFEP  318

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ +  
Sbjct  319  PLPKGYFGNGIVLTNSICEAGELTEKPLGYAVGLVREAIKMVTDGYMRSAIDYFEVTRAR  378

Query  332  P--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +NVL
Sbjct  379  PSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSINVL  434

Query  158  VALPPKEMEKFKSLF  114
            + LP   M+ F+  F
Sbjct  435  LGLPASAMDVFQEQF  449



>ref|XP_004979328.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Setaria italica]
Length=454

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 91/183 (50%), Gaps = 9/183 (5%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN ++   
Sbjct  279  RCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRRRFVPPLPRGYFGNGIVLTN  335

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRL  294
              A   EL   P  +   +V +    +TDEY RSA+D+ E  +  P      L+++W RL
Sbjct  336  AIATAGELLSAPVSRAAALVQDAVRMVTDEYMRSAVDYFEATRARPSLASTLLITTWSRL  395

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
             F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ F+ L 
Sbjct  396  EFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPATAMDAFQELM  451

Query  113  HKF  105
             + 
Sbjct  452  DEI  454



>ref|XP_006581855.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Glycine max]
Length=431

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 97/192 (51%), Gaps = 10/192 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+  +WR +  +        D+ + +LFAVD R R  PP+
Sbjct  243  LKKKA-TEDGVLEKCSTFEALSGFVWRARTAAL---RMQPDQQTKLLFAVDGRSRFVPPI  298

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++         EL + P   +V ++ E    +TD Y RSAID+ E+ +  P 
Sbjct  299  PKGYFGNAIVLTNSLCNAGELLKNPLSFSVGLIREAIEMVTDSYMRSAIDYFEVTRARPS  358

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W +L F    F WG+P  S PV    K++IL      + G+    VNVL+ 
Sbjct  359  LAATLLITTWTKLSFHTTDFGWGEPLCSGPVTLPEKEVILFL----SHGQERKSVNVLLG  414

Query  152  LPPKEMEKFKSL  117
            LP   ME F++L
Sbjct  415  LPSSAMEIFEAL  426



>gb|KHN15565.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=658

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 102/200 (51%), Gaps = 14/200 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA   D    K T F VL+A +W  R KAL  L      D+ + +LFAVD R + N
Sbjct  272  QLKMKA-MEDGALEKCTTFEVLSAFVWIARTKALKML-----PDQQTKLLFAVDGRAKFN  325

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P LP  Y GN ++      +  EL E PF   V+++ +    +TD Y RSAID+ E+ + 
Sbjct  326  PTLPKGYFGNGIVLTNSVCQAGELTEKPFSFGVRLIQDAIKMVTDSYMRSAIDYFEVTRA  385

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G+    +NV
Sbjct  386  RPSLACTLLITTWSRLSFHTTDFGWGEPALSGPVSLPEKEVILFL----SHGQERRNINV  441

Query  161  LVALPPKEMEKFKSLFHKFL  102
            L+ LP   M+ F+ L    L
Sbjct  442  LLGLPAPVMKIFQDLMQIVL  461



>gb|KDP41799.1| hypothetical protein JCGZ_26817 [Jatropha curcas]
Length=434

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 100/197 (51%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            ++K KA   D +  K T F  L+A +WR   KAL+ +      D+ + +LFAVD R + N
Sbjct  247  KIKTKAME-DGILEKCTTFETLSAFVWRARTKALNLV-----PDQETKLLFAVDGRPKFN  300

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P LP+ Y GN ++      K +EL + P    V +V      +TD Y RSAID+ E+ + 
Sbjct  301  PKLPEGYFGNGIVLTNSICKVSELLDSPLSYAVGLVQNSIKMVTDSYMRSAIDYFEVTRA  360

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G     +NV
Sbjct  361  RPSLASTLLITTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGNERKSINV  416

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  417  LLGLPASAMKVFQELMQ  433



>ref|XP_003528100.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Glycine max]
Length=436

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 97/192 (51%), Gaps = 10/192 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+  +WR +  +        D+ + +LFAVD R R  PP+
Sbjct  248  LKKKA-TEDGVLEKCSTFEALSGFVWRARTAAL---RMQPDQQTKLLFAVDGRSRFVPPI  303

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++         EL + P   +V ++ E    +TD Y RSAID+ E+ +  P 
Sbjct  304  PKGYFGNAIVLTNSLCNAGELLKNPLSFSVGLIREAIEMVTDSYMRSAIDYFEVTRARPS  363

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W +L F    F WG+P  S PV    K++IL      + G+    VNVL+ 
Sbjct  364  LAATLLITTWTKLSFHTTDFGWGEPLCSGPVTLPEKEVILFL----SHGQERKSVNVLLG  419

Query  152  LPPKEMEKFKSL  117
            LP   ME F++L
Sbjct  420  LPSSAMEIFEAL  431



>dbj|BAJ89613.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 90/183 (49%), Gaps = 9/183 (5%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN ++   
Sbjct  272  RCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLPKGYFGNGIVLTN  328

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRL  294
              A   +L   P  +    V E    +TDEY RSA+D+ E  +  P      L+++W RL
Sbjct  329  ALATAGDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSLASTLLITTWSRL  388

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
             F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ F+ L 
Sbjct  389  AFNGADFGWGEPAMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPASAMDTFQELM  444

Query  113  HKF  105
             + 
Sbjct  445  DEI  447



>ref|XP_010678277.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Beta vulgaris subsp. vulgaris]
Length=433

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 100/193 (52%), Gaps = 14/193 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            RLK+KA     V TK T F  LTA +WR  CKAL       N D+ + +LFAVD R R N
Sbjct  245  RLKNKA-LEHGVLTKCTTFEALTALVWRTRCKALRM-----NPDQQTKLLFAVDGRSRFN  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P LP  + GN ++      K  +L + P    V++V      +TD Y RSAID+ E+ + 
Sbjct  299  PELPKGFFGNGIVLTNALCKARDLLDEPLSHAVELVQGAVKLVTDSYMRSAIDYFEMTRA  358

Query  335  FP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P  +G  ++++W RL F    F WG+  Y+ PV    K++ L  P     G+    ++V
Sbjct  359  RPSLNGTLVITAWSRLAFHSPDFGWGETIYTGPVGLPEKEVALFLP----SGEDRKSISV  414

Query  161  LVALPPKEMEKFK  123
             + +P   M+ F+
Sbjct  415  NLGMPASAMKVFE  427



>gb|EMT29891.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii]
Length=447

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 98/197 (50%), Gaps = 10/197 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            R++  A A  +++ + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PP
Sbjct  259  RVRGLALADGDLE-RCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPP  314

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++     A   +L   P  +    V E    +TDEY RSA+D+ E  +  P
Sbjct  315  LPKGYFGNGIVLTNALATAGDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARP  374

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F G  F WG+P  S PV    K++IL        GK    +NVL+
Sbjct  375  SLASTLLITTWSRLAFNGADFGWGEPTMSGPVTLPEKEVILFLAH----GKERKSINVLL  430

Query  155  ALPPKEMEKFKSLFHKF  105
             LP   M+ F+ L  + 
Sbjct  431  GLPASAMDTFQELMDEI  447



>dbj|BAJ90980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 90/183 (49%), Gaps = 9/183 (5%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN ++   
Sbjct  272  RCTTFEALSGLVWRART-RALG--LAPEQQTKLLFAVDGRRRFVPPLPKGYFGNGIVLTN  328

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRL  294
              A   +L   P  +    V E    +TDEY RSA+D+ E  +  P      L+++W RL
Sbjct  329  ALATAGDLLSAPVSRAAGKVQEAVRMVTDEYMRSAVDYFEATRARPSLASTLLITTWSRL  388

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
             F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ F+ L 
Sbjct  389  AFNGADFGWGEPAMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPASAMDAFQELM  444

Query  113  HKF  105
             + 
Sbjct  445  DEI  447



>emb|CDY48963.1| BnaA04g10770D [Brassica napus]
Length=436

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 100/196 (51%), Gaps = 13/196 (7%)
 Frame = -2

Query  683  KDKAKAPDNVKT----KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            K K +A +N ++      T F  L+A +WR +  S    +  +D+ + +LFAVD R +  
Sbjct  245  KLKLQATENSESLLGNSCTTFEALSAFVWRARTKSL---KMLNDQKTKLLFAVDGRAKFE  301

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ + 
Sbjct  302  PPLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDGYMRSAIDYFEVTRA  361

Query  335  FP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +NV
Sbjct  362  RPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEERRSINV  417

Query  161  LVALPPKEMEKFKSLF  114
            L+ LP   M+ F+ LF
Sbjct  418  LLGLPASAMDVFQELF  433



>gb|KHN32561.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=473

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 97/192 (51%), Gaps = 10/192 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+  +WR +  +        D+ + +LFAVD R R  PP+
Sbjct  285  LKKKA-TEDGVLEKCSTFEALSGFVWRARTAAL---RMQPDQQTKLLFAVDGRSRFVPPI  340

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++         EL + P   +V ++ E    +TD Y RSAID+ E+ +  P 
Sbjct  341  PKGYFGNAIVLTNSLCNAGELLKNPLSFSVGLIREAIEMVTDSYMRSAIDYFEVTRARPS  400

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W +L F    F WG+P  S PV    K++IL      + G+    VNVL+ 
Sbjct  401  LAATLLITTWTKLSFHTTDFGWGEPLCSGPVTLPEKEVILFL----SHGQERKSVNVLLG  456

Query  152  LPPKEMEKFKSL  117
            LP   ME F++L
Sbjct  457  LPSSAMEIFEAL  468



>ref|XP_009140062.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=455

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 101/198 (51%), Gaps = 17/198 (9%)
 Frame = -2

Query  683  KDKAKAPDNVKT----KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRR  522
            K K +A +N ++      T F  L+A +WR   K+L  L     +D+ + +LFAVD R +
Sbjct  264  KLKLQATENSESLLGNSCTTFEALSAFVWRARTKSLKML-----NDQKTKLLFAVDGRAK  318

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
              PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ 
Sbjct  319  FEPPLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDGYMRSAIDYFEVT  378

Query  341  KGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  168
            +  P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +
Sbjct  379  RARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEERRSI  434

Query  167  NVLVALPPKEMEKFKSLF  114
            NVL+ LP   M+ F+ LF
Sbjct  435  NVLLGLPASAMDVFQELF  452



>gb|KDP22581.1| hypothetical protein JCGZ_26412 [Jatropha curcas]
Length=432

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 101/197 (51%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK+ A   + V  K + F  L+A +W  RC+AL  L      D+ + +LFAVD R R  
Sbjct  245  KLKEMATE-NGVIPKCSTFEALSAFVWKARCQALRML-----PDQQTKLLFAVDGRSRFA  298

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PP+P+ Y GNA++      +  +L +      V +V E    + D Y RSAID+ E+ + 
Sbjct  299  PPIPEGYFGNAIVLTNSLCRAGDLLDNHLSFAVGLVKEAVNLVNDSYMRSAIDYFEVTRA  358

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P   G  L+++W RL F    F WG+P  S PV    K++IL      + GK    +NV
Sbjct  359  RPSLAGTLLITTWSRLSFHTTDFGWGEPILSGPVALPEKEVILFL----SHGKERKSINV  414

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  415  LLGLPASAMKFFEELMQ  431



>gb|ADD62404.1| fatty omega-hydroxyacid/fatty alcohol 0-hydroxycinnamoyl transferase 
1 [Quercus suber]
Length=419

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 100/198 (51%), Gaps = 14/198 (7%)
 Frame = -2

Query  683  KDKAKAPDN-VKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
            K K KA +N V  K T F V++A +W  R +AL  L      D+ + +LFAVD R + NP
Sbjct  231  KLKMKAMENGVLDKCTTFEVVSAFVWKARTEALGFL-----PDQKTKLLFAVDGRPKFNP  285

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP  Y GN ++      +  EL E P    V +V      +TD Y RSAID+ E+ +  
Sbjct  286  PLPKGYFGNGIVLTNSICQAGELLEKPLSFAVGLVKNAIKMVTDSYMRSAIDYFEITRAR  345

Query  332  P--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            P      L+++W RL F    F WG+P  S PV    K++ L      + GK    +NVL
Sbjct  346  PSLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGKERKSINVL  401

Query  158  VALPPKEMEKFKSLFHKF  105
            + LP   M+ F+ L   +
Sbjct  402  MGLPASSMKIFQELVQIY  419



>gb|ACN28372.1| unknown [Zea mays]
 gb|AFW84462.1| transferase [Zea mays]
Length=453

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 92/188 (49%), Gaps = 9/188 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D    + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN 
Sbjct  273  DGALGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRRRFAPPLPRGYFGNG  329

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++     A   EL   P  +   +V +    +TD+Y RSA+D+ E  +  P      L++
Sbjct  330  IVLTNALATAGELLSAPVSRAAGLVQDAVRMVTDDYMRSAVDYFEATRARPSLASTLLIT  389

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ 
Sbjct  390  TWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPATAMDA  445

Query  128  FKSLFHKF  105
            F+ L  + 
Sbjct  446  FQELMDEI  453



>ref|NP_001150426.1| transferase [Zea mays]
 gb|ACG39047.1| transferase [Zea mays]
Length=453

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 92/188 (49%), Gaps = 9/188 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D    + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN 
Sbjct  273  DGALGRCTTFEALSGLVWRART-KALG--LAPEQRTKLLFAVDGRRRFAPPLPRGYFGNG  329

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++     A   EL   P  +   +V +    +TD+Y RSA+D+ E  +  P      L++
Sbjct  330  IVLTNALATAGELLSAPVSRAAGLVQDAVRMVTDDYMRSAVDYFEATRARPSLASTLLIT  389

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F G  F WG+P  S PV    K++IL        GK    +NVL+ LP   M+ 
Sbjct  390  TWSRLEFHGADFGWGEPVMSGPVTLPEKEVILFLAH----GKERKSINVLLGLPATAMDA  445

Query  128  FKSLFHKF  105
            F+ L  + 
Sbjct  446  FQELMDEI  453



>ref|XP_008791113.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=432

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 93/195 (48%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            RLK KA   D    K T F  L+  +W+ +  +         + S +LFAVD R R NPP
Sbjct  245  RLKRKAME-DGALDKCTTFEALSGFVWKARTEAL---RLQPSQKSKLLFAVDGRSRFNPP  300

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++         EL E P      +V +    +TDEY RSAID+ E  +  P
Sbjct  301  LPKGYFGNGIVLTNSLCSAGELTEKPLSFAAGLVQKAVRMVTDEYMRSAIDYFEATRARP  360

Query  329  --HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  + PV    K++IL      + GK    +NVL+
Sbjct  361  SLSATLLITTWSRLCFHTTDFGWGEPIQTGPVALPEKEVILFL----SHGKERKSINVLL  416

Query  155  ALPPKEMEKFKSLFH  111
             LP   M KF+ L  
Sbjct  417  GLPSSAMLKFQELME  431



>gb|KJB70702.1| hypothetical protein B456_011G088000 [Gossypium raimondii]
Length=432

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 94/179 (53%), Gaps = 13/179 (7%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  474
            K T F  L+A +WR   KAL+ L      D+ + +LFAVD R + NPPLP  Y GN ++ 
Sbjct  258  KCTTFEALSAFVWRARTKALNML-----PDQQTKLLFAVDGRPKFNPPLPKGYFGNGIVL  312

Query  473  GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVSSWW  300
                ++   L E P    V ++ +    +TD+Y RSAID+ E+ +  P      L+++W 
Sbjct  313  TNSISQAGLLLEKPLSHAVGLIQDAIKMVTDDYMRSAIDYFEVTRARPSLSSTLLITTWS  372

Query  299  RLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFK  123
            RL F    F WG+P  S PV    K++IL      + GK    +NVL+ LP   M+ F+
Sbjct  373  RLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVLLGLPASAMKVFQ  427



>gb|KJB70701.1| hypothetical protein B456_011G088000 [Gossypium raimondii]
Length=443

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 94/179 (53%), Gaps = 13/179 (7%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLT  474
            K T F  L+A +WR   KAL+ L      D+ + +LFAVD R + NPPLP  Y GN ++ 
Sbjct  269  KCTTFEALSAFVWRARTKALNML-----PDQQTKLLFAVDGRPKFNPPLPKGYFGNGIVL  323

Query  473  GYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVSSWW  300
                ++   L E P    V ++ +    +TD+Y RSAID+ E+ +  P      L+++W 
Sbjct  324  TNSISQAGLLLEKPLSHAVGLIQDAIKMVTDDYMRSAIDYFEVTRARPSLSSTLLITTWS  383

Query  299  RLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFK  123
            RL F    F WG+P  S PV    K++IL      + GK    +NVL+ LP   M+ F+
Sbjct  384  RLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVLLGLPASAMKVFQ  438



>ref|XP_003522443.2| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=431

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 100/193 (52%), Gaps = 10/193 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+  +WR +  + LG +   D+ + +LFAVD R+R  PP+
Sbjct  243  LKKKA-TEDGVLEKCSTFEALSGFVWRART-AALGMQ--PDQQTKLLFAVDGRKRFVPPI  298

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH  327
            P  Y GNA++         EL + P   +V ++ E    +TD Y RSAID+ E+ +  P 
Sbjct  299  PKGYFGNAIVLTNSLCNAGELLKNPLSFSVGLIREAIDMVTDSYMRSAIDYFEVTRARPS  358

Query  326  --GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W +L F    F WG+P  S PV    K++IL      + G+    VNVL+ 
Sbjct  359  LTATLLITTWTKLSFHTADFGWGEPLCSGPVTLPEKEVILFL----SHGQERKSVNVLLG  414

Query  152  LPPKEMEKFKSLF  114
            LP   M  F++L 
Sbjct  415  LPSSAMVIFEALM  427



>ref|XP_009379971.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=482

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 90/186 (48%), Gaps = 9/186 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D    K T F  L+  +WR +  + L       +L   LFAVD R R +PPLP+ Y GN 
Sbjct  303  DGALDKCTTFEALSGLVWRARTEALLLQPGQQTKL---LFAVDGRSRFDPPLPEGYFGNG  359

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++         EL   P    V +V +    +TDEY RSA+D+ E  +  P      L++
Sbjct  360  IVLTNSLCTAGELLARPLSFAVGLVQDAVKMVTDEYMRSAMDYFEATRARPSLTATLLIT  419

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F    F WG+P  S PV   +K++IL      + GK    +NVL+ LP   M +
Sbjct  420  TWSRLSFHTTDFGWGEPVQSGPVTLPQKEVILFL----SHGKERKSINVLLGLPNSAMAR  475

Query  128  FKSLFH  111
            F+ L  
Sbjct  476  FQELME  481



>ref|XP_008804093.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=442

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 90/188 (48%), Gaps = 9/188 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D    K T F  L+A +WR +  +     N   +L   LFAVD R R NPPLP  
Sbjct  258  KLAMQDGSLDKCTTFEALSAFVWRARTKALQFQPNQQTKL---LFAVDGRSRFNPPLPKG  314

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HG  324
            Y GN ++      K A+L E P    V ++ +     TD Y RSA+D+ E+ +  P    
Sbjct  315  YFGNGIVLTNSLCKAADLLESPLSFAVGLIQKAVKMATDSYMRSAMDYFEVTRVRPSLSA  374

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL+ LP 
Sbjct  375  TLLITTWSRLAFHTTDFGWGEPLQSGPVALPEKEVILFL----SHGKERRNINVLLGLPT  430

Query  143  KEMEKFKS  120
              M  F+ 
Sbjct  431  SAMLTFQQ  438



>gb|KJB76362.1| hypothetical protein B456_012G084200 [Gossypium raimondii]
Length=445

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 96/189 (51%), Gaps = 13/189 (7%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNPPLP  504
            K    D V  K T F  L+A +WR   KAL+ L     S + + +LFAVD R + +PPLP
Sbjct  261  KYSMEDGVLEKCTTFEALSAFVWRARTKALNLL-----SHQQTKLLFAVDGRPKFDPPLP  315

Query  503  DSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--  330
              Y GN ++      +  EL + P    V ++ +    +TD Y RSAID+ E+ +  P  
Sbjct  316  KGYFGNGIVLTNSICQAGELLDKPISHAVALIQDAIKMVTDGYMRSAIDYFEVTRARPSL  375

Query  329  HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVAL  150
                L+++W RL F    F WG+P  S PV    K++ LL     + GK    +NVL+ L
Sbjct  376  SSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVTLLL----SHGKERKNINVLLGL  431

Query  149  PPKEMEKFK  123
            P   M+ F+
Sbjct  432  PASAMKVFQ  440



>ref|XP_010554116.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554117.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554118.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554119.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554120.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=438

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 98/199 (49%), Gaps = 13/199 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA     V    T F  L+A +WR   KAL  L     +D+ + +LFAVD R +  
Sbjct  249  KLKLKATEDGEVLDNCTTFEALSAFVWRARTKALKML-----NDQKTKLLFAVDGRAKFE  303

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E P    V +V +    +TD Y RSAID+ E+ + 
Sbjct  304  PPLPKGYVGNGIVLTNAICEAGELLEKPLAFAVGLVRDAIKMVTDGYMRSAIDYFEVTRA  363

Query  335  FP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G+    +NV
Sbjct  364  RPSLSSTLLITAWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGEQRRSINV  419

Query  161  LVALPPKEMEKFKSLFHKF  105
            L+ LP   M+ F+    + 
Sbjct  420  LLGLPGSAMDVFEEQMRQI  438



>ref|XP_006844599.1| hypothetical protein AMTR_s00016p00213830 [Amborella trichopoda]
 gb|ERN06274.1| hypothetical protein AMTR_s00016p00213830 [Amborella trichopoda]
Length=432

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 93/180 (52%), Gaps = 9/180 (5%)
 Frame = -2

Query  647  KVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNAVLTGY  468
            + T F  L+A +W+ +  +    +   D+ + +LFAVD R R  PPLP  Y GN ++   
Sbjct  258  RCTTFEALSAFVWKARTRAL---QLRPDQRTKLLFAVDGRSRFVPPLPKGYFGNGIVLTN  314

Query  467  GSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVSSWWRL  294
             +    E+ E P   TV++V +    +TD   RSAID+ E+ +  P      L+++W RL
Sbjct  315  SACNAGEILENPLSFTVELVQKAVDMVTDSCMRSAIDYFEVTRARPSLTATLLITTWSRL  374

Query  293  GFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEKFKSLF  114
             F    F WG+P+ S PV    K++IL      + G+    +NVL+ LP   M+ F+ L 
Sbjct  375  SFHTTDFGWGEPQQSGPVTLPEKEVILFL----SHGRERKSINVLLGLPASAMKTFQDLM  430



>ref|XP_007209159.1| hypothetical protein PRUPE_ppa006018mg [Prunus persica]
 gb|EMJ10358.1| hypothetical protein PRUPE_ppa006018mg [Prunus persica]
Length=432

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 9/191 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D V  K T F  L+A +WR +  +        D+ + +LFAVD R R  PP+P+ 
Sbjct  248  KMAMEDGVLDKCTTFQALSAFVWRARTQAL---RMRPDQKTKLLFAVDGRSRFEPPIPEG  304

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HG  324
            + GNA+L         EL E P    V +V +    +TD Y RSAID+ E+ +  P    
Sbjct  305  FFGNAILLTNSLCSAGELLEKPLSFAVGLVDKAVHMVTDSYMRSAIDYFEVTRARPSLSE  364

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W +L F    F WG+P  S PV    K++ L      + GK+   +NVL+ LP 
Sbjct  365  TLLITTWSKLAFHSTDFGWGEPVLSGPVGLPEKEVSLFL----SHGKNRKSINVLLGLPA  420

Query  143  KEMEKFKSLFH  111
              M+ F+ L  
Sbjct  421  SAMKTFEELMQ  431



>ref|XP_010550744.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=479

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 91/186 (49%), Gaps = 9/186 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V    T F  LT  +W+C+   C       D+   +LFA D R R +PPLP  YSGN 
Sbjct  300  DGVLQHCTTFQTLTGFLWKCR---CQALHLKPDQRIKLLFAADGRSRFSPPLPAGYSGNG  356

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFLVS  309
            ++  Y      +L   P   +V +V      +TD + RSAID+ E+ +  P      L++
Sbjct  357  IVFTYSVTSAGDLMCNPLSHSVGLVRGAVDMVTDGFMRSAIDYFEVTRARPSLSATLLIT  416

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            SW +L F    F WG+P  S PV    K++IL  P     G  +  +NVL+ LP   M+ 
Sbjct  417  SWAKLSFHTKNFGWGEPVVSGPVGLPEKEVILFLP----CGSDSKSINVLLGLPASAMKV  472

Query  128  FKSLFH  111
            F+ L +
Sbjct  473  FEDLMN  478



>ref|XP_006662951.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Oryza brachyantha]
Length=459

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 97/197 (49%), Gaps = 9/197 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            R++  A A  ++  + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PP
Sbjct  270  RVRGLALAGGDLGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRRRFEPP  326

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++     A   +L   P  +   +  E    +TDEY RSA+D+ E  +  P
Sbjct  327  LPKGYFGNGIVLTNAVATAGDLLSSPPSRAAGLGQEAVRMVTDEYMRSAVDYFEATRARP  386

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++IL        GK    +NVL+
Sbjct  387  SLASTLLITTWSRLAFHDADFGWGEPAMSGPVTLPEKEVILFLAH----GKERKSINVLL  442

Query  155  ALPPKEMEKFKSLFHKF  105
             LP   M+ F++L  + 
Sbjct  443  GLPASAMDAFQNLMDEI  459



>ref|XP_010528158.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Tarenaya hassleriana]
Length=439

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 96/193 (50%), Gaps = 13/193 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK  A     V    T F  L+A +WR   KAL  L     +D+ + +LFAVD R +  
Sbjct  250  KLKLTATGDGQVLQSCTTFEALSAFVWRARTKALKLL-----NDQKTKLLFAVDGRAKFQ  304

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN +     + +  EL E P    V +V E    +TD Y RSAID+ E+ + 
Sbjct  305  PPLPKGYFGNGITLINATCEAGELLEKPLAFAVGLVREAINTVTDGYMRSAIDYFEVTRT  364

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WGKP  S PV    K++IL      + G+    +NV
Sbjct  365  RPSLASTLLITTWSRLPFHSTDFGWGKPVLSGPVALPEKEVILFL----SHGEERRSINV  420

Query  161  LVALPPKEMEKFK  123
            L+ LP   M+ F+
Sbjct  421  LLGLPGSAMDVFE  433



>ref|XP_010528157.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 96/193 (50%), Gaps = 13/193 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK  A     V    T F  L+A +WR   KAL  L     +D+ + +LFAVD R +  
Sbjct  261  KLKLTATGDGQVLQSCTTFEALSAFVWRARTKALKLL-----NDQKTKLLFAVDGRAKFQ  315

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN +     + +  EL E P    V +V E    +TD Y RSAID+ E+ + 
Sbjct  316  PPLPKGYFGNGITLINATCEAGELLEKPLAFAVGLVREAINTVTDGYMRSAIDYFEVTRT  375

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WGKP  S PV    K++IL      + G+    +NV
Sbjct  376  RPSLASTLLITTWSRLPFHSTDFGWGKPVLSGPVALPEKEVILFL----SHGEERRSINV  431

Query  161  LVALPPKEMEKFK  123
            L+ LP   M+ F+
Sbjct  432  LLGLPGSAMDVFE  444



>emb|CDO98678.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA   D    K T F  L+A IWR ++ +    +   D+ + +LFAVD R R +PP
Sbjct  245  KLKRKA-LEDGALAKCTTFEALSAFIWRSRSQAL---KMKPDQKTKLLFAVDGRSRFDPP  300

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P+ Y GN ++         EL   P    V++V E    +TD Y RSAID+ E  +  P
Sbjct  301  IPEGYFGNGIVLTNSFCSAGELVGNPLSFAVKLVQESVQIVTDSYMRSAIDYFEATRVRP  360

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + G+    +NVL+
Sbjct  361  SLTATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SHGRERKSINVLL  416

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  417  GLPAAAMKTFEELMQ  431



>gb|EYU23064.1| hypothetical protein MIMGU_mgv1a006699mg [Erythranthe guttata]
Length=434

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 102/196 (52%), Gaps = 12/196 (6%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             L++ A A D    K T F  L+  +WR +  +    +   D+ + +LFAVD R R +PP
Sbjct  247  HLRETALA-DGTLKKCTTFEALSGFVWRARTEAL---DLKPDQETKLLFAVDGRSRFDPP  302

Query  509  LPDSYSGNAVLTGYGSAKCAEL-EEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            +P++Y GNA++     +K   L E GP + +V +V E    +TD Y RSAID+ E  +  
Sbjct  303  IPNNYFGNAIVLTNALSKAGPLIENGPSF-SVGLVQEAVRLVTDGYMRSAIDYFEATRAR  361

Query  332  PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            P      L+++W RL F    F WG P  S PV    K++IL      + G+    +NVL
Sbjct  362  PSLASTLLITTWSRLSFGTTDFGWGPPVLSGPVALPEKEVILFL----SHGREKKSINVL  417

Query  158  VALPPKEMEKFKSLFH  111
            + LP   MEKF+ L  
Sbjct  418  LGLPAPAMEKFEQLME  433



>gb|KFK33037.1| hypothetical protein AALP_AA6G322400 [Arabis alpina]
Length=455

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 100/198 (51%), Gaps = 17/198 (9%)
 Frame = -2

Query  683  KDKAKAPDNVKT----KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRR  522
            K K +A +N ++      T F  L+A +WR   K+L  L     SD+ + +LFAVD R +
Sbjct  264  KLKVQAIENSESLLGNTCTTFEALSAFVWRARTKSLKML-----SDQKTKLLFAVDGRAK  318

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
              PPLP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ 
Sbjct  319  FEPPLPKGYFGNGIVLTNSICEAGELIEKPLSFAVGLVREAIKMVTDGYMRSAIDYFEVT  378

Query  341  KGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  168
            +  P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +
Sbjct  379  RARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSI  434

Query  167  NVLVALPPKEMEKFKSLF  114
            NVL+ LP   M+ F+  F
Sbjct  435  NVLLGLPASAMDVFQEQF  452



>ref|XP_011045747.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Populus 
euphratica]
Length=442

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 98/196 (50%), Gaps = 14/196 (7%)
 Frame = -2

Query  683  KDKAKA-PDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
            K K KA  D V  K T F  L+A +WR   KAL  L      D+ + +LFAVD R + NP
Sbjct  255  KIKMKAMEDGVLGKCTTFEGLSAFVWRARTKALKML-----PDQQTKLLFAVDGRPKFNP  309

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGF  333
            PLP  Y GN ++      +  EL + P    V +V +    +TD Y RSA+D+ E  +  
Sbjct  310  PLPKGYFGNGIVLTNSMCEAGELLDRPLSHAVGLVQDAIKMVTDSYMRSAVDYFEATRVR  369

Query  332  PH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
            P      L+++W RL F    F WG+P  S PV    K++IL      + GK    +NVL
Sbjct  370  PSLASTLLITTWSRLSFYTTDFGWGEPVLSGPVALPEKEVILFL----SHGKERKSINVL  425

Query  158  VALPPKEMEKFKSLFH  111
            + LP   M+ F+ +  
Sbjct  426  LGLPALAMKTFQEMIQ  441



>ref|XP_008231077.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Prunus mume]
Length=436

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 99/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            ++K KA+  D      T F  L+A +W  R +AL  L      ++   +LFAVD RR+ +
Sbjct  249  KVKMKARE-DRALDNCTTFEALSAFVWKARTRALKLL-----PEQQIKLLFAVDGRRKFS  302

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  +L E P    V +V +    +TD Y RSAID+ EL + 
Sbjct  303  PPLPKGYFGNGIVLTNSICQAGDLLEKPLSHAVGLVQDAIKMVTDSYMRSAIDYFELTRA  362

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G     +NV
Sbjct  363  RPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFL----SNGTEKKNINV  418

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L +
Sbjct  419  LLGLPASAMKVFQELMN  435



>ref|XP_008239515.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Prunus 
mume]
Length=432

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 93/191 (49%), Gaps = 9/191 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D V  K T F  L+A +WR +  +        D+ + +LFAVD R R  PP+P+ 
Sbjct  248  KMAMEDGVLDKCTTFQALSAFVWRARTQAL---RMRPDQKTKLLFAVDGRSRFEPPIPEG  304

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HG  324
            + GNA++         EL E P    V +V +    +TD Y RSAID+ E+ +  P    
Sbjct  305  FFGNAIVLTNSLCSAGELLERPLSFAVGLVDKAVHMVTDSYMRSAIDYFEVTRARPSLSA  364

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W +L F    F WG+P  S PV    K++ L      + GK    +NVL+ LP 
Sbjct  365  TLLITTWSKLAFHSTDFGWGEPVLSGPVGLPEKEVSLFL----SHGKDRKSINVLLGLPA  420

Query  143  KEMEKFKSLFH  111
              M+ F+ L  
Sbjct  421  SAMKTFEELMQ  431



>ref|XP_011010462.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
 ref|XP_011010463.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
 ref|XP_011010464.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=369

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 102/198 (52%), Gaps = 20/198 (10%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWR--CKALSCLGGENNSDRLSTVLFAVDIRRRLNP  513
            LK+ A     +K+  + F  LTA +WR  CKAL     + N D+ + +L  VD+R +LNP
Sbjct  183  LKNMAMEDGTIKS-CSNFTALTAFVWRARCKAL-----QMNPDQTTQLLLIVDVRSKLNP  236

Query  512  PLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG-  336
            PLP  Y GN ++T     +  EL + P    V+ V  G   + +EYARS ID+ E+ +  
Sbjct  237  PLPKGYFGNGIVTSSCLGRAGELIKNPLSFAVEEVQNGIKMVNEEYARSWIDYIEVKRAK  296

Query  335  ---FPHGEFLVSSWWRLGFEGVQFPWGKP-KYSCPVVYHRKDIILLFPDIDNGGKSNSGV  168
                P   F+VSSW RL  E   F WG+P ++ C  +   KD     PD    GK   G+
Sbjct  297  DFRLP-SHFIVSSWTRLSIECADFGWGEPAQFGCANL--PKDSGFFLPD----GKEKKGI  349

Query  167  NVLVALPPKEMEKFKSLF  114
            N+++ LP   M  F+ L 
Sbjct  350  NLILDLPVTAMSTFQELM  367



>gb|KEH21000.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=445

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 101/190 (53%), Gaps = 10/190 (5%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK KA   D V  K + F  L+A +WR +  +    + + ++L  +LFAVD R R  PP+
Sbjct  242  LKKKA-TEDGVVKKCSTFEALSAFVWRARTQAL---KVHPNQLVKLLFAVDGRSRFVPPI  297

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP-  330
            P  Y GNA++      K  EL + P   +V+++ +    +TD Y RS ID+ E+ +  P 
Sbjct  298  PKGYFGNAIVLSNAMCKARELLKNPLSFSVELINKAIEMVTDSYMRSVIDYFEVKRSKPT  357

Query  329  -HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVA  153
                 L+++W RL F    F WGKPKY CPV   +K++IL  P  ++       +NV V 
Sbjct  358  LTSTLLITTWTRLSFHEADFGWGKPKYFCPVTLPQKEVILFLPHRED----TKSINVFVG  413

Query  152  LPPKEMEKFK  123
            LP   M+ F+
Sbjct  414  LPASTMQIFE  423



>ref|XP_009375174.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
 ref|XP_009344292.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=434

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 93/189 (49%), Gaps = 9/189 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            K    D V    T F  L+A +WR +  +        D+ + +LFAVD R +L PP+P+ 
Sbjct  249  KMAMEDGVLENCTTFKALSAFVWRARTKAL---RMRPDQKTKLLFAVDGRSKLKPPVPEG  305

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  324
            Y GNA+L  +      EL E P    V +V +    +T  Y RS +D+ E+ +  P    
Sbjct  306  YFGNAILLTHALCSAGELLENPLSFAVGLVDKAVKMVTSSYMRSVVDYFEVTRARPSLAA  365

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              L+++W +L F    F WG+P +S PV    K++ L  P     G+    +NVL+ LP 
Sbjct  366  TLLITAWSKLSFHTTDFGWGEPVFSGPVGLPEKEVSLFLPR----GEDRKSINVLLGLPA  421

Query  143  KEMEKFKSL  117
              ME F+ L
Sbjct  422  SAMEIFEDL  430



>emb|CAT00082.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=432

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 96/195 (49%), Gaps = 10/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA   D    K T F  L+A IWR ++ +    +   D+ + +LFAVD R R +PP
Sbjct  245  KLKRKA-LEDGALAKCTTFEALSAFIWRSRSQAL---KMKPDQKTKLLFAVDGRSRFDPP  300

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P+ Y GN ++         EL   P    V++V E    + D Y RSAID+ E  +  P
Sbjct  301  IPEGYFGNGIVLTNSLCSAGELVGNPLSFAVKLVQESVQIVKDSYMRSAIDYFEATRVRP  360

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++ L      + GK    VNVL+
Sbjct  361  SLTATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SHGKERKSVNVLL  416

Query  155  ALPPKEMEKFKSLFH  111
             LP   M+ F+ L  
Sbjct  417  GLPAAAMKTFEELMQ  431



>ref|XP_010679985.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Beta 
vulgaris subsp. vulgaris]
Length=450

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 96/191 (50%), Gaps = 10/191 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
            +LK KA    N+  K T F  L+A +WR ++ +        D+++ +LFAVD R + NPP
Sbjct  262  KLKAKAMEDGNL-NKCTSFEALSAFVWRARSKAL---NMKPDQMTKLLFAVDGRSKFNPP  317

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            LP  Y GN ++         +L E      V +V E    +TD+Y RSAID+ E  +  P
Sbjct  318  LPKGYFGNGIVLTNSICSAGKLVENNVSYGVGLVQEAINMVTDDYMRSAIDYFETTRARP  377

Query  329  --HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W RL F    F WG+P  S PV    K++IL      + G     +NVL+
Sbjct  378  SLSSTLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGSERRSINVLL  433

Query  155  ALPPKEMEKFK  123
             LP   M+ F+
Sbjct  434  GLPDSAMKNFE  444



>gb|KDP32472.1| hypothetical protein JCGZ_13397 [Jatropha curcas]
Length=434

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 97/197 (49%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            ++K KA   D    K T F  LTA +WR   KAL+ +      D+ + +LFAVD R + N
Sbjct  247  KIKTKA-MEDGTVEKCTTFETLTAFVWRARTKALNLV-----PDQETKLLFAVDGRPKFN  300

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            P LP  Y GN ++      K  EL E P    V++V      +TD Y RSAID+ E+ + 
Sbjct  301  PKLPKGYFGNGIVLTNSICKAGELLENPLSYAVRLVQNSVKAVTDSYMRSAIDYFEVTRA  360

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+S+W RL F    F WG+P  S PV    K++ L      + G     ++V
Sbjct  361  RPSLASTLLLSTWSRLSFHTTDFGWGEPILSGPVALPEKEVSLFL----SHGNERKSIHV  416

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  417  LLGLPASAMKVFQELMQ  433



>ref|XP_007161685.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
 gb|ESW33679.1| hypothetical protein PHAVU_001G089700g [Phaseolus vulgaris]
Length=430

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
             LK KA   D      T F VL+A +W  R KAL     + + D+ + +LFAVD R + N
Sbjct  243  ELKMKAMQ-DGALDACTTFEVLSAFVWIARTKAL-----KMSPDQQTKLLFAVDGRAKFN  296

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL + P    V ++ +    +TD Y RSAID+ E+ + 
Sbjct  297  PPLPKGYFGNGIVITNSVCRAGELTQKPLSFAVGLIQDAIKMVTDTYMRSAIDYFEVTRT  356

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG P  S PV    K++IL      + G+    +NV
Sbjct  357  RPSLTCTLLITTWSRLSFHTTDFGWGDPVLSGPVSLPEKEVILFL----SHGQERRNINV  412

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L  
Sbjct  413  LLGLPATVMKIFQDLMQ  429



>gb|ABA93921.1| transferase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=462

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 90/188 (48%), Gaps = 9/188 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN 
Sbjct  282  DLVGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRRRFEPPLPRGYFGNG  338

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++     A   EL   P  +   +V      +TD Y RSA+D+ E  +  P      L++
Sbjct  339  IVLTNAVATAGELLSSPPSRAAGLVQAAVRMVTDGYMRSAVDYFEATRARPSLASTLLIT  398

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F G  F WG P  S PV    K++IL        G+    +NVL+ LP   M+ 
Sbjct  399  TWSRLAFHGADFGWGAPAMSGPVTLPEKEVILFLAH----GEERKSINVLLGLPASAMDA  454

Query  128  FKSLFHKF  105
            F+ L  + 
Sbjct  455  FQELMDEI  462



>ref|XP_010436043.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=487

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 99/198 (50%), Gaps = 17/198 (9%)
 Frame = -2

Query  683  KDKAKAPDNVKT----KVTGFNVLTAAIWRC--KALSCLGGENNSDRLSTVLFAVDIRRR  522
            K K +A +N ++      T F  L+A +WR   K+L  L     SD+ + +LFAVD R +
Sbjct  296  KLKIQATENSESLLGNSCTSFEALSAFVWRARTKSLKML-----SDQKTKLLFAVDGRAK  350

Query  521  LNPPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELY  342
              P LP  Y GN ++      +  EL E P    V +V E    +TD Y RSAID+ E+ 
Sbjct  351  FEPQLPKGYFGNGIVLTNSICEAGELTEKPLSFAVGLVREAIKMVTDRYMRSAIDYFEVT  410

Query  341  KGFP--HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGV  168
            +  P      L+++W RLGF    F WG+P  S PV    K++ L      + G+    +
Sbjct  411  RARPSLSSTLLITTWSRLGFHTTDFGWGEPVLSGPVALPEKEVTLFL----SHGEQRRSI  466

Query  167  NVLVALPPKEMEKFKSLF  114
            NVL+ LP   M+ F+  F
Sbjct  467  NVLLGLPASAMDVFQEQF  484



>ref|NP_001067952.2| Os11g0507200 [Oryza sativa Japonica Group]
 dbj|BAF28315.2| Os11g0507200 [Oryza sativa Japonica Group]
Length=464

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 90/188 (48%), Gaps = 9/188 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN 
Sbjct  284  DLVGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRRRFEPPLPRGYFGNG  340

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++     A   EL   P  +   +V      +TD Y RSA+D+ E  +  P      L++
Sbjct  341  IVLTNAVATAGELLSSPPSRAAGLVQAAVRMVTDGYMRSAVDYFEATRARPSLASTLLIT  400

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F G  F WG P  S PV    K++IL        G+    +NVL+ LP   M+ 
Sbjct  401  TWSRLAFHGADFGWGAPAMSGPVTLPEKEVILFLAH----GEERKSINVLLGLPASAMDA  456

Query  128  FKSLFHKF  105
            F+ L  + 
Sbjct  457  FQELMDEI  464



>ref|XP_001772486.1| predicted protein [Physcomitrella patens]
 gb|EDQ62768.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 94/187 (50%), Gaps = 10/187 (5%)
 Frame = -2

Query  677  KAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDS  498
            KA   D    KV+ F  LTA  WR +  +         RL   LFAVD R + +PPLP+ 
Sbjct  250  KAILEDGAIQKVSTFEALTALTWRARTQAMDMPLKQKTRL---LFAVDGRSKFDPPLPEH  306

Query  497  YSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--G  324
            + GN ++        AEL + P    V++V +  A + D+Y RSA+D+ EL +  P    
Sbjct  307  FFGNGIVLTCAITTAAELTQQPLSYAVKLVQDAIAMINDDYMRSALDFYELTRSRPALVA  366

Query  323  EFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPP  144
              LV++W RL F  V F WG P  + P     +++IL      + GK    V +L+A+P 
Sbjct  367  TLLVTTWLRLPFHTVDFGWGYPMSTSPACLPDREVILF----TSCGKGRRSVKILLAMPS  422

Query  143  KE-MEKF  126
            +E MEK 
Sbjct  423  QESMEKL  429



>ref|XP_007215405.1| hypothetical protein PRUPE_ppa005943mg [Prunus persica]
 gb|EMJ16604.1| hypothetical protein PRUPE_ppa005943mg [Prunus persica]
Length=436

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            ++K KA+  D      T F  L+A +W  R  AL  L      ++   +LFAVD RR+ +
Sbjct  249  KVKMKARE-DRALDNCTTFEALSAFVWKARTTALKLL-----PEQQIKLLFAVDGRRKFS  302

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  +L E P    V +V +    +TD Y RSAID+ EL + 
Sbjct  303  PPLPKGYFGNGIVLTNSICQAGDLLEKPLSHAVGLVQDAIKMVTDSYMRSAIDYFELTRA  362

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G     +NV
Sbjct  363  RPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFL----SNGTEKKNINV  418

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L +
Sbjct  419  LLGLPASAMKVFQELMN  435



>ref|XP_010026248.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 ref|XP_010026255.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW83126.1| hypothetical protein EUGRSUZ_B00086 [Eucalyptus grandis]
Length=435

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 96/197 (49%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA   + +  + T F  L+A +W  R KAL         D+ + +LFAVD R R  
Sbjct  248  QLKKKAMEHEALD-RCTTFEALSAFVWTARTKALKM-----KPDQQTKLLFAVDGRSRFE  301

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP+ Y GN ++         +L E P    V+ V      +TD Y RSAID+ E  + 
Sbjct  302  PPLPEGYFGNGIVLTNSLCSAGDLLESPLSAAVRKVQNAIEMVTDSYMRSAIDYFETTRA  361

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G+    +NV
Sbjct  362  RPSLAATLLITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVILFL----SHGEERKSINV  417

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M  F+ L +
Sbjct  418  LLGLPESAMNIFEQLMN  434



>ref|XP_004304535.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=445

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA+  D    K + F  L+A +W  R +AL  L      ++   +LFAVD R + N
Sbjct  258  KLKAKARE-DGALDKCSTFEALSAFVWKARTRALRLL-----PEQQIKLLFAVDGRPKFN  311

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E P    V +V +    +TD Y RSAID+ E  + 
Sbjct  312  PPLPKGYFGNGIVLTNSICEAGELLEKPLSHAVGLVQDAIKMVTDGYMRSAIDYFEATRA  371

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G     +NV
Sbjct  372  RPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFL----SNGTEKKNINV  427

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L +
Sbjct  428  LLGLPASAMDVFQELMN  444



>ref|XP_011468200.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=435

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA+  D    K + F  L+A +W  R +AL  L      ++   +LFAVD R + N
Sbjct  248  KLKAKARE-DGALDKCSTFEALSAFVWKARTRALRLL-----PEQQIKLLFAVDGRPKFN  301

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  EL E P    V +V +    +TD Y RSAID+ E  + 
Sbjct  302  PPLPKGYFGNGIVLTNSICEAGELLEKPLSHAVGLVQDAIKMVTDGYMRSAIDYFEATRA  361

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W RL F    F WG+P  S PV    K++IL      + G     +NV
Sbjct  362  RPSLASTLLITTWSRLSFYTTDFGWGEPILSGPVALPEKEVILFL----SNGTEKKNINV  417

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M+ F+ L +
Sbjct  418  LLGLPASAMDVFQELMN  434



>ref|XP_004297519.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Fragaria vesca subsp. vesca]
Length=433

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 93/186 (50%), Gaps = 9/186 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  K T F  L+A +WR +  +        D+ + +LFAVD R R  P +P  Y GNA
Sbjct  254  DGVLEKCTSFVALSAFVWRARTRAL---RMVPDQKTKLLFAVDGRSRFEPVIPKGYYGNA  310

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++  Y      EL E PF  +V +V +    ++D Y RS ID+ E+ +  P      L++
Sbjct  311  IVLTYALCSTGELLENPFSFSVGLVDKAIHMVSDSYMRSVIDYFEVTRARPSLAATLLIT  370

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F    F WG+P +S PV    K++IL      + G+    +NV + +P   M+ 
Sbjct  371  TWSRLDFHTTDFGWGEPVFSGPVGLPEKEVILFL----SHGEDRKSINVFLGMPASAMKV  426

Query  128  FKSLFH  111
            F+ L  
Sbjct  427  FEELMQ  432



>ref|XP_001755199.1| predicted protein [Physcomitrella patens]
 gb|EDQ80143.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 108/206 (52%), Gaps = 12/206 (6%)
 Frame = -2

Query  686  LKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPL  507
            LK    A  N+ TK + F  + A  WR +   CL  +   + +S +L AVD R R+ PP+
Sbjct  263  LKAITMADGNI-TKCSSFEAVIAHFWRSRT-RCL--DFAPEEISNILIAVDFRTRIQPPI  318

Query  506  PDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP-  330
            P ++ GN++++ + SA   E+ + P    V  + +  AR+ + Y RSAIDW +++KG P 
Sbjct  319  PPTFCGNSIISAHVSAPAGEILQEPLSFCVDKIQQAVARINERYVRSAIDWLQIHKGLPA  378

Query  329  ---HGEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVL  159
                 + LVS+WW++ F    + WGKP +S P      + +L+  D    G    G+ +L
Sbjct  379  VRTTKDCLVSAWWKIPFYEHDYGWGKPVHSGPPFPGTSEYVLIVTDPAEDG----GLLLL  434

Query  158  VALPPKEMEKFKSLFHKFLA*SSSSS  81
            V L P EM KF   F    + S+S +
Sbjct  435  VTLLPHEMVKFNKYFKDISSGSNSGT  460



>ref|XP_009378002.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=444

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 98/197 (50%), Gaps = 14/197 (7%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLN  516
            +LK KA+  D      T F  L+A +W  R +AL+ L      ++   +LFAVD RR+  
Sbjct  257  KLKMKARE-DGALENCTTFEALSAFVWKARTRALNLL-----PEQQIKLLFAVDGRRKFR  310

Query  515  PPLPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKG  336
            PPLP  Y GN ++      +  +L + P    V +V +    +TD Y RSAID+ EL + 
Sbjct  311  PPLPKGYFGNGIVLTNSVCQAGDLLDKPLSNAVGLVQDAIKMVTDSYMRSAIDYFELTRA  370

Query  335  FPH--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNV  162
             P      L+++W +L F    F WG+P  S PV    K++IL      + G     +NV
Sbjct  371  RPSLASTLLITTWSKLSFYTTDFGWGEPVLSGPVALPEKEVILFL----SNGTEKKNINV  426

Query  161  LVALPPKEMEKFKSLFH  111
            L+ LP   M  F+ L +
Sbjct  427  LLGLPASAMNVFQELMN  443



>ref|XP_003532502.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
 gb|KHN16860.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=430

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 99/195 (51%), Gaps = 9/195 (5%)
 Frame = -2

Query  689  RLKDKAKAPDNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPP  510
             L  K    D V  K + F  LTA +WR ++   LG   +S++ + +LFAVD R +  PP
Sbjct  242  ELLKKVATEDGVVKKCSTFEALTAFVWRARS-EALG--THSNQQTKLLFAVDGRSKFVPP  298

Query  509  LPDSYSGNAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP  330
            +P  Y GNA++      K  EL   P   +V +V +    + D Y RSAID+ E+ +  P
Sbjct  299  IPKGYFGNAIVFSNALCKVEELVNNPLSFSVGLVGKAIDMVKDSYMRSAIDYFEVKRSRP  358

Query  329  H--GEFLVSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLV  156
                  L+++W R+ F    F WGKP +  PV    K++IL      +  + +  +NVL+
Sbjct  359  SLTATLLITTWTRIPFRSADFGWGKPFFFGPVTLPGKEVILFL----SHNEESKSINVLL  414

Query  155  ALPPKEMEKFKSLFH  111
             LP   M++F+ L  
Sbjct  415  GLPASAMKRFERLME  429



>gb|EAY81037.1| hypothetical protein OsI_36216 [Oryza sativa Indica Group]
Length=460

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 90/188 (48%), Gaps = 9/188 (5%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIWRCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSGNA  483
            D V  + T F  L+  +WR +    LG     ++ + +LFAVD RRR  PPLP  Y GN 
Sbjct  280  DLVGGRCTTFEALSGLVWRART-RALG--LAPEQRTKLLFAVDGRRRFEPPLPRGYFGNG  336

Query  482  VLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFPH--GEFLVS  309
            ++     A   EL   P  +   +V      +TD Y RSA+D+ E  +  P      L++
Sbjct  337  IVLTNAVATAGELLSSPPSRAAGLVQAAVRMVTDGYMRSAVDYFEETRARPSLASTLLIT  396

Query  308  SWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEMEK  129
            +W RL F G  F WG P  S PV    K++IL        G+    +NVL+ LP   M+ 
Sbjct  397  TWSRLAFHGADFGWGAPAMSGPVTLPEKEVILFLAH----GEERKSINVLLGLPVSAMDA  452

Query  128  FKSLFHKF  105
            F+ L  + 
Sbjct  453  FQELMDEI  460



>gb|KDO63871.1| hypothetical protein CISIN_1g014029mg [Citrus sinensis]
Length=432

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 91/187 (49%), Gaps = 13/187 (7%)
 Frame = -2

Query  662  DNVKTKVTGFNVLTAAIW--RCKALSCLGGENNSDRLSTVLFAVDIRRRLNPPLPDSYSG  489
            D V  K + F  L+A +W  R KAL  L  +      + +LFAVD R + NPPLP  Y G
Sbjct  253  DEVLDKCSTFEALSAFVWKARTKALKFLPHQQ-----TKLLFAVDGRSKFNPPLPKGYFG  307

Query  488  NAVLTGYGSAKCAELEEGPFWKTVQMVYEGAARMTDEYARSAIDWGELYKGFP--HGEFL  315
            N ++      +  EL E P    V  V +    + D Y RSAID+ E+ +  P      L
Sbjct  308  NGIVLTNSICQAGELTEKPLSFAVGQVQDAIKMVNDSYMRSAIDYFEVTRARPSLSSTLL  367

Query  314  VSSWWRLGFEGVQFPWGKPKYSCPVVYHRKDIILLFPDIDNGGKSNSGVNVLVALPPKEM  135
            +++W RL F    F WG+P  S PV    K++ L      + GK    +NVL+ LP   M
Sbjct  368  ITTWSRLSFHTTDFGWGEPVLSGPVALPEKEVSLFL----SHGKERKSINVLLGLPASAM  423

Query  134  EKFKSLF  114
            + F+ L 
Sbjct  424  KIFQELM  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520