BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024M07

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    385   2e-132   Cucumis melo [Oriental melon]
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    394   3e-132   Nicotiana tomentosiformis
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    393   6e-132   Solanum lycopersicum
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    393   7e-132   Nicotiana sylvestris
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    391   2e-131   Solanum tuberosum [potatoes]
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    387   5e-130   
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    387   1e-129   Malus domestica [apple tree]
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       387   1e-129   
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    387   2e-129   Prunus mume [ume]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    385   5e-129   Pyrus x bretschneideri [bai li]
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         385   6e-129   Jatropha curcas
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             385   9e-129   Prunus persica
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    385   1e-128   
emb|CDP13207.1|  unnamed protein product                                384   1e-128   Coffea canephora [robusta coffee]
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                384   2e-128   Erythranthe guttata [common monkey flower]
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           384   3e-128   Morus notabilis
emb|CBI23368.3|  unnamed protein product                                382   1e-127   Vitis vinifera
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   381   1e-127   Citrus sinensis [apfelsine]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             381   2e-127   Citrus clementina [clementine]
ref|NP_001268094.1|  uncharacterized protein LOC100261274               381   3e-127   Vitis vinifera
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    381   3e-127   Nelumbo nucifera [Indian lotus]
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    380   6e-127   
emb|CAN62302.1|  hypothetical protein VITISV_023686                     379   2e-126   Vitis vinifera
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    378   4e-126   Fragaria vesca subsp. vesca
gb|AET06145.1|  PLP-dependent aminotransferase                          378   5e-126   Papaver somniferum
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    378   5e-126   Eucalyptus grandis [rose gum]
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    377   8e-126   
ref|XP_003613139.1|  Alanine aminotransferase                           377   8e-126   Medicago truncatula
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    375   4e-125   Populus trichocarpa [western balsam poplar]
gb|AAZ43368.1|  AlaT1                                                   375   7e-125   Vitis labrusca [Concord grape]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    374   3e-124   Glycine max [soybeans]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    373   4e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    373   4e-124   Brassica rapa
emb|CDY61225.1|  BnaC06g43710D                                          373   4e-124   Brassica napus [oilseed rape]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    374   6e-124   Brassica rapa
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    372   8e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    372   9e-124   Tarenaya hassleriana [spider flower]
ref|NP_001237567.1|  alanine aminotransferase 2                         370   4e-123   
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    370   5e-123   Elaeis guineensis
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    370   6e-123   
gb|KJB31170.1|  hypothetical protein B456_005G179600                    370   7e-123   Gossypium raimondii
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    370   7e-123   Cicer arietinum [garbanzo]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    369   1e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             369   1e-122   
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             369   1e-122   Phaseolus vulgaris [French bean]
gb|KJB31175.1|  hypothetical protein B456_005G179600                    369   1e-122   Gossypium raimondii
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    369   2e-122   Gossypium arboreum [tree cotton]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                369   2e-122   Glycine soja [wild soybean]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              368   3e-122   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61453.1|  putative alanine aminotransferase                       368   3e-122   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90574.1|  predicted protein                                      361   4e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    367   8e-122   
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    367   1e-121   Brassica rapa
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    367   1e-121   Populus euphratica
ref|NP_001237581.1|  alanine aminotransferase 3                         367   1e-121   Glycine max [soybeans]
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    362   1e-121   
dbj|BAH20108.1|  AT1G70580                                              366   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    366   2e-121   Elaeis guineensis
emb|CDX91708.1|  BnaC08g06270D                                          363   3e-121   
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             365   3e-121   Capsella rubella
emb|CDY66294.1|  BnaAnng22050D                                          365   3e-121   Brassica napus [oilseed rape]
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             365   4e-121   Populus trichocarpa [western balsam poplar]
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             365   4e-121   
emb|CDY25780.1|  BnaA07g10020D                                          362   5e-121   Brassica napus [oilseed rape]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          365   5e-121   
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             365   7e-121   
gb|AAK68842.1|  alanine aminotransferase-like protein                   361   9e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    364   1e-120   
emb|CDY41452.1|  BnaA08g20540D                                          364   1e-120   Brassica napus [oilseed rape]
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    363   3e-120   Brassica rapa
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    363   3e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          363   4e-120   Amborella trichopoda
gb|EPS68501.1|  hypothetical protein M569_06265                         363   4e-120   Genlisea aurea
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    362   5e-120   Camelina sativa [gold-of-pleasure]
gb|EMS58349.1|  Alanine aminotransferase 2                              362   8e-120   Triticum urartu
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    362   8e-120   Camelina sativa [gold-of-pleasure]
gb|AAL24255.1|  At1g23310/F26F24_4                                      362   9e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 362   9e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    362   9e-120   Camelina sativa [gold-of-pleasure]
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       361   1e-119   
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    362   1e-119   Camelina sativa [gold-of-pleasure]
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    360   5e-119   Nicotiana sylvestris
ref|NP_001058716.1|  Os07g0108300                                       360   5e-119   
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    359   7e-119   Nicotiana tomentosiformis
gb|AAO84040.1|  alanine aminotransferase                                360   8e-119   Oryza sativa Indica Group [Indian rice]
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    359   1e-118   Solanum lycopersicum
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    359   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    358   1e-118   Brassica rapa
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    358   3e-118   Setaria italica
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     354   7e-118   
emb|CDY12474.1|  BnaC07g13140D                                          359   7e-118   Brassica napus [oilseed rape]
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             357   7e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          357   8e-118   Arabidopsis lyrata subsp. lyrata
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    357   1e-117   Brachypodium distachyon [annual false brome]
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    356   2e-117   
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    355   3e-117   
ref|NP_001151209.1|  alanine aminotransferase 2                         354   7e-117   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    352   4e-116   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               352   5e-116   Zea mays [maize]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    350   2e-115   Cucumis melo [Oriental melon]
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    349   9e-115   Cucumis sativus [cucumbers]
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    342   5e-114   
gb|ABK25444.1|  unknown                                                 343   1e-112   Picea sitchensis
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    335   1e-110   Populus euphratica
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              338   2e-110   
gb|AFK42206.1|  unknown                                                 330   1e-109   Lotus japonicus
ref|XP_001763950.1|  predicted protein                                  306   4e-98    
ref|XP_001782822.1|  predicted protein                                  303   9e-97    
ref|XP_003613140.1|  Alanine aminotransferase                           299   2e-95    
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    286   2e-94    
ref|XP_001777071.1|  predicted protein                                  296   6e-94    
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              291   9e-93    Arabidopsis thaliana [mouse-ear cress]
gb|EMT29455.1|  Alanine aminotransferase 2                              290   2e-91    
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             288   6e-91    Selaginella moellendorffii
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    288   1e-90    
ref|XP_002527918.1|  alanine aminotransferase, putative                 275   2e-86    
gb|AAM22749.1|  alanine aminotransferase                                263   1e-85    Deschampsia antarctica
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    263   1e-85    
ref|XP_002947519.1|  alanine aminotransferase                           262   2e-80    Volvox carteri f. nagariensis
ref|XP_005651940.1|  alanine aminotransferase                           262   2e-80    Coccomyxa subellipsoidea C-169
ref|XP_001698518.1|  alanine aminotransferase                           255   8e-78    Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                253   3e-77    Chlamydomonas reinhardtii
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               248   2e-74    Nannochloropsis gaditana
gb|KIZ07569.1|  alanine transaminase                                    243   3e-72    Monoraphidium neglectum
emb|CDX91589.1|  BnaC02g15710D                                          224   1e-70    
ref|XP_003291733.1|  alanine transaminase                               236   2e-70    Dictyostelium purpureum
gb|EEE58449.1|  hypothetical protein OsJ_09677                          226   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004992298.1|  alanine aminotransferase                           232   2e-69    Salpingoeca rosetta
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              227   3e-69    
ref|NP_001060284.1|  Os07g0617800                                       227   4e-69    
gb|ETK83815.1|  hypothetical protein L915_11053                         221   2e-68    Phytophthora parasitica
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         229   2e-68    
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    228   4e-68    Oryza brachyantha
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              224   5e-68    
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    228   8e-68    Oryza brachyantha
gb|ETL37230.1|  hypothetical protein L916_10951                         219   1e-67    Phytophthora parasitica
dbj|BAC79866.1|  putative alanine aminotransferase                      227   2e-67    Oryza sativa Japonica Group [Japonica rice]
gb|AAV64199.1|  putative alanine aminotransferase                       228   2e-67    Zea mays [maize]
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              228   3e-67    Zea mays [maize]
gb|AAV64237.1|  putative alanine aminotransferase                       227   3e-67    Zea mays [maize]
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         226   4e-67    Oryza brachyantha
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            226   4e-67    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064504.1|  Os10g0390500                                       226   5e-67    
gb|EEE67593.1|  hypothetical protein OsJ_25140                          227   7e-67    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          227   7e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          227   8e-67    Sorghum bicolor [broomcorn]
gb|EEC74641.1|  hypothetical protein OsI_10280                          225   2e-66    Oryza sativa Indica Group [Indian rice]
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  223   9e-66    
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         224   1e-65    Phoenix dactylifera
gb|EXX69945.1|  alanine transaminase ALT1                               223   1e-65    Rhizophagus irregularis DAOM 197198w
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             222   1e-65    Guillardia theta CCMP2712
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              223   1e-65    Chlorella variabilis
gb|EFA80185.1|  alanine transaminase                                    224   2e-65    Heterostelium album PN500
gb|ETP13560.1|  hypothetical protein F441_11279                         222   2e-65    Phytophthora parasitica CJ01A1
gb|ETP41623.1|  hypothetical protein F442_11247                         222   2e-65    Phytophthora parasitica P10297
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    222   3e-65    Phytophthora parasitica INRA-310
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               223   3e-65    Acytostelium subglobosum LB1
ref|XP_002887430.1|  ALAAT2                                             223   3e-65    
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              220   1e-64    
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              220   1e-64    
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    219   2e-64    Auxenochlorella protothecoides
gb|ETI43749.1|  hypothetical protein F443_11362                         219   2e-64    Phytophthora parasitica P1569
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              220   2e-64    Phoenix dactylifera
ref|XP_002906656.1|  alanine aminotransferase 2                         219   4e-64    Phytophthora infestans T30-4
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    214   5e-64    
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    219   7e-64    Camelina sativa [gold-of-pleasure]
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              218   1e-63    Elaeis guineensis
gb|AAK59591.2|  putative alanine aminotransferase                       218   2e-63    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565040.2|  alanine aminotransferase 2                            218   2e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         218   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001185380.1|  alanine aminotransferase 2                         218   2e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    218   2e-63    Camelina sativa [gold-of-pleasure]
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              218   3e-63    Fragaria vesca subsp. vesca
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         217   3e-63    
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         216   4e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    216   4e-63    Acanthamoeba castellanii str. Neff
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   211   4e-63    Gossypium raimondii
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   211   4e-63    Gossypium raimondii
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             217   5e-63    Prunus persica
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    217   6e-63    Prunus mume [ume]
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    215   6e-63    Hordeum vulgare [barley]
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    216   7e-63    Cucumis melo [Oriental melon]
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      215   7e-63    Ectocarpus siliculosus
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    216   7e-63    Brachypodium distachyon [annual false brome]
emb|CCI42079.1|  unnamed protein product                                215   8e-63    Albugo candida
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    216   8e-63    
ref|XP_002499950.1|  alanine aminotransferase                           214   8e-63    Micromonas commoda
ref|XP_001745052.1|  hypothetical protein                               215   8e-63    Monosiga brevicollis MX1
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    215   8e-63    
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    215   9e-63    Solanum lycopersicum
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    215   9e-63    
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    215   9e-63    Hordeum vulgare [barley]
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       216   9e-63    Cucumis sativus [cucumbers]
ref|XP_002681562.1|  alanine aminotransferase                           215   1e-62    Naegleria gruberi strain NEG-M
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    216   1e-62    Cucumis melo [Oriental melon]
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    214   1e-62    Cucumis melo [Oriental melon]
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    214   2e-62    Solanum tuberosum [potatoes]
gb|KDD76740.1|  aminotransferase                                        214   2e-62    Helicosporidium sp. ATCC 50920
ref|XP_008869166.1|  hypothetical protein H310_06043                    214   2e-62    Aphanomyces invadans
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    214   2e-62    Elaeis guineensis
ref|NP_001086104.1|  alanine aminotransferase 2                         215   2e-62    Xenopus laevis [clawed frog]
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    215   2e-62    Camelina sativa [gold-of-pleasure]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    215   2e-62    Cicer arietinum [garbanzo]
ref|XP_010490704.1|  PREDICTED: glutamate--glyoxylate aminotransf...    205   3e-62    Camelina sativa [gold-of-pleasure]
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              213   4e-62    Brachypodium distachyon [annual false brome]
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    216   5e-62    Brachypodium distachyon [annual false brome]
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              214   5e-62    Sesamum indicum [beniseed]
gb|ADE77246.1|  unknown                                                 209   5e-62    Picea sitchensis
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    213   5e-62    Cucumis sativus [cucumbers]
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    213   5e-62    
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    213   7e-62    Elaeis guineensis
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         214   7e-62    Sesamum indicum [beniseed]
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               214   8e-62    Glycine soja [wild soybean]
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         211   8e-62    Falco cherrug
emb|CDJ93113.1|  Aminotransferase domain containing protein             213   8e-62    Haemonchus contortus [red stomach worm]
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    214   8e-62    Solanum tuberosum [potatoes]
ref|XP_637993.1|  alanine transaminase                                  213   8e-62    Dictyostelium discoideum AX4
ref|XP_001769989.1|  predicted protein                                  212   1e-61    
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             213   1e-61    
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                212   1e-61    Erythranthe guttata [common monkey flower]
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             213   1e-61    Citrus clementina [clementine]
ref|XP_006828623.1|  hypothetical protein AMTR_s00129p00080070          210   1e-61    
ref|XP_010096539.1|  Alanine aminotransferase 2                         213   1e-61    Morus notabilis
ref|XP_004356702.1|  alanine aminotransferase, mitochondrial, put...    211   1e-61    Acanthamoeba castellanii str. Neff
ref|XP_007024768.1|  Alanine aminotransferase 2                         213   1e-61    
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    211   2e-61    Gossypium arboreum [tree cotton]
gb|AIT69922.1|  alanine transaminase                                    212   2e-61    Sargassum fusiforme
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         210   2e-61    
gb|EIE85592.1|  hypothetical protein RO3G_10302                         211   2e-61    Rhizopus delemar RA 99-880
ref|XP_003627448.1|  Alanine aminotransferase                           212   2e-61    Medicago truncatula
gb|AET06148.1|  PLP-dependent aminotransferase                          211   2e-61    Papaver somniferum
ref|XP_008620886.1|  alanine transaminase                               211   2e-61    Saprolegnia diclina VS20
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             211   3e-61    Phytophthora sojae
gb|ETK88933.1|  hypothetical protein L915_06890                         205   3e-61    Phytophthora parasitica
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    211   3e-61    
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    212   3e-61    Citrus sinensis [apfelsine]
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   212   3e-61    Citrus sinensis [apfelsine]
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             212   3e-61    Capsella rubella
ref|XP_004345426.2|  alanine aminotransferase                           211   4e-61    Capsaspora owczarzaki ATCC 30864
gb|EMT23015.1|  Alanine aminotransferase 2                              211   4e-61    
gb|ETL42327.1|  hypothetical protein L916_06840                         202   4e-61    Phytophthora parasitica
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    211   4e-61    
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              212   4e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    211   5e-61    
ref|XP_009826737.1|  hypothetical protein H257_04062                    210   6e-61    Aphanomyces astaci
emb|CCA27196.1|  unnamed protein product                                211   6e-61    Albugo laibachii Nc14
gb|EMS46317.1|  Alanine aminotransferase 2                              211   6e-61    Triticum urartu
gb|KDO24164.1|  hypothetical protein SPRG_10592                         210   7e-61    Saprolegnia parasitica CBS 223.65
gb|EPS60556.1|  hypothetical protein M569_14246                         210   8e-61    Genlisea aurea
gb|KJE95383.1|  alanine aminotransferase                                211   8e-61    Capsaspora owczarzaki ATCC 30864
gb|ACJ85860.1|  unknown                                                 211   9e-61    Medicago truncatula
emb|CEI91975.1|  Putative Alanine transaminase                          209   2e-60    Rhizopus microsporus
gb|KDE04574.1|  hypothetical protein MVLG_05042                         211   2e-60    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|AIT69930.1|  alanine transaminase                                    209   2e-60    Sargassum hemiphyllum var. chinense
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         210   3e-60    
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              203   3e-60    
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             209   4e-60    Phaseolus vulgaris [French bean]
emb|CDJ93112.1|  Aminotransferase domain containing protein             206   5e-60    Haemonchus contortus [red stomach worm]
gb|ABK93875.1|  unknown                                                 199   6e-60    Populus trichocarpa [western balsam poplar]
emb|CEG73189.1|  Putative Alanine transaminase                          207   6e-60    Rhizopus microsporus
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603             207   7e-60    Phytophthora sojae
gb|KFH70378.1|  alanine transaminase                                    207   7e-60    Mortierella verticillata NRRL 6337
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         206   9e-60    Cuculus canorus
gb|AFK39904.1|  unknown                                                 208   9e-60    Medicago truncatula
gb|ETI43741.1|  hypothetical protein F443_11357                         207   1e-59    Phytophthora parasitica P1569
gb|ADB91976.1|  alanine aminotransferase                                207   1e-59    Branchiostoma belcheri
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              207   1e-59    Eptesicus fuscus
emb|CEF68484.1|  Alanine aminotransferase 1                             206   1e-59    Strongyloides ratti
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         206   1e-59    
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    206   1e-59    
gb|KFO75258.1|  Alanine aminotransferase 2                              205   2e-59    Cuculus canorus
gb|AIT69931.1|  alanine transaminase                                    206   2e-59    Sargassum thunbergii
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              206   2e-59    Ochotona princeps [southern American pika]
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...    206   2e-59    Elaeis guineensis
emb|CEP13768.1|  hypothetical protein                                   206   2e-59    Parasitella parasitica
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2              207   3e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...    206   3e-59    Elaeis guineensis
ref|XP_005514471.1|  PREDICTED: alanine aminotransferase 2-like         204   3e-59    
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2              207   3e-59    Nicotiana tomentosiformis
gb|EMT05433.1|  Alanine aminotransferase 2                              206   3e-59    
ref|XP_005775483.1|  alanine aminotransferase                           207   3e-59    
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         206   3e-59    
ref|NP_001016805.1|  alanine aminotransferase 2                         206   3e-59    
gb|ETP13552.1|  hypothetical protein F441_11274                         206   3e-59    
gb|EPB88721.1|  alanine transaminase                                    206   3e-59    
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    206   3e-59    
emb|CEG73120.1|  Putative Alanine transaminase                          206   4e-59    
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg             207   4e-59    
gb|EMC77259.1|  Alanine aminotransferase 2                              204   4e-59    
emb|CDO97792.1|  unnamed protein product                                205   4e-59    
ref|XP_003055208.1|  predicted protein                                  205   5e-59    
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...    206   5e-59    
ref|XP_002826439.1|  PREDICTED: alanine aminotransferase 2              197   5e-59    
gb|AIT69921.1|  alanine transaminase                                    205   5e-59    
emb|CEG73119.1|  Putative Alanine transaminase                          206   5e-59    
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    206   5e-59    
gb|EMS62762.1|  Alanine aminotransferase 2                              206   6e-59    
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    199   6e-59    
ref|XP_006105500.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    205   6e-59    
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318              205   7e-59    
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...    206   7e-59    
gb|AIT69918.1|  alanine transaminase                                    205   7e-59    
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like         206   8e-59    
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         205   8e-59    
ref|NP_001237553.1|  alanine aminotransferase 1                         204   8e-59    
emb|CEI94294.1|  Putative Alanine transaminase                          205   8e-59    
emb|CEG76882.1|  Putative Alanine transaminase                          205   8e-59    
gb|AHJ25706.1|  GPT2                                                    197   9e-59    
gb|KFK41654.1|  hypothetical protein AALP_AA2G155600                    206   1e-58    
ref|XP_004400797.1|  PREDICTED: alanine aminotransferase 1              204   1e-58    
ref|XP_009899311.1|  PREDICTED: alanine aminotransferase 1              202   2e-58    
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    202   2e-58    
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...    203   2e-58    
dbj|GAN09782.1|  alanine transaminase                                   204   2e-58    
gb|AGV14561.1|  alanine transaminase, variant                           203   2e-58    
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              199   3e-58    
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...    203   3e-58    
gb|AAR05449.1|  alanine aminotransferase                                203   3e-58    
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...    204   3e-58    
gb|KFV67752.1|  Alanine aminotransferase 2                              202   3e-58    
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              201   3e-58    
gb|AFR96660.1|  alanine transaminase                                    203   3e-58    
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    202   4e-58    
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2              203   4e-58    
emb|CEI89079.1|  Putative Alanine transaminase                          203   4e-58    
ref|XP_011226825.1|  PREDICTED: alanine aminotransferase 1 isofor...    203   4e-58    
emb|CEI89078.1|  Putative Alanine transaminase                          203   5e-58    
ref|XP_010015482.1|  PREDICTED: alanine aminotransferase 2              201   5e-58    
gb|AIT69926.1|  alanine transaminase                                    203   5e-58    
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              202   5e-58    
ref|XP_006186085.1|  PREDICTED: alanine aminotransferase 1              201   5e-58    
gb|AFW68849.1|  hypothetical protein ZEAMMB73_492015                    194   5e-58    
gb|KFR15864.1|  Alanine aminotransferase 2                              201   5e-58    
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    202   5e-58    
gb|AIT69919.1|  alanine transaminase                                    202   5e-58    
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         200   5e-58    
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              201   5e-58    
emb|CBK19835.2|  Alanine aminotransferase 2                             202   5e-58    
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    199   5e-58    
ref|XP_010628764.1|  PREDICTED: alanine aminotransferase 1              202   5e-58    
gb|AIT69941.1|  alanine transaminase                                    202   5e-58    
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              201   6e-58    
emb|CDS14202.1|  hypothetical protein LRAMOSA06372                      203   6e-58    
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    203   6e-58    
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     202   6e-58    
gb|KFP35282.1|  Alanine aminotransferase 2                              201   6e-58    
gb|KFV00293.1|  Alanine aminotransferase 2                              198   6e-58    
gb|KHN77825.1|  Alanine aminotransferase 1                              203   7e-58    
ref|XP_009976045.1|  PREDICTED: alanine aminotransferase 2              201   7e-58    
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              201   7e-58    
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              198   7e-58    
gb|KFQ52041.1|  Alanine aminotransferase 2                              201   7e-58    
ref|XP_010193171.1|  PREDICTED: alanine aminotransferase 2              201   7e-58    
gb|AIT69916.1|  alanine transaminase                                    202   8e-58    
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              200   8e-58    
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              200   9e-58    
dbj|BAK07780.1|  predicted protein                                      203   9e-58    
gb|KFZ65228.1|  Alanine aminotransferase 2                              200   9e-58    
gb|AIT69935.1|  alanine transaminase                                    202   1e-57    
ref|XP_009274977.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
gb|KFQ20610.1|  Alanine aminotransferase 2                              201   1e-57    
gb|EYC32543.1|  hypothetical protein Y032_0003g1641                     202   1e-57    
gb|KFP49490.1|  Alanine aminotransferase 2                              199   1e-57    
ref|XP_004779455.1|  PREDICTED: alanine aminotransferase 1 isofor...    202   1e-57    
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              202   1e-57    
gb|KFU99477.1|  Alanine aminotransferase 2                              200   1e-57    
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         203   1e-57    
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              201   1e-57    
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    201   1e-57    
ref|XP_009487594.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_009920931.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              201   1e-57    
ref|XP_010959534.1|  PREDICTED: alanine aminotransferase 1              201   1e-57    
ref|XP_009816631.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    202   1e-57    
ref|XP_009571057.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              201   1e-57    
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_005233896.1|  PREDICTED: alanine aminotransferase 2              200   1e-57    
ref|XP_008903570.1|  hypothetical protein PPTG_10079                    201   1e-57    
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              199   1e-57    
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              199   2e-57    
gb|KFQ54613.1|  Alanine aminotransferase 2                              200   2e-57    
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              201   2e-57    
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              201   2e-57    
gb|KFP59082.1|  Alanine aminotransferase 2                              200   2e-57    
ref|XP_004779454.1|  PREDICTED: alanine aminotransferase 1 isofor...    202   2e-57    
ref|XP_006908800.1|  PREDICTED: alanine aminotransferase 2              199   2e-57    
gb|KFQ69505.1|  Alanine aminotransferase 2                              200   2e-57    
ref|XP_571848.1|  transaminase                                          202   2e-57    
ref|XP_011226824.1|  PREDICTED: alanine aminotransferase 1 isofor...    203   2e-57    
ref|XP_004826063.1|  PREDICTED: alanine aminotransferase 1 isofor...    201   2e-57    
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              202   2e-57    
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    202   2e-57    
gb|KFV58998.1|  Alanine aminotransferase 2                              200   2e-57    
gb|KFP94695.1|  Alanine aminotransferase 2                              200   2e-57    
gb|KFO93213.1|  Alanine aminotransferase 2                              200   2e-57    
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    201   2e-57    
gb|KFQ05762.1|  Alanine aminotransferase 2                              200   2e-57    
gb|KFZ58051.1|  Alanine aminotransferase 2                              200   2e-57    
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553             201   2e-57    
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1              199   2e-57    
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2              202   2e-57    
ref|XP_001490415.3|  PREDICTED: alanine aminotransferase 2 isofor...    202   2e-57    
gb|ETN63742.1|  alanine aminotransferase                                201   2e-57    
gb|AIT69932.1|  alanine transaminase                                    201   2e-57    
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              200   2e-57    
gb|KIY92376.1|  hypothetical protein MNEG_15586                         191   2e-57    
ref|XP_005395954.1|  PREDICTED: alanine aminotransferase 1              201   2e-57    
ref|XP_010309159.1|  PREDICTED: alanine aminotransferase 2              199   2e-57    
ref|XP_008936281.1|  PREDICTED: alanine aminotransferase 2              199   2e-57    
ref|XP_007516096.1|  PREDICTED: alanine aminotransferase 1              201   2e-57    
gb|KGB32667.1|  Alanine aminotransferase 2                              201   2e-57    
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    200   2e-57    
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    201   2e-57    
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    200   2e-57    
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              199   3e-57    
gb|KFQ16813.1|  Alanine aminotransferase 2                              199   3e-57    
emb|CDX81815.1|  BnaC08g37860D                                          202   3e-57    
ref|XP_006390672.1|  hypothetical protein EUTSA_v10019459mg             202   3e-57    
gb|KFO06425.1|  Alanine aminotransferase 2                              199   3e-57    
ref|XP_009676627.1|  PREDICTED: alanine aminotransferase 2              199   3e-57    
gb|AFK36743.1|  unknown                                                 191   3e-57    
gb|KFQ82063.1|  Alanine aminotransferase 2                              199   3e-57    
ref|XP_005318527.1|  PREDICTED: alanine aminotransferase 2              199   3e-57    
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    200   3e-57    
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...    200   4e-57    
gb|AIT69936.1|  alanine transaminase                                    200   4e-57    
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2              200   4e-57    
sp|P34106.1|ALA2_PANMI  RecName: Full=Alanine aminotransferase 2;...    200   4e-57    
ref|XP_009636322.1|  PREDICTED: alanine aminotransferase 2              199   4e-57    
ref|XP_007439806.1|  PREDICTED: alanine aminotransferase 2              199   4e-57    
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              200   4e-57    
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2              201   4e-57    
emb|CDH53092.1|  alanine transaminase                                   201   4e-57    
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...    201   4e-57    
dbj|BAN21041.1|  alanine aminotransferase                               201   4e-57    
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...    201   4e-57    
ref|XP_009265680.1|  hypothetical protein J056_000007                   200   4e-57    
gb|KFO63157.1|  Alanine aminotransferase 2                              201   4e-57    
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    201   4e-57    
gb|AIT69923.1|  alanine transaminase                                    200   5e-57    
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    198   5e-57    
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              199   5e-57    
gb|EIE90509.1|  hypothetical protein RO3G_15220                         199   5e-57    
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2              201   5e-57    
ref|XP_004443056.1|  PREDICTED: alanine aminotransferase 1              200   5e-57    
gb|AIT69928.1|  alanine transaminase                                    200   5e-57    
ref|XP_004362319.1|  alanine transaminase                               201   5e-57    
ref|XP_009088853.1|  PREDICTED: alanine aminotransferase 2              198   5e-57    
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              199   5e-57    
gb|KFP15258.1|  Alanine aminotransferase 2                              199   6e-57    
gb|KFV83100.1|  Alanine aminotransferase 2                              200   6e-57    
ref|XP_005401470.1|  PREDICTED: alanine aminotransferase 2-like i...    199   6e-57    
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g             199   6e-57    
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              201   6e-57    
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    200   6e-57    
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...    201   6e-57    
ref|XP_010842208.1|  PREDICTED: alanine aminotransferase 2              198   6e-57    
gb|AIT69940.1|  alanine transaminase                                    199   7e-57    
gb|KFW64540.1|  Alanine aminotransferase 2                              201   7e-57    
gb|KFM05788.1|  Alanine aminotransferase 2                              201   7e-57    
ref|XP_004983099.1|  PREDICTED: alanine aminotransferase 2-like         199   7e-57    
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    199   7e-57    
gb|AIT69942.1|  alanine transaminase                                    199   7e-57    
ref|XP_004324928.1|  PREDICTED: alanine aminotransferase 2              198   7e-57    
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2              199   7e-57    
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    200   7e-57    
emb|CBJ31990.1|  Alanine transaminase                                   200   7e-57    
ref|XP_006261713.1|  PREDICTED: alanine aminotransferase 2              198   7e-57    
gb|KIR99100.1|  alanine transaminase                                    200   7e-57    
gb|EMP35918.1|  Alanine aminotransferase 2                              200   8e-57    
gb|KFO69634.1|  Alanine aminotransferase 2                              199   8e-57    
gb|KIR88856.1|  alanine transaminase                                    200   8e-57    
ref|XP_008560719.1|  PREDICTED: alanine aminotransferase 1              201   8e-57    
gb|ENN78579.1|  hypothetical protein YQE_04947                          200   8e-57    
ref|XP_005062449.1|  PREDICTED: alanine aminotransferase 2-like i...    199   8e-57    
ref|XP_003463744.1|  PREDICTED: alanine aminotransferase 1 isofor...    199   8e-57    
ref|NP_001012057.1|  alanine aminotransferase 2                         200   8e-57    
ref|XP_010199869.1|  PREDICTED: alanine aminotransferase 2              197   9e-57    
gb|KGB76334.1|  transaminase                                            200   9e-57    
emb|CCD81366.1|  putative alanine aminotransferase                      199   9e-57    
gb|KIR49354.1|  alanine transaminase                                    200   9e-57    
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like         200   9e-57    
gb|AIT69929.1|  alanine transaminase                                    199   9e-57    
ref|XP_010221695.1|  PREDICTED: alanine aminotransferase 2              197   9e-57    
ref|XP_005613478.1|  PREDICTED: alanine aminotransferase 1              197   9e-57    
ref|XP_006172385.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...    197   9e-57    
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    200   1e-56    
ref|XP_008654837.1|  PREDICTED: uncharacterized protein LOC100193...    199   1e-56    
gb|KFQ95766.1|  Alanine aminotransferase 2                              200   1e-56    
gb|AIT69924.1|  alanine transaminase                                    199   1e-56    
ref|XP_002906651.1|  alanine aminotransferase 2                         199   1e-56    
gb|KFP06658.1|  Alanine aminotransferase 2                              200   1e-56    
ref|XP_010812871.1|  PREDICTED: alanine aminotransferase 2 isofor...    197   1e-56    
ref|XP_005401469.1|  PREDICTED: alanine aminotransferase 2-like i...    198   1e-56    
gb|KFP31561.1|  Alanine aminotransferase 2                              198   1e-56    
gb|KIR54768.1|  alanine transaminase                                    199   1e-56    



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   385 bits (990),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  42   SFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  101

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AIE 
Sbjct  102  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIEA  161

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  162  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKF  221

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM++YEDHRGYSRM
Sbjct  222  NDSFMEEYEDHRGYSRM  238



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   394 bits (1012),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASISLSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIET
Sbjct  345  GDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  LGKAPDV YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  ANKLGKAPDVLYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM++YEDH+GYSRM
Sbjct  465  NDEFMEKYEDHKGYSRM  481



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   393 bits (1009),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASISLSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQ+VRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET
Sbjct  345  GDISYDQYVRESKGILESLRRRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  LGKA DV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  ANKLGKAADVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM++YEDH+GYSRM
Sbjct  465  NDEFMEKYEDHKGYSRM  481



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  264  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  323

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  324  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  383

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  384  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  443

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM++YEDHRGYSRM
Sbjct  444  NDSFMEEYEDHRGYSRM  460



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFMDQYED RGYSRM
Sbjct  465  NDEFMDQYEDQRGYSRM  481



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   387 bits (994),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  345  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM++YEDHRGYSRM
Sbjct  465  NDSFMEEYEDHRGYSRM  481



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASIALSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QFVRESKGILESLRKRARIMTDGFN+CRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFVRESKGILESLRKRARIMTDGFNNCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   385 bits (990),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            N+EFMDQYED RGYSRM
Sbjct  465  NNEFMDQYEDQRGYSRM  481



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   385 bits (990),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRE KGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYDQFVREGKGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKF
Sbjct  405  AKRLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDH GYSRM
Sbjct  465  NDEFMEQYEDHTGYSRM  481



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   385 bits (988),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASIALSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QFVRESKGILESLR+RARIMTDGFN+CRN+VCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFVRESKGILESLRRRARIMTDGFNNCRNIVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKV SI+LSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVVSIALSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF+RESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFMDQYED RGYSRM
Sbjct  465  NDEFMDQYEDRRGYSRM  481



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASIALSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+++VRESK +LESLRKRA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYERYVRESKAVLESLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDH+GYSRM
Sbjct  465  NDEFMEQYEDHKGYSRM  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   384 bits (986),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASI+LSPNVP QIF+GLMVNPPKP
Sbjct  284  SFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASIALSPNVPAQIFMGLMVNPPKP  343

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY++F+RESKGILESLR+RA++MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  344  GDISYERFIRESKGILESLRRRAQLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  403

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  404  AQKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  463

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDH+GYSRM
Sbjct  464  NDEFMEQYEDHKGYSRM  480



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP +V+EIYKV+SISLSPNVP QIFLGLMVNPP+P
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPETVDEIYKVSSISLSPNVPAQIFLGLMVNPPRP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+Q+VRESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYEQYVRESKGILESLRRRASIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGMFHLRTTILPAEEDMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP P
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP KP
Sbjct  267  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPLKP  326

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  327  GDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  386

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKF
Sbjct  387  AKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKF  446

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSRM
Sbjct  447  NDEFMEQYEDYRGYSRM  463



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP P
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIFLGLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFLGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +FV ESK IL+SLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLKFVTESKAILDSLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKNAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   380 bits (976),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  345  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM++YED  GYSRM
Sbjct  465  NDSFMEEYEDXWGYSRM  481



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP P
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE MPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEXMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   378 bits (970),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS++LSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHSVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASVALSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ 
Sbjct  345  GDISYDQFARESKEILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQK+GVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKSAGKVPDVFYCLKLLEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            N+EFM+QYED RGYSRM
Sbjct  465  NNEFMEQYEDDRGYSRM  481



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   378 bits (970),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIP  SV+EIYKVASISLSPNVPGQIFLGLMVNPPKP
Sbjct  284  SFHTVSKGYWGECGQRGGYFEMTNIPAESVDEIYKVASISLSPNVPGQIFLGLMVNPPKP  343

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +FV+ESK ILESLRKRA IMT+GFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  344  GDISYQKFVQESKTILESLRKRAHIMTNGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEV  403

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  404  AKMAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  463

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QYED RGYSRM
Sbjct  464  NDAFMEQYEDQRGYSRM  480



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   378 bits (970),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QI +G+MV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQILMGMMVDPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD +VRESKGI+ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ 
Sbjct  345  GDISYDLYVRESKGIIESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   377 bits (969),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASISLSPNVP QIF+GLMVNP KP
Sbjct  282  SFHTVSKGYWGECGQRGGYFEMTNISPKTVEEIYKVASISLSPNVPAQIFMGLMVNPLKP  341

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+++VRESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  342  GDISYERYVRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  401

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  402  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  461

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYEDHRGYSRM
Sbjct  462  NDEFMEQYEDHRGYSRM  478



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   377 bits (969),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLM+NPPKP
Sbjct  285  SFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMINPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ET
Sbjct  345  GDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKF
Sbjct  405  AKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND+FM+QY+DHRGYSR+
Sbjct  465  NDDFMEQYDDHRGYSRL  481



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKAVDEIYKVASVSLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF+RESKGILESLR+RAR+MTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  345  GDISYEQFIRESKGILESLRRRARMMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKF
Sbjct  405  AKMAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYE H GYSR+
Sbjct  465  NDEFMEQYEGHGGYSRL  481



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   375 bits (962),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP P
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  179  NDEFMDQYEDHRG  141
            NDEFM+QYEDHRG
Sbjct  465  NDEFMEQYEDHRG  477



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M+NPP+P
Sbjct  285  SFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLNPPQP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+FVRES GILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  345  GDISYDKFVRESTGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKF
Sbjct  405  AKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED RGYSR+
Sbjct  465  NDEFMEQYEDDRGYSRL  481



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   373 bits (957),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIP  SV+EIYK+ASI+LSPNVPGQIFLGLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPQESVDEIYKIASIALSPNVPGQIFLGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY ++ +ESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE 
Sbjct  345  GDISYLRYEQESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIED  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFH+RTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKKAGKHPDVFYCLKLLEATGISTVPGSGFGQKEGVFHMRTTILPAEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QYEDHRGYSRM
Sbjct  465  NDAFMEQYEDHRGYSRM  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   373 bits (957),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYGDNFGYSRM  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   373 bits (957),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYGDNFGYSRM  481



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   374 bits (959),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  313  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  372

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  373  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  432

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  433  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  492

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  493  NDEFMSQYGDNFGYSRM  509



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIP ++V+EIYKVAS+SLSPNVPGQIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKVASVSLSPNVPGQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +FV ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLRFVAESTAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKSAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   372 bits (955),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNVP QIF+GLMV+PP P
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVPAQIFMGLMVSPPNP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF+RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPARAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  ARQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYED+ GYSRM
Sbjct  465  NDEFMSQYEDNFGYSRM  481



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   370 bits (951),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++PP+P
Sbjct  285  SFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHPPQP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  345  GDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKF
Sbjct  405  AKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED RGYSR+
Sbjct  465  NDEFMEQYEDDRGYSRL  481



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   370 bits (950),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVAS+SLSPNVPGQIFLGLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDIS+ +FV ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE 
Sbjct  345  GDISHLKFVVESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKF
Sbjct  405  AKKVGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED RGYSRM
Sbjct  465  NDEFMEQYEDCRGYSRM  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   370 bits (950),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+P ++V+EIYKVASISLSPNVPGQIFLGLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPSQTVDEIYKVASISLSPNVPGQIFLGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +FV+ESK +LESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLKFVQESKAVLESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KF
Sbjct  405  ARKAGKAPDVFYCLGLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFRKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYE+ RGYSRM
Sbjct  465  NDEFMEQYENCRGYSRM  481



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE 
Sbjct  345  GDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYED+   SRM
Sbjct  465  NDEFMAQYEDNWNRSRM  481



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEM NI P +V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHSVSKGYYGECGQRGGYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ET
Sbjct  345  GDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKF
Sbjct  405  AKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND+FM+QYEDHRGYSR+
Sbjct  465  NDDFMEQYEDHRGYSRL  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+P ++V+EIYKVAS+SLSPNVPGQIFLGLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPAKTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLRFAAESNAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKL+EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKF
Sbjct  405  AKRAGKAPDVFYCLKLVEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D  GYSRM
Sbjct  465  NDEFMSQYGDSFGYSRM  481



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M+NP KP
Sbjct  285  SFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMINPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYDQFVRESNGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFK F
Sbjct  405  AKQAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKNF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSR+
Sbjct  465  NDEFMEQYEDNRGYSRL  481



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KP
Sbjct  299  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKP  358

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE 
Sbjct  359  GDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEA  418

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  419  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  478

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYED+   SRM
Sbjct  479  NDEFMAQYEDNWNRSRM  495



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+SYDQ+VRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI LPP+AIE 
Sbjct  345  GDVSYDQYVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIHLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYED+  +SRM
Sbjct  465  NDEFMAQYEDNWNHSRM  481



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++PP+P
Sbjct  285  SFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHPPQP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  345  GDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSR+
Sbjct  465  NDEFMEQYEDNRGYSRL  481



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYADNFGYSRM  481



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYADNFGYSRM  481



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   361 bits (927),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  102  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKP  161

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ 
Sbjct  162  GDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDV  221

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  222  AKSAGKEPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  281

Query  179  NDEFMDQYEDH  147
            ND FMDQY+DH
Sbjct  282  NDSFMDQYQDH  292



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   367 bits (942),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASISLSPNVPGQIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNISPQTVEEIYKVASISLSPNVPGQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+++VRESKGILESLR+RARIMTDGFN CRNVVCNFTEGAMYSFPQIRLP + +E 
Sbjct  345  GDISYERYVRESKGILESLRRRARIMTDGFNCCRNVVCNFTEGAMYSFPQIRLPLKVMEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+ GYSRM
Sbjct  465  NDEFMEQYEDNGGYSRM  481



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  282  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  341

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  342  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  401

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYE+  GYSRM
Sbjct  462  NDEFMAQYENGFGYSRM  478



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            N+EFM+QY+D  GYSR+
Sbjct  465  NNEFMEQYDDRSGYSRL  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++PP+P
Sbjct  284  SFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHPPQP  343

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  344  GDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  403

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   K PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKF
Sbjct  404  AKQAAKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKF  463

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSR+
Sbjct  464  NDEFMEQYEDNRGYSRL  480



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  145  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  204

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPPRAIE+
Sbjct  205  GDFSYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPRAIES  264

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  265  AKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKF  324

Query  179  NDEFMDQY  156
            ND FM++Y
Sbjct  325  NDAFMEEY  332



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEI+KVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIHKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYADNFGYSRM  481



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+P ++V+EIYKVAS+SLSPNVPGQIFLGLMVNPPK 
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPSQTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKA  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY + V+ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP +AIE 
Sbjct  345  GDISYLKLVQESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPLKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKLLEATGI+TVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KF
Sbjct  405  ARKAGKAPDVFYCLKLLEATGIATVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFRKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   363 bits (931),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  207  SFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  266

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  267  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  326

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  327  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  386

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYE+  GYSRM
Sbjct  387  NDEFMAQYENGFGYSRM  403



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYSRM
Sbjct  465  NDEFMTQYDNNVGYSRM  481



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPK 
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKS  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRES+GILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESEGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            N EFM QY D+ GYSRM
Sbjct  465  NHEFMSQYGDNFGYSRM  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GNISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            N+EFM+QY+D  GYSR+
Sbjct  465  NNEFMEQYDDRSGYSRL  481



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+ EEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTAEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMGSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYGDNFGYSRM  481



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   362 bits (930),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  207  SFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  266

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  267  GDISYDQFTRESKGILESLRRRANIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  326

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLE TGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  327  AKQAGKVPDVFYCLKLLETTGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  386

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYSRM
Sbjct  387  NDEFMTQYDNNFGYSRM  403



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QI +GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQILMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP AI+ 
Sbjct  345  GDISYDQFARESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYSRM
Sbjct  465  NDEFMTQYDNNVGYSRM  481



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   365 bits (936),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  282  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  341

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  342  GDISYDQFSRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  401

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYSRM
Sbjct  462  NDEFMTQYDNNFGYSRM  478



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   361 bits (926),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  183  SFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  242

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  243  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  302

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  303  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  362

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYS+M
Sbjct  363  NDEFMTQYDNNFGYSKM  379



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK++SISLSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKISSISLSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+Q+VRESKGIL+SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP+A+E 
Sbjct  345  GDISYEQYVRESKGILDSLRRRAWIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPKAVEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYED+  +SRM
Sbjct  465  NDEFMEQYEDNWSHSRM  481



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  282  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  341

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  342  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  401

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY++  GYSRM
Sbjct  462  NDEFMAQYDNGFGYSRM  478



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  282  SFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  341

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP A++ 
Sbjct  342  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPGALQA  401

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QYE+  GYSRM
Sbjct  462  NDEFMTQYENSFGYSRM  478



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 2/197 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY    GYSRM
Sbjct  465  NDEFMSQY--GVGYSRM  479



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   363 bits (931),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+HTVSKGYWGECGQRGGYFEMTN+ P +V+E+YK++SISLSPNVP QIF+GLMVNPPKP
Sbjct  285  SYHTVSKGYWGECGQRGGYFEMTNLSPETVDEMYKISSISLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDIS+ +F  ESK ILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISFMRFAAESKEILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE+DMP IM SFKKF
Sbjct  405  AKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEQDMPEIMASFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QYE HRGYSRM
Sbjct  465  NDEFMEQYEHHRGYSRM  481



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   363 bits (931),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 184/199 (92%), Gaps = 2/199 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNI P +V+EIYKV+SI+LSPNVP QIF+GLMVNPPKP
Sbjct  283  SFHTVSKGYWGECGQRGGYFEMTNISPETVDEIYKVSSIALSPNVPAQIFMGLMVNPPKP  342

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+F+ ESKGILESLR+RARIMTDGFNSCRN+VCNFTEGAMYSFPQI+LP RAIE 
Sbjct  343  GDISYDKFITESKGILESLRRRARIMTDGFNSCRNIVCNFTEGAMYSFPQIQLPARAIEA  402

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  403  ANRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKF  462

Query  179  NDEFMDQYED--HRGYSRM  129
            ND+FMDQYE+  H+ YSRM
Sbjct  463  NDDFMDQYEEDHHKAYSRM  481



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY++  GYSRM
Sbjct  465  NDEFMTQYDNTVGYSRM  481



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   362 bits (929),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ 
Sbjct  345  GDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDV  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  464

Query  179  NDEFMDQYEDH  147
            ND FM+QY+DH
Sbjct  465  NDSFMEQYQDH  475



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   362 bits (929),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 185/197 (94%), Gaps = 2/197 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY    GYSRM
Sbjct  465  NDEFMSQY--GVGYSRM  479



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   362 bits (929),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYS+M
Sbjct  465  NDEFMTQYDNNFGYSKM  481



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   362 bits (929),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYS+M
Sbjct  465  NDEFMTQYDNNFGYSKM  481



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   362 bits (929),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NV CNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVACNFTEGAMYSFPQIRLPAGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYSRM
Sbjct  465  NDEFMTQYDNNVGYSRM  481



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAIE 
Sbjct  345  GDISYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  464

Query  179  NDEFMDQY  156
            ND FM++Y
Sbjct  465  NDAFMEEY  472



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND+FM QY+++ GYSRM
Sbjct  465  NDDFMTQYDNNFGYSRM  481



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   360 bits (923),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGLM NPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLMANPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RA IMT GFNSCRNV+CNFTEGAMYSFPQI+LP  AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRAHIMTGGFNSCRNVLCNFTEGAMYSFPQIQLPRGAIDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKF
Sbjct  405  AKKLGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKF  464

Query  179  NDEFMDQYE  153
            ND+FM QYE
Sbjct  465  NDDFMKQYE  473



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   360 bits (924),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  292  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKP  351

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  352  GDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDA  411

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  412  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKF  471

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FMDQY+   GYSRM
Sbjct  472  NDTFMDQYD---GYSRM  485



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGLM NPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLMANPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQFVRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQI+LP   I+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRAHLMTDGFNSCRNVVCNFTEGAMYSFPQIQLPRGVIDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ LGK PDV+YC+KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKF
Sbjct  405  AKKLGKTPDVFYCIKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKF  464

Query  179  NDEFMDQYE  153
            ND+FM+QYE
Sbjct  465  NDDFMEQYE  473



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   360 bits (923),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  291  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKP  350

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  351  GDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDA  410

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  411  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKF  470

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FMDQY+   GYSRM
Sbjct  471  NDTFMDQYD---GYSRM  484



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGL+ NPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLLANPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAI+ 
Sbjct  345  GDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP+IM SFKKF
Sbjct  405  AKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPSIMASFKKF  464

Query  179  NDEFMDQYE  153
            NDEFM +YE
Sbjct  465  NDEFMARYE  473



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 184/197 (93%), Gaps = 2/197 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY QFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYAQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND+FM QY    GYSRM
Sbjct  465  NDDFMSQY--GVGYSRM  479



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  282  SFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  341

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI LPP A++ 
Sbjct  342  GDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQILLPPGALQA  401

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEA GISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEAAGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM QY+++ GYSRM
Sbjct  462  NDAFMTQYDNNFGYSRM  478



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 182/197 (92%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK IL+SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLKFAAESKSILDSLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFK F
Sbjct  405  AKRAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKNF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM QYE   GYSRM
Sbjct  465  NDSFMAQYE---GYSRM  478



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 182/197 (92%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKP
Sbjct  206  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGVMVNPPKP  265

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  266  GDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  325

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKF
Sbjct  326  ARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKF  385

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QYE   GYSR+
Sbjct  386  NDSFMEQYE---GYSRL  399



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   359 bits (921),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+ PKP
Sbjct  341  SFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSSPKP  400

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+N VCNFTEGAMYSFPQI+LPP A++ 
Sbjct  401  GDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNAVCNFTEGAMYSFPQIQLPPGALQA  460

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  461  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  520

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYSRM
Sbjct  521  NDEFMTQYDNNFGYSRM  537



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   357 bits (916),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVV NFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVRNFTEGAMYSFPQIRLPTGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM QY+++ GYS+M
Sbjct  465  NDEFMTQYDNNFGYSKM  481



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDIS+DQFV ESK ILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AIE 
Sbjct  345  GDISHDQFVCESKRILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  179  NDEFMDQYEDHR-GYSRM  129
            NDEFM QY D+  GYSRM
Sbjct  465  NDEFMSQYGDNNFGYSRM  482



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 184/197 (93%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLM+NPPKP
Sbjct  286  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMMNPPKP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP RAI+T
Sbjct  346  GDISYLKFATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSFPQIRLPKRAIDT  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  406  AKSAGKEPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  465

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QY+D   YSR+
Sbjct  466  NDSFMEQYQD---YSRL  479



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 183/200 (92%), Gaps = 3/200 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  295  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKP  354

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLP RAI+ 
Sbjct  355  GDISYLKFAAESKAILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIDA  414

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  415  ANRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  474

Query  179  NDEFMDQYEDHRG---YSRM  129
            ND FMD+Y+ + G   YSRM
Sbjct  475  NDSFMDEYDGYGGGSSYSRM  494



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGL+ NPPKP
Sbjct  288  SFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLLANPPKP  347

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP AI+ 
Sbjct  348  GDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPGAIDA  407

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP+IM SFKKF
Sbjct  408  AKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPVEEEMPSIMASFKKF  467

Query  179  NDEFMDQYE  153
            NDEFM QYE
Sbjct  468  NDEFMAQYE  476



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 182/197 (92%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGVMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKF
Sbjct  405  ARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QYE   GYSR+
Sbjct  465  NDSFMEQYE---GYSRL  478



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 180/197 (91%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNPPKP
Sbjct  286  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  346  GDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKF
Sbjct  406  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKF  465

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QYE   GYSRM
Sbjct  466  NDSFMEQYE---GYSRM  479



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 180/197 (91%), Gaps = 3/197 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNPPKP
Sbjct  286  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  346  GDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKF
Sbjct  406  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKF  465

Query  179  NDEFMDQYEDHRGYSRM  129
            ND FM+QYE   GYSRM
Sbjct  466  NDSFMEQYE---GYSRM  479



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP Q+F+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+SY+Q+ RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIET
Sbjct  345  GDVSYEQYHRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP IM SF+KF
Sbjct  405  AKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPGIMASFRKF  464

Query  179  NDEFMDQY  156
            NDEFM+QY
Sbjct  465  NDEFMEQY  472



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   349 bits (895),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP Q+F+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+SY+Q+ RESKGIL+SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIET
Sbjct  345  GDVSYEQYHRESKGILDSLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MPAIM SFKKF
Sbjct  405  AKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPAIMASFKKF  464

Query  179  NDEFMDQY  156
            NDEFM+QY
Sbjct  465  NDEFMEQY  472



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   342 bits (878),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 175/197 (89%), Gaps = 6/197 (3%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQ GGYFEMTNIPP++V+EIYKVASISLSPNVP QIFL LMVNPPKP
Sbjct  148  SFHTVSKGYWGECGQXGGYFEMTNIPPKTVDEIYKVASISLSPNVPIQIFLSLMVNPPKP  207

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F      I ESL++RA IMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIET
Sbjct  208  GDISYLKF------ITESLKRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQMRLPPKAIET  261

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PDV+YCLKLLEATGIS VPGSGFGQKE  FHL TTILPAEEDMPAIM SFKKF
Sbjct  262  AKRAGKVPDVFYCLKLLEATGISMVPGSGFGQKEEAFHLMTTILPAEEDMPAIMASFKKF  321

Query  179  NDEFMDQYEDHRGYSRM  129
            NDEFM+QY DHRGYS M
Sbjct  322  NDEFMEQYGDHRGYSWM  338



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+HTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLGLMVNPPKP
Sbjct  285  SYHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASISLSPNVPGQIFLGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
             DISY +FV ESK ILESLR+RA +MTDGFN+CRNV+CNFTEGAMYSFPQI+LPP+AI  
Sbjct  345  ADISYQRFVAESKAILESLRRRAHLMTDGFNNCRNVICNFTEGAMYSFPQIKLPPKAIAA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCLKLLEATG+STVPGSGFGQKEGVFHLRTTILP EE+MP IM  FK F
Sbjct  405  AKEAGKAPDVFYCLKLLEATGMSTVPGSGFGQKEGVFHLRTTILPPEEEMPEIMNVFKIF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            ND+FM +YE++  +SR+
Sbjct  465  NDDFMAKYENY-SWSRL  480



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 177/199 (89%), Gaps = 3/199 (2%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP +V EIYKVAS+S+SPNVP QIF+GLMVNPPKP
Sbjct  185  SFHTVSKGYWGECGQRGGYFEMTNIPPETVVEIYKVASLSISPNVPAQIFMGLMVNPPKP  244

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+SY+QF+RESKGILESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQI  PP+AI+ 
Sbjct  245  GDVSYEQFIRESKGILESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIX-PPKAIDA  303

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG--VFHLRTTILPAEEDMPAIMESFK  186
            A+  GK PDV+YCLKLLEATGISTVP  G        VFHLRTTILPAEEDMP IM+SFK
Sbjct  304  AKRAGKVPDVFYCLKLLEATGISTVPQIGLIVIRSCRVFHLRTTILPAEEDMPEIMDSFK  363

Query  185  KFNDEFMDQYEDHRGYSRM  129
            KFNDEFM++YE H GYSR+
Sbjct  364  KFNDEFMERYEGHGGYSRL  382



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNPPKP
Sbjct  286  SFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  346  GDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKF
Sbjct  406  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKF  465

Query  179  NDEF  168
            ND F
Sbjct  466  NDSF  469



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  716  FHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPG  537
            FH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLMVNPPKPG
Sbjct  130  FHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKPG  189

Query  536  DISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  357
            DISYDQFVRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPPRAIE A
Sbjct  190  DISYDQFVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPRAIEAA  249

Query  356  QGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  189
            +   KAPDVYYCLKLLEATGISTVPGSGFGQK+G FHLRTTILP EE+MPAIM  F
Sbjct  250  KQARKAPDVYYCLKLLEATGISTVPGSGFGQKDGYFHLRTTILPLEEEMPAIMGEF  305



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG+ GECGQRGGYFEMTN  P++VEE+YKVASI+LSPNV GQI +GLMV PP+P
Sbjct  286  SFHTVSKGFLGECGQRGGYFEMTNFHPKTVEELYKVASIALSPNVTGQIMMGLMVKPPRP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+S+  +  ES  I++SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  AI  
Sbjct  346  GDVSFPLYAAESAAIMQSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPKAAIAA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMPAIMESFK F
Sbjct  406  ARQAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPAIMESFKMF  465

Query  179  NDEFMDQYEDHR  144
            N +FM QY D +
Sbjct  466  NADFMAQYSDSK  477



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG+ GECGQRGGYFEMTN  P++V+E+YKV+SI+LSPNV GQI +GLMVNPPKP
Sbjct  286  SFHTVSKGFLGECGQRGGYFEMTNFHPKTVDELYKVSSIALSPNVSGQIMMGLMVNPPKP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY Q+  ESK I  SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  A+  
Sbjct  346  GDISYPQYEAESKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPQAAVAA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMP IMESFKKF
Sbjct  406  AKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPGIMESFKKF  465

Query  179  NDEFMDQYEDHR  144
            N +FM QY D +
Sbjct  466  NQDFMAQYADAK  477



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLM+NPPKP
Sbjct  285  SFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMINPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ET
Sbjct  345  GDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  246
            A+  GKA DVYYCLKLLEATGISTVPGSGFGQKEG  H
Sbjct  405  AKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGYVH  442



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   286 bits (731),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  638  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  459
            ++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMT
Sbjct  2    QTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMT  61

Query  458  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  279
            DGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPG
Sbjct  62   DGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPG  121

Query  278  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  177
            SGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN
Sbjct  122  SGFGQKEGVFHLRTTILPAEEEMPLIMESFKKFN  155



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG+ GECGQRGGYFEMTNI P++V+E+YKV+SI+LSPNV GQI +GLMV+PPKP
Sbjct  286  SFHTVSKGFLGECGQRGGYFEMTNIHPKTVDELYKVSSIALSPNVTGQIMMGLMVSPPKP  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY  +  ES+ I  SLRKRA IMTDGFN+C N+VCNFTEGAMYSFPQ++LP  AI  
Sbjct  346  GDISYPLYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMYSFPQVKLPQAAIAA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E DMP IMESFKKF
Sbjct  406  AKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSERDMPGIMESFKKF  465

Query  179  NDEFMDQYEDHR  144
            N +FM Q+ D +
Sbjct  466  NADFMAQHSDTK  477



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   291 bits (745),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  255
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ 
Sbjct  345  GDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDV  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  255
            A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEG
Sbjct  405  AKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECGQRGGYFEMTNI P++VEE+YKVASISLSPNV GQI +GLMV PP+P
Sbjct  285  SFHSVSKGFLGECGQRGGYFEMTNIHPQTVEELYKVASISLSPNVVGQIMMGLMVTPPRP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
             DISY Q+  ESK I+ES+R+RA IMTDGFN C +VVCNFTEGAMYSFP+I+L   A++ 
Sbjct  345  FDISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFPRIKLSKAAMDA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   GKA DV+YCLKLLEATGISTVPGSGFGQKEG  HLRTTILP E+DMP IM  F+KF
Sbjct  405  AAQAGKAADVFYCLKLLEATGISTVPGSGFGQKEGTLHLRTTILPLEQDMPGIMAKFQKF  464

Query  179  NDEFMDQYEDHRGYSRM  129
            + +FM QY D+   SR+
Sbjct  465  HADFMAQYSDYSVSSRL  481



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECGQRGGYFEM NI P +V+EIYKVASISLSPNVP QIF+GLMVNPPKP
Sbjct  285  SFHSVSKGYYGECGQRGGYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ET
Sbjct  345  GDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALET  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  255
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  405  AKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 151/202 (75%), Gaps = 39/202 (19%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYWGECGQRGGYFEMTNIP ++V+EIYKVAS+SLSPNVP QIF+GLMVNP KP
Sbjct  285  SFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFP-----QIRLPP  375
            GDISY+Q+VRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSF      +I    
Sbjct  345  GDISYEQYVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFLXXSWFRIWTER  404

Query  374  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  195
            RA+                                     VFHLRTTILPAEEDMPAIM 
Sbjct  405  RALPCR----------------------------------VFHLRTTILPAEEDMPAIMA  430

Query  194  SFKKFNDEFMDQYEDHRGYSRM  129
            SFKKFNDEFM++YEDHRGYSRM
Sbjct  431  SFKKFNDEFMEEYEDHRGYSRM  452



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   263 bits (672),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -3

Query  578  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  399
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  1    QIFMGLMVNPPKPGDISYLKYATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  60

Query  398  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  219
            FPQIRLP RA++TA+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  61   FPQIRLPQRAMDTAKSAGKAPDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  120

Query  218  EDMPAIMESFKKFNDEFMDQYEDH  147
            EDMPAIM SFKKFND FM+QY+D+
Sbjct  121  EDMPAIMSSFKKFNDSFMEQYQDY  144



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  638  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  459
            ++V+EIYKVASI+LSPNVPGQIF+GLM+N PKPGDISY +F  ESK IL+SLR+RA+IMT
Sbjct  4    QTVDEIYKVASIALSPNVPGQIFMGLMMNHPKPGDISYLKFATESKSILDSLRRRAQIMT  63

Query  458  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  279
            DGFNSC+NVVCNFTEGAMYS+ QI LP RAI+TA+  GK PDV+YCLKLLEAT ISTVPG
Sbjct  64   DGFNSCQNVVCNFTEGAMYSYFQICLPKRAIDTAKSAGKEPDVFYCLKLLEATRISTVPG  123

Query  278  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  177
            SGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFN
Sbjct  124  SGFGQKEGVFHLRTTILPAEEDMPAIMLSFKKFN  157



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  GQI L  +VNPPKP
Sbjct  334  SFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSCLVNPPKP  393

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ + +E    L SLR+RA ++TDGFNS   V CNFTEGAMYSFPQI+LPP+A+E 
Sbjct  394  GDSSYEMYTKEKAAELASLRRRAHMVTDGFNSLDGVTCNFTEGAMYSFPQIKLPPKALEA  453

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLE+TGISTVPGSGFGQ++G FHLRTTILP EE M + +E F+KF
Sbjct  454  AKAAGKAGDVFYCLKLLESTGISTVPGSGFGQEDGTFHLRTTILPREEVMSSFVEKFEKF  513

Query  179  NDEFMDQY  156
            + +FM QY
Sbjct  514  HKDFMKQY  521



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHT+SKG  GECG RGG  E TNI P +++++YK+ASI+LSPN  GQ  L LMVNPPK 
Sbjct  335  SFHTISKGALGECGMRGGMLEATNIHPDTIDQLYKIASINLSPNTFGQAGLALMVNPPKE  394

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++Q   E+ GI+ S+R+RAR+MTDGFN+C  + CN+TEGAMYSFP++ LPP+A++ 
Sbjct  395  GDPSHEQHEAEAAGIIASMRRRARMMTDGFNACEGITCNYTEGAMYSFPRLNLPPKALQA  454

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPD +YCLKLL+ATG+ TVPGSGFGQ+EG FHLRTTILP E+ +  ++ SF+KF
Sbjct  455  AKKAGKAPDTWYCLKLLDATGVLTVPGSGFGQEEGTFHLRTTILPQEDKIKDVIASFQKF  514

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  515  HASFMDEY  522



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  GQI L ++VNPPKP
Sbjct  333  SFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSVLVNPPKP  392

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYDQ+ +E    L SLR+RA ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E 
Sbjct  393  GDPSYDQYTKEKASELVSLRRRAHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEA  452

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF
Sbjct  453  AKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTHFVEKFDKF  512

Query  179  NDEFMDQY  156
            + +FM QY
Sbjct  513  HKDFMKQY  520



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  GQI L ++VNPPKP
Sbjct  333  SFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSVLVNPPKP  392

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYDQ+ +E    L SLR+R  ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E 
Sbjct  393  GDPSYDQYTKEKASELVSLRRRRHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEA  452

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF
Sbjct  453  AKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTTFVEKFDKF  512

Query  179  NDEFMDQY  156
            + +FM QY
Sbjct  513  HKDFMKQY  520



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 153/219 (70%), Gaps = 7/219 (3%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            +FHT SKG +GECG RGG  E+ N   R  +E+YK+ASI+LSPNVPGQ+ LGLMVN P+P
Sbjct  331  TFHTASKGVYGECGFRGGVMELLNFDERVADELYKLASINLSPNVPGQVILGLMVNGPRP  390

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY Q+ RE + +L+SLR+RAR +TD FNSC  +VC  TEGAMYSFP+I LPP A+  
Sbjct  391  GDESYAQYAREKQDLLDSLRRRARAITDAFNSCEGIVCQETEGAMYSFPKITLPPAAMAA  450

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK+PDV+YCLKLLE TGISTVPGSGF Q++G FH RTTILP E     I++ F  F
Sbjct  451  AKAAGKSPDVFYCLKLLETTGISTVPGSGFKQRDGTFHFRTTILPPESKFQDIIQRFLAF  510

Query  179  NDEFMDQYE-------DHRGYSRM*QIADNMKQLLKSHK  84
            +  FM +Y+       D R   R  Q    +  ++ +H+
Sbjct  511  HSAFMAEYKGSTGRGTDSRDVKRAEQQESEVNWMIPAHR  549



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+HTVSKG  GECG RGGY+EM NI P +V++ YK++SI+LSPN  GQI L  MVNPP  
Sbjct  433  SYHTVSKGTSGECGLRGGYYEMVNIHPATVDQFYKISSINLSPNSIGQIALSCMVNPPAA  492

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +++E +G L SL +RA+++ DGFNS + V CN TEGAMY+FP++ LPPRA+E 
Sbjct  493  GDPSHELWIQEQQGELASLNRRAKMVVDGFNSLQGVSCNATEGAMYAFPRLSLPPRALEA  552

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G+APD +YCL+LLEATGI  VPGSGFGQ EG FHLRTTILP EE M   ++ F+ F
Sbjct  553  ARKAGRAPDAFYCLRLLEATGIVAVPGSGFGQAEGSFHLRTTILPREERMAEFVQKFRTF  612

Query  179  NDEFMDQY  156
            +  FM ++
Sbjct  613  HQSFMAEF  620



>emb|CDX91589.1| BnaC02g15710D [Brassica napus]
 emb|CDX88411.1| BnaC06g38550D [Brassica napus]
 emb|CDX86159.1| BnaA06g28760D [Brassica napus]
Length=131

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 8/133 (6%)
 Frame = -3

Query  638  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  459
            ++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE        R+RARIMT
Sbjct  2    QTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRE--------RRRARIMT  53

Query  458  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  279
            DGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKL EATGISTVPG
Sbjct  54   DGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLFEATGISTVPG  113

Query  278  SGFGQKEGVFHLR  240
            SGFGQKEGVFHLR
Sbjct  114  SGFGQKEGVFHLR  126



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG+RGGY E+  I      EIYK+ASI L PNV GQ+ + LMV PP P
Sbjct  342  SFHSVSKGFVGECGKRGGYMELNGITSDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPTP  401

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +++E  GI +SL+KRA ++    NS   V CN +EGAMY+FPQIRLP +A+E 
Sbjct  402  GDSSYELYIKERDGIYDSLKKRANLLNKALNSLEGVTCNPSEGAMYAFPQIRLPKKAVEY  461

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ +GKAPD YYC++LLE TGI  VPGSGFGQK+G +H RTT LP+EE +  + E    F
Sbjct  462  AQSIGKAPDAYYCIQLLEHTGICVVPGSGFGQKDGTYHFRTTFLPSEEAIEGVCERIADF  521

Query  179  NDEFMDQYE  153
            + +FM++Y+
Sbjct  522  HKQFMNKYK  530



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S H+VSKGY+GECG+RGGY E+T       E++YK+AS++L  N+ GQI   L+++PPK 
Sbjct  65   SLHSVSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPPKA  124

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE 
Sbjct  125  GDASYDLYEEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEA  184

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F
Sbjct  185  ARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREF  244

Query  179  NDEFMDQYED  150
            ++EFM QY D
Sbjct  245  HEEFMSQYRD  254



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG +GECG+RGGY E TNI P +++++YKV SI LS NV GQ+ +GLM NPPKP
Sbjct  288  SFHTVSKGVFGECGRRGGYLEATNIHPGALDQLYKVFSIGLSSNVDGQLMMGLMCNPPKP  347

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+Q+ +E   I +SL++RA ++++ FN+   V C   EGA+Y+FP++RLP  A++ 
Sbjct  348  GDASYEQYEQECDAIFQSLKRRAEMISNAFNALPGVSCQNVEGALYAFPRVRLPEAAVKE  407

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD++YCL+LL ATGI  VPGSGFGQ+EG FH RTTILPAEE MP +++ F  F
Sbjct  408  AEKKDMGPDLFYCLELLHATGICAVPGSGFGQEEGTFHFRTTILPAEEQMPRVIDLFTSF  467

Query  179  NDEFMDQY  156
            + +F+ ++
Sbjct  468  HKDFLQRF  475



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  140  SFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKA  199

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  200  GDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  259

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  260  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  319

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  320  HEKFMDEFRD  329



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  140  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKA  199

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  200  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  259

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  260  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  319

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  320  HEKFMDEFRD  329



>gb|ETK83815.1| hypothetical protein L915_11053 [Phytophthora parasitica]
Length=200

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  12   SFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQP  71

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  72   GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  131

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  132  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  191

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  192  HARFMDKY  199



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 138/190 (73%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECG+RGGY E+T       E++YK+AS++L  N+ GQI   L++NPPK 
Sbjct  293  SFHSVSKGYYGECGKRGGYMEVTGFSAPVREQLYKIASVNLCSNITGQILSSLIMNPPKA  352

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL+SL +RA+ M   FNS   + CN TEGAMY FPQI LP +AIE 
Sbjct  353  GDGSYDLYMEEKDGILKSLARRAKAMESAFNSIDGITCNKTEGAMYLFPQIYLPHKAIEA  412

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ + KAPD +Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F
Sbjct  413  ARAVNKAPDAFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIARFREF  472

Query  179  NDEFMDQYED  150
            ++EFM QY D
Sbjct  473  HEEFMAQYRD  482



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  264  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKA  323

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  324  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGA  383

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  384  AQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  443

Query  179  NDEFMDQYED  150
            +++FMD+Y D
Sbjct  444  HEKFMDEYRD  453



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF ++SKGY+GECG+RGGY E+T   P+  ++IYK+ASI+L  N+ GQI   L++NPPK 
Sbjct  140  SFQSISKGYYGECGKRGGYMEITGFSPQVRDQIYKMASINLCSNITGQILASLVMNPPKA  199

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F  E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  200  GDESFESFRLERDGILSSLGRRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPRKAIGA  259

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H+R+TILP E+ +P I+  FK+F
Sbjct  260  AQAAGTAPDAYYAKRLLEATGIVFVPGSGFGQVPGTWHIRSTILPQEDKIPGIVSRFKEF  319

Query  179  NDEFMDQYEDH  147
            +D+FMD++ D+
Sbjct  320  HDKFMDEFRDY  330



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  302  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKA  361

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  362  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGA  421

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  422  AQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  481

Query  179  NDEFMDQYED  150
            +++FMD+Y D
Sbjct  482  HEKFMDEYRD  491



>gb|ETL37230.1| hypothetical protein L916_10951 [Phytophthora parasitica]
 gb|ETM43674.1| hypothetical protein L914_10886 [Phytophthora parasitica]
Length=200

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  12   SFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQP  71

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  72   GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  131

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF
Sbjct  132  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKF  191

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  192  HARFMDKY  199



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  297  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKA  356

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  357  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  416

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  417  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  476

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  477  HEKFMDEFRD  486



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  327  SFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKA  386

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  387  GDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  446

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  447  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  506

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  507  HEKFMDEFRD  516



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  352  SFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKA  411

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  412  GDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  471

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  472  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  531

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  532  HEKFMDEFRD  541



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  327  SFQSVSKGYYGECGKRGGYMEITGFSPDVREQIYKVASVNLCSNVSGQILASLVMNPPKA  386

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  387  GDESFESFMSERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  446

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  447  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  506

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  507  HEKFMDEFRD  516



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  294  SFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKA  353

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  +  E  GIL+SL +RA+ + D FN+   + CN TEGAMY FPQ+ LP +AIE 
Sbjct  354  GDASYASYKAEKDGILQSLARRAKALEDAFNNLEGITCNKTEGAMYLFPQLLLPRKAIEA  413

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F
Sbjct  414  AKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRFKTF  473

Query  179  NDEFMDQYED  150
            ++ FM  Y D
Sbjct  474  HESFMAAYRD  483



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  295  SFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKA  354

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ 
Sbjct  355  GDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDA  414

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F
Sbjct  415  AKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAF  474

Query  179  NDEFMDQYED  150
            ++ FM  Y D
Sbjct  475  HEGFMAAYRD  484



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  294  SFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKA  353

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ 
Sbjct  354  GDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDA  413

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F
Sbjct  414  AKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAF  473

Query  179  NDEFMDQYED  150
            ++ FM  Y D
Sbjct  474  HEGFMAAYRD  483



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  357  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKA  416

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  417  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  476

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  477  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  536

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  537  HEKFMDEFRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  357  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKA  416

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  417  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  476

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  477  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  536

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  537  HEKFMDEFRD  546



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKG++GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK 
Sbjct  352  SFQSVSKGFYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKA  411

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  412  GDESFESFMLERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  471

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  472  AQAAGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRFKEF  531

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  532  HEKFMDEFRD  541



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S H+VSKGY+GECG+RGGY E+T       E++YK+AS++L  N+ GQI   L+++PPK 
Sbjct  305  SLHSVSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPPKA  364

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE 
Sbjct  365  GDASYDLYEEERDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEA  424

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F
Sbjct  425  ARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREF  484

Query  179  NDEFMDQYED  150
            ++EFM QY D
Sbjct  485  HEEFMSQYRD  494



>gb|ESA18192.1| hypothetical protein GLOINDRAFT_334935 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG  GECG+RGGY+E TNI  R +EE+YK+AS+SL PNV GQI + LMV PPK 
Sbjct  307  SFHSVSKGMIGECGRRGGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLMVQPPKR  366

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  + +E   I ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP +AIE 
Sbjct  367  GDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLPQKAIEA  426

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H R+T LP EE +       +KF
Sbjct  427  AHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFCIKLQKF  486

Query  179  NDEFMDQYED  150
            ++EF+++Y D
Sbjct  487  HNEFLEKYCD  496



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T + P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  341  SFQSVSKGYYGECGKRGGYMEVTGLSPDVKEQIYKVASVNLCSNISGQILASLVMNPPKV  400

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ E   IL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ 
Sbjct  401  GDESYESYIAERDEILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIKA  460

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R+TILP E+ +PAI+   K F
Sbjct  461  AEAVKTAPDAYYAHRLLDATGIVVVPGSGFGQVPGTWHIRSTILPQEDKIPAILSRLKAF  520

Query  179  NDEFMDQYED  150
            ++ FMD++ D
Sbjct  521  HEAFMDEFRD  530



>gb|EXX69945.1| alanine transaminase ALT1 [Rhizophagus irregularis DAOM 197198w]
Length=528

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG  GECG+RGGY+E TNI  R +EE+YK+AS+SL PNV GQI + LMV PPK 
Sbjct  339  SFHSVSKGMIGECGRRGGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLMVQPPKR  398

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  + +E   I ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP +AIE 
Sbjct  399  GDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLPQKAIEA  458

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H R+T LP EE +       +KF
Sbjct  459  AHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFCIKLQKF  518

Query  179  NDEFMDQYED  150
            ++EF+++Y D
Sbjct  519  HNEFLEKYCD  528



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+H+VSKG  GECG+RGGY E+ NI P  VE+IYK+ SISL  N+ GQI + LMVNPP  
Sbjct  285  SYHSVSKGMIGECGRRGGYMELINIDPVVVEQIYKLFSISLCSNIAGQIIVDLMVNPPAK  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S+DQ+ RE K + ESL++R++ +    NS +N+ C    GAMY+FP I LPP A++ 
Sbjct  345  GDPSHDQYEREMKDLFESLKRRSQKLHAALNSMKNITCTEIGGAMYAFPSIHLPPSAVQA  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G  PD +Y ++LL+ATGI  VPGSGF QK+G FH RTT LP+E  M  +++  +KF
Sbjct  405  AKEAGMTPDTFYAVELLDATGICVVPGSGFRQKQGSFHFRTTFLPSESKMDDVIDKLRKF  464

Query  179  NDEFMDQY  156
            N  FMD+Y
Sbjct  465  NQSFMDKY  472



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 137/188 (73%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG  GECG RGGY E+TN  P +V+E+YK  SI+LSPN  GQ+ + LMVNPPKP
Sbjct  341  SFHTVSKGVLGECGLRGGYVELTNFHPGTVDELYKAVSINLSPNTTGQVAMSLMVNPPKP  400

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY Q+  E    L SLR+RA  MTDGFN+   V C FTEGAMYSFP++ LPP+AI  
Sbjct  401  GDESYAQWKAEHDEGLASLRRRAHAMTDGFNALDGVTCTFTEGAMYSFPRLHLPPKAIAA  460

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   GK  D +YCL+LLEATGI TVPGSGFGQ+EG FHLRTTILP E  +   ++ F+ F
Sbjct  461  AAAAGKPADTFYCLQLLEATGIVTVPGSGFGQEEGTFHLRTTILPPEAKIGEFVKLFQDF  520

Query  179  NDEFMDQY  156
            +  FM +Y
Sbjct  521  HKAFMAKY  528



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 131/189 (69%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG+RGGY E+  I      EIYK+ASI L PNV GQI + LMV PP  
Sbjct  411  SFHSVSKGFVGECGKRGGYMELHGITNEVKAEIYKLASIGLCPNVTGQIVVDLMVRPPVA  470

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ SYD +V+E   I +SL++RA ++    N    V CN  EGAMY+FPQIRLP RAIE 
Sbjct  471  GEQSYDTYVKERDTIFDSLKRRANLLAAALNGLEGVTCNQPEGAMYAFPQIRLPARAIEE  530

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+E+ +  +      F
Sbjct  531  AKANGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTYHFRTTFLPSEQAIQGVCTRIADF  590

Query  179  NDEFMDQYE  153
            +  FM +Y+
Sbjct  591  HKNFMAKYK  599



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  311  SFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQP  370

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  311  SFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQP  370

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  311  SFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQP  370

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG+RGGY E+  I P    EIYK++SI L PNV GQ+ + LMVNPP+ 
Sbjct  343  SFHSVSKGFVGECGKRGGYMELFGISPEVKSEIYKLSSIGLCPNVIGQLVVDLMVNPPQE  402

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ S+ Q++ E   I  SL++RA ++    NS   V CN  EGAMY+FPQIRLPP+A+E 
Sbjct  403  GEASHKQYIEERDAIYNSLKRRANLLATALNSLEGVTCNAPEGAMYAFPQIRLPPKAVEE  462

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PD +YC++LLEATGI  VPGSGFGQ++G +H RTT LP+E+ +  + +    F
Sbjct  463  AKQNGKQPDAHYCIQLLEATGICVVPGSGFGQRDGTYHFRTTFLPSEQAIEGVCKKVADF  522

Query  179  NDEFMDQYE  153
            +  FM +Y+
Sbjct  523  HKAFMAKYK  531



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  346  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  405

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + DG NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  406  GDDSYDSYMAERDGILSSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  465

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  466  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIVNRLTEF  525

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  526  HKSFMDEFRD  535



>ref|XP_002969652.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
 gb|EFJ29740.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
Length=503

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECG+RGGY E+T +     E+IYK+AS++L  N+ GQI + L+ NPPK 
Sbjct  314  SFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVSNPPKA  373

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA++ 
Sbjct  374  GDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERALKA  433

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++     F
Sbjct  434  AAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRLTSF  493

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  494  HQRFMDEFRD  503



>ref|XP_002970914.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
 gb|EFJ28240.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
Length=503

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY+GECG+RGGY E+T +     E+IYK+AS++L  N+ GQI + L+ NPPK 
Sbjct  314  SFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVSNPPKA  373

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA++ 
Sbjct  374  GDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERALKA  433

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++     F
Sbjct  434  AAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRLTSF  493

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  494  HQRFMDEFRD  503



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG  GECG RGGY E  NI P +  E+YKVAS++L PN  GQ  + LMV PP  
Sbjct  298  SFHTVSKGMLGECGLRGGYVEWVNIHPGAQAELYKVASVNLCPNTVGQATVSLMVAPPTG  357

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
               +  Q+ ++ +  L SLR+RA +MTD FN      CNFTEGAMYSFP++ LP +AI+ 
Sbjct  358  DSEAARQYAKQYEDSLASLRRRAHVMTDAFNGLEGASCNFTEGAMYSFPRLHLPAKAIQA  417

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GK PD +YCL LL  TGI TVPGSGFGQ EG FHLRTTILP E+ M   ++  + F
Sbjct  418  AKEAGKDPDTFYCLALLADTGIVTVPGSGFGQVEGTFHLRTTILPQEDVMHEFVDKLRTF  477

Query  179  NDEFMDQYED  150
            +  FM +Y+D
Sbjct  478  HKSFMAKYKD  487



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  311  SFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQP  370

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  337  SFQSVSKGYHGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNPPKV  396

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  397  GDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  456

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F
Sbjct  457  AKAVNVAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISHLKAF  516

Query  179  NDEFMDQYED  150
            ++ FM+++ D
Sbjct  517  HESFMEEFHD  526



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 133/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+P
Sbjct  311  SFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLVVGMMTNPPQP  370

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC ++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCTQMLDDTGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEMTSKF  490

Query  179  NDEFMDQY  156
            + +FMD Y
Sbjct  491  HAKFMDTY  498



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++N PK 
Sbjct  140  SFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNTPKV  199

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  200  GDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  259

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F
Sbjct  260  ANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAF  319

Query  179  NDEFMDQYED  150
            ++ F+ ++ D
Sbjct  320  HESFLGEFRD  329



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  359  SFQSVSKGYYGECGKRGGYMEVTGFTPDVREQIYKMASVNLCSNISGQILASLVMSPPKP  418

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE 
Sbjct  419  GDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRISLPQKAIEA  478

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI++    F
Sbjct  479  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVDRLTAF  538

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  539  HKSFMDEFRD  548



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++N PK 
Sbjct  337  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNTPKV  396

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  397  GDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  456

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F
Sbjct  457  AKVVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRLKAF  516

Query  179  NDEFMDQYED  150
            ++ FM+++ D
Sbjct  517  HESFMEEFHD  526



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  343  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  402

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  403  GDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  462

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  463  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEF  522

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  523  HKSFMDEFRN  532



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  351  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  410

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  411  GDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  470

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  471  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEF  530

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  531  HKSFMDEFRN  540



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  334  SFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMNPPKV  393

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE 
Sbjct  394  GDESYESFDAEKTGILSSLARRAKALEDAFNGLEEVTCNKAEGAMYLFPRLHLPKKAIEA  453

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F
Sbjct  454  AKAVKAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPHEDKIPAIISRLKAF  513

Query  179  NDEFMDQYED  150
            ++ FM+++ D
Sbjct  514  HEAFMEEFRD  523



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  364  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  423

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  424  GDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  483

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  484  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEF  543

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  544  HKSFMDEFRN  553



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  360  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  419

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE 
Sbjct  420  GDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRINLPQKAIEA  479

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+E    F
Sbjct  480  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVERLTAF  539

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  540  HKSFMDEFRD  549



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 133/190 (70%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L+++PPK 
Sbjct  352  SFQSVSKGYYGECGKRGGYMEVTGFSPEVREQIYKMASVNLCSNISGQILSSLVMSPPKV  411

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ E  GIL SL++RA+ + D  NS   V CN  EGAMY FP+I LP +AI  
Sbjct  412  GDESYELYLSEKDGILSSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQKAIHA  471

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA+++   +F
Sbjct  472  AEAAKTAPDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVDRLTEF  531

Query  179  NDEFMDQYED  150
            + +FMD++ D
Sbjct  532  HKKFMDEFRD  541



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  341  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNPPKV  400

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE 
Sbjct  401  GDESYESFAAEKNGILSSLARRAKALEDAFNGLVGVTCNKAEGAMYLFPRLHLPQKAIEA  460

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F
Sbjct  461  AKAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIARLKAF  520

Query  179  NDEFMDQYED  150
            ++ FM ++ D
Sbjct  521  HESFMGEFRD  530



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF ++SKGY GECG+RGGY E+T       E+ YKVAS++L  N+ GQI   L++NPPK 
Sbjct  298  SFQSISKGYHGECGKRGGYMEVTGFSAEVREQFYKVASVNLCSNISGQIIASLVMNPPKV  357

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ 
Sbjct  358  GDESYKSFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIDA  417

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD  Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F
Sbjct  418  AKAVIAAPDTLYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPQEDKIPAIISRLKAF  477

Query  179  NDEFMDQYED  150
            ++ FMD++ D
Sbjct  478  HEAFMDEFRD  487



>ref|XP_004342401.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20285.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=514

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG  GECG RGG+ E+  I     ++ YK+ASISL PN+PGQ+ + LMV PP  
Sbjct  325  SFHSVSKGVIGECGHRGGFMELVGIDEEVKQQFYKLASISLCPNLPGQVVVDLMVRPPVA  384

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ SYD + +E+ GI ESL++RA  +T+ FN    V CN  EGAMY FP++RLP +A+  
Sbjct  385  GEPSYDLYHQETTGIFESLKRRALRLTEAFNKLEGVTCNEAEGAMYLFPRVRLPAKAVHE  444

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A    K PD +YCL LL+ TGI  VPGSGFGQK+G +H RTT LP E+ + A+ +S  KF
Sbjct  445  AVKQKKTPDSFYCLALLDQTGICVVPGSGFGQKDGTYHFRTTFLPPEDKIDAVAKSIAKF  504

Query  179  NDEFMDQYED  150
            + +FM +Y D
Sbjct  505  HHDFMQKYRD  514



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+++PPK 
Sbjct  140  SFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSPPKV  199

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ 
Sbjct  200  GDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKA  259

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  260  AEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDF  319

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  320  HKRFMDEFRD  329



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+++PPK 
Sbjct  142  SFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSPPKV  201

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ 
Sbjct  202  GDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKA  261

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  262  AEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDF  321

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  322  HKRFMDEFRD  331



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T I P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  355  SFQSVSKGYYGECGKRGGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLVMSPPKV  414

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ 
Sbjct  415  GDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKA  474

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  475  AEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  534

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  535  HKSFMDEFRD  544



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T I P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  355  SFQSVSKGYYGECGKRGGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLVMSPPKV  414

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ 
Sbjct  415  GDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKA  474

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  475  AEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  534

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  535  HKSFMDEFRD  544



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+ +VSKGY+GECG+RGGYFE+T       E+IYK+AS++L  N+ GQI   L++NPPK 
Sbjct  293  SYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKA  352

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
             D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE 
Sbjct  353  SDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEA  412

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F
Sbjct  413  AKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVF  472

Query  179  NDEFMDQYED  150
            ++ FM +Y D
Sbjct  473  HEAFMSEYRD  482



>ref|XP_008460348.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=513

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  324  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKV  383

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ 
Sbjct  384  GDESFESYSAEKDGILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKAIKA  443

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  444  AEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEF  503

Query  179  NDEFMDQYED  150
            + +FM+++ D
Sbjct  504  HKQFMEEFRD  513



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 139/188 (74%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG +GECG RGGY E+TNI  R  +E+YK+ SI+LSPNV GQ+ +G+M NPPKP
Sbjct  288  SFHTVSKGVYGECGLRGGYMELTNIDQRVSDEMYKLCSINLSPNVTGQVAMGIMCNPPKP  347

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G  SY   +RE + +L+SL +RAR + D FN    V C  TEGA+Y+FP+I LP  AI+ 
Sbjct  348  GSESYALHMREKEVLLQSLIRRARSIVDAFNGLDGVTCEETEGALYAFPKIDLPRAAIDA  407

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPDV+YCL+LL+ TG+S VPGSGFGQ EG +H RTTILPAE+   ++++ F  F
Sbjct  408  AKAAGKAPDVFYCLELLKETGLSCVPGSGFGQAEGTYHFRTTILPAEDTFQSVVDGFTSF  467

Query  179  NDEFMDQY  156
            +  FM +Y
Sbjct  468  HRGFMAKY  475



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  264  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVMNPPKA  323

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  324  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  383

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  384  AQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEF  443

Query  179  NDEFMDQYED  150
            +++FMD+Y +
Sbjct  444  HEKFMDEYRE  453



>emb|CCI42079.1| unnamed protein product [Albugo candida]
Length=479

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + E++YK+ SI+L  N+ GQ+ +GLMVNPPK 
Sbjct  291  SFHSTSKGFTGECGRRGGYMELVNISECAREQLYKLMSINLCSNIEGQLMVGLMVNPPKK  350

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY ++  +   IL SL++RA  +   FN    V CN TEGA+Y+FP+IRL  +A++ 
Sbjct  351  GDASYQRYCHQRDSILASLKRRALKLVAAFNKLEGVTCNATEGALYTFPRIRLSEKAVQA  410

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A G   APD YYC+++LE TGI  VPGSGFGQK+G FH R+TILP E+++  ++     F
Sbjct  411  ASGCNMAPDTYYCIQMLEKTGIVVVPGSGFGQKDGTFHFRSTILPPEDEVNEVITKMSDF  470

Query  179  NDEFMDQY  156
            +  FM+ +
Sbjct  471  HLNFMNAH  478



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  339  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKV  398

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ 
Sbjct  399  GDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKA  458

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  459  AEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEF  518

Query  179  NDEFMDQYED  150
            + +FM+++ D
Sbjct  519  HKQFMEEFRD  528



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 131/189 (69%), Gaps = 1/189 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S  + SKG++GECG+RGGY E+  + P    E+YK+AS+ L PN+ GQ+ +GL+++PPKP
Sbjct  274  SMQSTSKGFYGECGRRGGYMEVCGLDPDVKAELYKLASVGLCPNLSGQVLMGLVMSPPKP  333

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E   IL SL++RA  +  G N+   V CN  +GAMY+FP++ LP + +  
Sbjct  334  GDPSYELYAAERDAILSSLKRRALKLVSGLNALEGVTCNEAQGAMYAFPKVSLPEKFVAE  393

Query  359  AQGLGK-APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKK  183
            A   GK APD  YC+KLLEATGI  VPGSGFGQ EG +H RTT LP+EED+  ++E   K
Sbjct  394  ATASGKMAPDALYCMKLLEATGIVVVPGSGFGQVEGTWHFRTTFLPSEEDIGGVVEKLAK  453

Query  182  FNDEFMDQY  156
            F+ EFMD Y
Sbjct  454  FHAEFMDTY  462



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG +GECG+RGGY E+  I P + E++YK+ SI+LS NV GQ+ +GLM +PP+P
Sbjct  285  SFHTVSKGVFGECGRRGGYVELLGIHPSAREQLYKLFSINLSSNVDGQLMVGLMCSPPRP  344

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  F  E   I +SL++RA ++T+ FN    + C   EGA+Y+FPQI+L  RA   
Sbjct  345  GDASYPTFTTECDAIFQSLKRRAAMVTEAFNRLPFISCRNVEGALYAFPQIQLSKRACAE  404

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G A DV YC++LL+ TGI  VPGSGFGQ++G FH RTTILP EE   +I++ F  F
Sbjct  405  AEKRGVAADVLYCMELLDETGICAVPGSGFGQRDGTFHFRTTILPPEEQFESILQLFADF  464

Query  179  NDEFMDQY  156
            + +FMD+Y
Sbjct  465  HLKFMDRY  472



>ref|XP_004166923.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like, partial 
[Cucumis sativus]
Length=493

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  304  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKV  363

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ 
Sbjct  364  GDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKA  423

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  424  AEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEF  483

Query  179  NDEFMDQYED  150
            + +FM+++ D
Sbjct  484  HKQFMEEFRD  493



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKGY+GECG+RGGY E T   P   E+IYK+AS++L  N+ GQI   L+++PPK 
Sbjct  298  SFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLIMSPPKV  357

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ 
Sbjct  358  GDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKA  417

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F
Sbjct  418  AEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQF  477

Query  179  NDEFMDQY  156
            + +FMD++
Sbjct  478  HKQFMDEF  485



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKGY+GECG+RGGY E T   P   E+IYK+AS++L  N+ GQI   L+++PPK 
Sbjct  295  SFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLIMSPPKV  354

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ 
Sbjct  355  GDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKA  414

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F
Sbjct  415  AEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQF  474

Query  179  NDEFMDQY  156
            + +FMD++
Sbjct  475  HKQFMDEF  482



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+ +VSKGY+GECG+RGGYFE+T       E+IYK+AS++L  N+ GQI   L++NPPK 
Sbjct  311  SYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKA  370

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
             D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE 
Sbjct  371  SDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEA  430

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F
Sbjct  431  AKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVF  490

Query  179  NDEFMDQYED  150
            ++ FM +Y D
Sbjct  491  HEAFMSEYRD  500



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  346  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKV  405

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ 
Sbjct  406  GDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKA  465

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  466  AEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEF  525

Query  179  NDEFMDQYED  150
            + +FM+++ D
Sbjct  526  HKQFMEEFRD  535



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 135/190 (71%), Gaps = 1/190 (1%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTN-IPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPK  543
            SFH+VSKG+ GECG+RGGYF+++  I P   EE+YK++S++L PN  GQI + LMV PP 
Sbjct  303  SFHSVSKGFIGECGRRGGYFQLSEAIDPAVKEELYKISSVNLCPNADGQIMVDLMVRPPS  362

Query  542  PGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE  363
             G+ SY ++V E   IL SL++RA  +    NS   V C   EGAMY+FPQI LP +AI+
Sbjct  363  QGEASYQEYVAERDNILNSLKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQITLPEKAIQ  422

Query  362  TAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKK  183
             A+ +G APD+ Y L+LLE TGI  VPGSGF QK G +H RTTILP+EE +  ++++  K
Sbjct  423  KAKEMGVAPDLMYVLELLEETGICVVPGSGFQQKPGTYHFRTTILPSEEQIEGVVQTLAK  482

Query  182  FNDEFMDQYE  153
            F+D+FM QY+
Sbjct  483  FHDKFMKQYK  492



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  341  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKV  400

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ 
Sbjct  401  GDESFESYSAEKDGILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKAIKA  460

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  461  AEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEF  520

Query  179  NDEFMDQYED  150
            + +FM+++ D
Sbjct  521  HKQFMEEFRD  530



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  299  SFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNPPKD  358

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ 
Sbjct  359  GDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKA  418

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F
Sbjct  419  AEAANTAPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDF  478

Query  179  NDEFMDQYED  150
            +  FM++Y D
Sbjct  479  HKAFMNEYRD  488



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKGY+GECG+RGGY E T   P   E+IYKVAS++L  N+ GQI   L++ PPK 
Sbjct  298  SFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKVASVNLCSNISGQILASLIMIPPKV  357

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E + IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ 
Sbjct  358  GDESYESFSAEKEAILSSLARRAKILEDAFNSLEGVTCYNAEGALYSFPRINLPDKAIKA  417

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F
Sbjct  418  AEEAKTAPDAFYAWRLLNATGIVIVLGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQF  477

Query  179  NDEFMDQY  156
            + +FMD++
Sbjct  478  HKQFMDEF  485



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKG  GECG RGGY E  N  P ++ ++YK+ASI+L PN  GQ  +GL VNPP  
Sbjct  297  SFHTVSKGVTGECGLRGGYVEWVNFHPDTIAQLYKIASINLCPNTVGQACVGLAVNPPSQ  356

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G  +  +   E++ I ES+++RA  +T  FN+   V CN TEGAMY+FP++ LPP+A+E 
Sbjct  357  GTKAGKEHATETRAIHESMQRRAAKVTAAFNALPGVTCNPTEGAMYAFPRLHLPPKAVEA  416

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPD +YCL LL+ TGI TVPG+GFGQ +G +H+RTTILP E+ +      F +F
Sbjct  417  ARAAGKAPDTFYCLALLDYTGIVTVPGTGFGQVDGTWHMRTTILPQEDVLDDFCNRFAEF  476

Query  179  NDEFMDQY  156
            + +FMD+Y
Sbjct  477  HQQFMDKY  484



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ N     +EE+YK+ SI+L  N+ GQ+ + LM NPPKP
Sbjct  298  SFHSTSKGFTGECGRRGGYMELVNFDHDVMEELYKLVSINLCSNIEGQLMVALMTNPPKP  357

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD +V +   I+ SL++RA  +   FN    V CN TEGAMY+FP+I +P +A+  
Sbjct  358  GDASYDLYVSQRDEIVNSLKRRALKLVASFNELEGVTCNATEGAMYTFPRITVPAKAVAE  417

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +G+APD +Y   LL ATGI  VPGSGFGQ++G FH R+TILP EE +  ++    KF
Sbjct  418  AKKVGQAPDAFYAFALLNATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIAKTAKF  477

Query  179  NDEFMDQY  156
            + +FM++Y
Sbjct  478  HADFMNKY  485



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++N PK 
Sbjct  286  SFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNTPKV  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  346  GDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F
Sbjct  406  ANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAF  465

Query  179  NDEFMDQYED  150
            ++ F+ ++ D
Sbjct  466  HESFLGEFRD  475



>ref|NP_001086104.1| alanine aminotransferase 2 [Xenopus laevis]
 sp|Q6GM82.1|ALAT2_XENLA RecName: Full=Alanine aminotransferase 2; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Xenopus laevis]
 gb|AAH74194.1| Gpt2 protein [Xenopus laevis]
Length=540

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKGY GECG RGGY E+ N+ P   +++ K+ S+ L P VPGQ+ L ++VNPPKP
Sbjct  352  SFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQVLLDVIVNPPKP  411

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ SY QF+ E + +L +L ++AR+  +  N    + CN  +GAMYSFP+I +P +AI+ 
Sbjct  412  GEPSYKQFISEKQAVLNNLAEKARLTEEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKL  471

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G+APD+++C+KLLE TGI  VPGSGFGQ+EG  H R TILP  + + +++E  K F
Sbjct  472  AQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDF  531

Query  179  NDEFMDQY  156
            + +FMD+Y
Sbjct  532  HQKFMDEY  539



>ref|XP_010471259.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010471260.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  359  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  418

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + D  N+   V CN  EGAMY FP+I LP +AIE 
Sbjct  419  GDDSYDSYMVERDGILSSMAKRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPHKAIEA  478

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ + AI++    F
Sbjct  479  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKILAIVDRLTAF  538

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  539  HKSFMDEFRD  548



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T   P   E+IYKV+S++L  N+ GQI   L+++PPK 
Sbjct  342  SFQSVSKGYHGECGKRGGYMEVTGFSPDVREQIYKVSSVNLCSNITGQILASLVMSPPKV  401

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E   IL SL  RA+ + +  N    V CN  EGAMY FPQIRLP +AIE 
Sbjct  402  GDESYESFMAEKGSILSSLATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPKKAIEA  461

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  462  AEAENTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTEF  521

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  522  HEKFMDEFRD  531



>ref|XP_010490704.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=202

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 119/177 (67%), Gaps = 25/177 (14%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFHTVSKGYW    +RGGYFEMTNIPPR VEEIYKVASI+ SPNV  QIF+GLMV+PPKP
Sbjct  22   SFHTVSKGYWT--ARRGGYFEMTNIPPRVVEEIYKVASIAFSPNVSAQIFMGLMVSPPKP  79

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEG-----------------  411
            GDI YDQF RESKGILESLR+RA+I+TDGFNSC+ VVC   +                  
Sbjct  80   GDILYDQFARESKGILESLRRRAKIVTDGFNSCKTVVCQRNKAIKAVQFRDFDTVLDDSC  139

Query  410  ------AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKE  258
                  AMYSFPQIRLP  A++ A+  GK PDV+YCL L   T    VP     ++ 
Sbjct  140  VSQMLIAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLWLCIWTERRCVPSEDTSRRR  196



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+ +VSKGY+GECG+RGGY E+T       E+IYK++S++L  N+ GQI   L++NPPK 
Sbjct  292  SYQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKISSVNLCSNITGQILASLVMNPPKA  351

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  +  E   IL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ 
Sbjct  352  GDESYASYQAEKDRILTSLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIDA  411

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A    KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  FK F
Sbjct  412  ANAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFKVF  471

Query  179  NDEFMDQYED  150
            ++ FM ++ D
Sbjct  472  HEAFMAEHRD  481



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  349  SFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVMNPPKA  408

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  409  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  468

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  469  AQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEF  528

Query  179  NDEFMDQYED  150
            +++FMD+Y +
Sbjct  529  HEKFMDEYRE  538



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  358  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKV  417

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E   IL SL +RA+ + + FN    V CN  EGAMY FP+I+LP +AIE 
Sbjct  418  GDESYESYSAEKDAILSSLARRAKKLEEAFNGLEGVTCNRAEGAMYLFPRIQLPKKAIEA  477

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y  +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  478  AKAVNTAPDAFYARRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDRIPAIISRLTEF  537

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  538  HKGFMDEFRD  547



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       +++YKVAS++L  N+ GQI   L++NPPK 
Sbjct  140  SFQSVSKGYYGECGRRGGYMEVTGFDNNIKDQLYKVASVNLCSNISGQILASLVMNPPKS  199

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F  E  GIL SL +RA+ + D  N    V CN  EGAMY FP+I LP +AI+ 
Sbjct  200  GDESFEMFFAERDGILSSLARRAKTLVDALNQLEGVTCNEAEGAMYVFPRIHLPQQAIKA  259

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +   PD +Y  +LLEATGI TVPGSGFGQ  G +H R+TILP E+ +P I+     F
Sbjct  260  AEAVNMVPDAFYSQRLLEATGIVTVPGSGFGQVPGTWHFRSTILPPEDKIPTIVSRMTTF  319

Query  179  NDEFMDQYED  150
            + +FM+++ D
Sbjct  320  HQKFMEEFHD  329



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 127/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  299  SFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNPPKD  358

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ 
Sbjct  359  GDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKA  418

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F
Sbjct  419  AEAANTVPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDF  478

Query  179  NDEFMDQYED  150
            +  FM++Y D
Sbjct  479  HKAFMNEYRD  488



>ref|XP_004155894.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=488

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 127/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  299  SFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNPPKD  358

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ 
Sbjct  359  GDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKA  418

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F
Sbjct  419  AEAANTVPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDF  478

Query  179  NDEFMDQYED  150
            +  FM++Y D
Sbjct  479  HKAFMNEYRD  488



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++N PK 
Sbjct  329  SFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNTPKV  388

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  389  GDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  448

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F
Sbjct  449  ANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAF  508

Query  179  NDEFMDQYED  150
            ++ F+ ++ D
Sbjct  509  HESFLGEFRD  518



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L++NPPK 
Sbjct  353  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKLASVNLCSNISGQILASLVMNPPKV  412

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ E   IL SL +RA+ + D FNS + V CN  EGAMY FP I LP +AIE 
Sbjct  413  GDESYESYLAEKDAILSSLARRAKQLEDAFNSLKGVTCNRAEGAMYLFPCIDLPKKAIEA  472

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y  +LL ATGI  VPGSGF Q  G +H R TILP E+ +PAI+    KF
Sbjct  473  AKAVSTAPDAFYARRLLNATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVSRLTKF  532

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  533  HKGFMDEFCD  542



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  347  SFQSVSKGYHGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKV  406

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E + ILESL +RA+ + D FN    V CN  EGAMY FPQIRL  +AI+ 
Sbjct  407  GDESYESFNAEKENILESLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKA  466

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A     APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+    +F
Sbjct  467  AGDANTAPDNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPPEEKIPAIVTRLTEF  526

Query  179  NDEFMDQYED  150
            +++FMD++ D
Sbjct  527  HEKFMDEFRD  536



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG R GY E+ N+ P   +++ K+ S+ L P VPGQI L  +V+PP+P
Sbjct  234  SFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDTVVDPPQP  293

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  
Sbjct  294  GDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAA  353

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F
Sbjct  354  AKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSF  413

Query  179  NDEFMDQY  156
              +F+ +Y
Sbjct  414  YTKFVKEY  421



>emb|CDJ93113.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=505

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 131/189 (69%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKGY GECG RGGY E  N+ P       K+ S  L   + GQ+ +  +VNPPKP
Sbjct  317  SFHSVSKGYMGECGMRGGYVEFFNLDPEVYVLFKKMISAKLCSTILGQVMMDALVNPPKP  376

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYDQ+++E   +L SL++RA ++ + + S   + CN  +GAMY+FPQ+ LPPRA+E 
Sbjct  377  GDPSYDQWLKEKNAVLASLKERATLVKEAYGSIEGIKCNEVQGAMYAFPQLMLPPRAVEK  436

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ L   PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++E FK F
Sbjct  437  ARSLNMEPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQTEMMKDMLERFKSF  496

Query  179  NDEFMDQYE  153
            + +FM++Y+
Sbjct  497  HTKFMEEYK  505



>ref|XP_006342897.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=545

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKG++GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  356  SFQSVSKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSPPKV  415

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F  E +GIL SL +RA+ + D F++   V CN  EGAMY FP+I LP +AI+ 
Sbjct  416  GDESYESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPNKAIKA  475

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LL ATGI  VPGSGFGQ+ G +H R TILP EE +PAI+    +F
Sbjct  476  AEEAKTAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSRLTEF  535

Query  179  NDEFMDQY  156
            + +FMD++
Sbjct  536  HKQFMDEF  543



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG+RGGY E+  +      EIYK+ASI L PNV GQ+ + LMV PP  
Sbjct  346  SFHSVSKGFVGECGKRGGYMELNGVTQDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPVA  405

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ S+D +++E   I ESL+KRA ++T+  N+   V CN +EGAMY+FPQIRLP +A+E 
Sbjct  406  GEQSHDLYLKERDNIYESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAKAVEY  465

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A  +GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+EE +  + +    F
Sbjct  466  ANSIGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADF  525

Query  179  NDEFMDQYE  153
            +  FM++Y+
Sbjct  526  HQSFMNKYK  534



>ref|XP_001769989.1| predicted protein [Physcomitrella patens]
 gb|EDQ65165.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T +P    +++YK+AS++L  NV GQI + L++NPPKP
Sbjct  295  SFQSVSKGYYGECGRRGGYMEVTGLPKDVKDQLYKLASVNLCSNVSGQILVSLVMNPPKP  354

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+QF RE   IL SL +RA+++T+  N    V CN  EGAMY FP++ LP +A   
Sbjct  355  GDSSYEQFARERDSILSSLARRAKVLTEAMNKLEGVSCNAAEGAMYVFPRLYLPKKAQIA  414

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   G   DV+Y  +LL++TGI  VPGSGFGQ  G +H+R TILP+EE+  AI++    F
Sbjct  415  AGEAGMKADVFYTRRLLDSTGIVMVPGSGFGQVPGTWHVRCTILPSEENFGAIIDRLTTF  474

Query  179  NDEFMDQYED  150
            + +FMD++ D
Sbjct  475  HKKFMDEFRD  484



>ref|XP_006426797.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40037.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=529

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  340  SFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMSPPKV  399

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  400  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  459

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  460  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  519

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  520  HKSFMDKFRN  529



>gb|EYU45916.1| hypothetical protein MIMGU_mgv1a005454mg [Erythranthe guttata]
Length=483

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 129/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L++NPPK 
Sbjct  294  SFQSVSKGYYGECGKRGGYMEITGFSPEIREQIYKLASVNLCSNISGQILASLVMNPPKV  353

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD +  E   IL SL +RA+ + D FN    V CN  EGAMY FP+I LP +A+E 
Sbjct  354  GDESYDSYFAEKNAILSSLARRAQKLEDAFNGLEGVSCNRAEGAMYLFPRIVLPNKALEA  413

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LL ATGI  VPGSGFGQ +G +H+R TILP E+ + AI+    KF
Sbjct  414  AKEAKTAPDAFYARRLLNATGIVVVPGSGFGQVDGTWHIRCTILPQEDRISAIITRLTKF  473

Query  179  NDEFMDQY  156
            + EFMD++
Sbjct  474  HTEFMDEF  481



>ref|XP_006426798.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40038.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=533

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  344  SFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMSPPKV  403

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  404  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  463

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  464  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  523

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  524  HKSFMDKFRN  533



>ref|XP_006828623.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
 gb|ERM96039.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
Length=405

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++PPKP
Sbjct  216  SFQSVSKGYYGECGKRGGYMEVTGFSRDVKEQIYKVASVNLCSNISGQILASLVMSPPKP  275

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ F  E  GIL SL +RA+ +   FNS   V CN  EGAMY FP++ LP +AI+ 
Sbjct  276  GDESFESFTAERDGILSSLARRAKALEKAFNSLEGVTCNRAEGAMYLFPRLHLPAKAIKA  335

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ L  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ + A++  F  F
Sbjct  336  AEALNVAPDAYYTHRLLDATGIVAVPGSGFGQVPGTWHVRYTILPQEDKIAAVVSKFTAF  395

Query  179  NDEFMDQYED  150
            ++  + ++ D
Sbjct  396  HEALIAEFRD  405



>ref|XP_010096539.1| Alanine aminotransferase 2 [Morus notabilis]
 gb|EXB64659.1| Alanine aminotransferase 2 [Morus notabilis]
Length=537

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  348  SFQSVSKGYYGECGKRGGYMEVTGFSADIREQIYKVASVNLCSNISGQILASLVMSPPKV  407

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ 
Sbjct  408  GDESYESYRAERDGILSSLARRAKTLEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIKA  467

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ + +APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  468  AEAVKEAPDAFYCHRLLNATGIVFVPGSGFGQAPGTWHFRCTILPQEDKIPAIVSRLTDF  527

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  528  HKGFMDEFRD  537



>ref|XP_004356702.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR24802.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=454

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 129/190 (68%), Gaps = 8/190 (4%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG  GECG RGGY E+  +     ++IYK+ASISL PN+ GQ+ + LMV PPKP
Sbjct  273  SFHSVSKGVIGECGHRGGYMELVGLDIAVKQQIYKLASISLCPNIAGQVVVDLMVRPPKP  332

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S+DQF RE++   ESL+KRA ++    N    V CN  EGAMY FP+IRLP RAI+ 
Sbjct  333  GDDSHDQFQRETQATFESLKKRAGLLATALNQLEGVTCNPAEGAMYLFPRIRLPQRAIDE  392

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ L +APDV+YC  LL+AT        GFGQ++G FH RTT LP EE + +++ +   F
Sbjct  393  AKRLCRAPDVFYCFALLDAT--------GFGQRDGTFHFRTTFLPQEEQIRSVVAAMAAF  444

Query  179  NDEFMDQYED  150
            +  FMDQ+ +
Sbjct  445  HARFMDQWRE  454



>ref|XP_007024768.1| Alanine aminotransferase 2 [Theobroma cacao]
 gb|EOY27390.1| Alanine aminotransferase 2 [Theobroma cacao]
Length=539

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQ+   L+++PPK 
Sbjct  350  SFQSVSKGYYGECGKRGGYMEVTGFGADVREQIYKVASVNLCSNISGQVLASLVMSPPKV  409

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL +L +RA+ + D FN    V CN  EGAMY FP+I LP +AI+ 
Sbjct  410  GDESYESYSAERDGILSALARRAKTLEDAFNKLEGVTCNKAEGAMYLFPRIHLPEKAIKA  469

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            AQ    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  470  AQVAKTAPDAFYCRRLLSATGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTHLTDF  529

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  530  HKSFMDEFRD  539



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+++PPK 
Sbjct  293  SFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSPPKV  352

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ 
Sbjct  353  GDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKA  412

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  413  AEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDF  472

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  473  HKRFMDEFRD  482



>gb|AIT69922.1| alanine transaminase [Sargassum fusiforme]
Length=501

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKGY+GECG RGGY E+  I P    E+YK+AS+SL  N  GQ+ +G+MVNPPKP
Sbjct  312  SFHSTSKGYFGECGLRGGYMELHGIGPEVRAEVYKLASLSLCSNTVGQLAMGMMVNPPKP  371

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY  F +E   IL SLR+R+ ++    N    + CN  +GA+Y+FP+IRLP +A++ 
Sbjct  372  GDPSYQTFEKERGDILSSLRRRSMMVHKALNEMEGITCNKADGALYAFPRIRLPNKAVQA  431

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   G  PD YYCLK+L+ TGI  VPGSGFGQ+EG  H RTT LP+E+ M   ++     
Sbjct  432  AVDKGIPPDEYYCLKILDETGIILVPGSGFGQEEGTLHFRTTFLPSEDTMEETLKILASA  491

Query  179  NDEFMDQYED  150
            + EFMD + D
Sbjct  492  HAEFMDDHRD  501



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG R GY E+ N+ P   +++ K+ S+ L P VPGQI L  +V+PP+P
Sbjct  248  SFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDTVVDPPQP  307

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  
Sbjct  308  GDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAA  367

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F
Sbjct  368  AKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSF  427

Query  179  NDEFMDQY  156
              +F+ +Y
Sbjct  428  YTKFIKEY  435



>gb|EIE85592.1| hypothetical protein RO3G_10302 [Rhizopus delemar RA 99-880]
Length=475

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH++SKG  GECG+RGGYFE  +I P  ++++YK++S+SL PN+ GQI + LM NPP  
Sbjct  286  SFHSISKGMIGECGRRGGYFECVHIDPEIMDQLYKISSVSLCPNIHGQIMVDLMTNPPVE  345

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY Q+  E   I +SLR+RA  +   FN+   V CN  EGAMY FPQIRLP +AI+ 
Sbjct  346  GDASYPQYKEEIDAIYQSLRRRAIKLATCFNNLEGVTCNSAEGAMYLFPQIRLPQKAIKE  405

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G A D YY + +LEATG+  VPGSGFGQ++G +H R+T LP E        S + F
Sbjct  406  AEKAGMAADTYYSMAMLEATGVCVVPGSGFGQQQGTYHFRSTFLPEEHLFDTFCSSLEAF  465

Query  179  NDEFMDQYED  150
            + EF+++Y D
Sbjct  466  HKEFLNKYRD  475



>ref|XP_003627448.1| Alanine aminotransferase [Medicago truncatula]
 gb|AET01924.1| alanine aminotransferase [Medicago truncatula]
Length=524

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  335  SFQSVSKGYHGECGKRGGYMEVTGFSPDVREQIYKVASVNLCSNITGQILASLIMSPPKV  394

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ F+ E   IL SL  RA+ + +  N    V CN  EGAMY FP+IRLP +AI+ 
Sbjct  395  GDESYESFMAERGAILSSLTTRAKALEEALNKLEGVTCNKAEGAMYLFPRIRLPEKAIKA  454

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  455  AEAEKSAPDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDRIPAIVTRLTEF  514

Query  179  NDEFMDQYED  150
            + +FMD++ D
Sbjct  515  HQKFMDEFRD  524



>gb|AET06148.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=484

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK 
Sbjct  295  SFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMNPPKV  354

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD S++ +  E  GIL SL +RA+ + D FN+   V CN  EGAMY FP+I L  +AI+ 
Sbjct  355  GDESFESYSAEKNGILSSLARRAKALEDAFNNLEGVTCNKAEGAMYLFPRIHLSQKAIKA  414

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+     F
Sbjct  415  AETAKTAPDAFYAKRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRLTDF  474

Query  179  NDEFMDQYED  150
            +  FM ++ D
Sbjct  475  HQAFMAEFRD  484



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ N    ++E++YK+ SI+L  N+ GQ+ + LM NPP  
Sbjct  301  SFHSTSKGFTGECGRRGGYMELVNFNADAMEQLYKLVSINLCSNIEGQLMVALMTNPPVE  360

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ ++ +  GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+E 
Sbjct  361  GDESYELYIAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVEE  420

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   G APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF
Sbjct  421  ATKRGVAPDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKF  480

Query  179  NDEFMDQY  156
            + EFMD Y
Sbjct  481  HAEFMDLY  488



>ref|XP_009515714.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
 gb|EGZ28439.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
Length=492

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 137/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  NV GQ+ +G+M NPP+P
Sbjct  297  SFHSTSKGFTGECGRRGGYMELVNIDDGAKDQFYKLMSVNLCSNVEGQLMVGMMTNPPQP  356

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY++++ +  G LE+L++RA  +   FN    V CN TEGAMY+FP+I +P +A+E 
Sbjct  357  GDASYERYIEQRDGTLEALKRRAVKLVKAFNELEGVTCNETEGAMYTFPKITIPAKAVEA  416

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H R+TILP EE +  ++E   KF
Sbjct  417  AKAAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRSTILPPEEAVDEVIEKTVKF  476

Query  179  NDEFMDQYED  150
            +  FMD+Y +
Sbjct  477  HANFMDKYRE  486



>gb|ETK88933.1| hypothetical protein L915_06890 [Phytophthora parasitica]
Length=266

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 135/191 (71%), Gaps = 0/191 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+ 
Sbjct  71   SFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQS  130

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY +++ +  G L SL++RA  +   FN+   V CN TEGA+Y+FP I LP +A+E 
Sbjct  131  GDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGVTCNETEGALYTFPSISLPAKAVEA  190

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E   KF
Sbjct  191  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKF  250

Query  179  NDEFMDQYEDH  147
            + +FMD+Y ++
Sbjct  251  HAKFMDKYREN  261



>ref|XP_007441690.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Python 
bivittatus]
 ref|XP_007441691.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Python 
bivittatus]
 ref|XP_007441692.1| PREDICTED: alanine aminotransferase 2-like isoform X5 [Python 
bivittatus]
Length=492

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 133/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V GQI L  MVN P+P
Sbjct  300  SFHSISKGFMGECGFRGGYMEVINMDPAVQQQLTKLVSVRLCPPVTGQILLDAMVNQPQP  359

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ 
Sbjct  360  GDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQD  419

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F
Sbjct  420  AEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQF  479

Query  179  NDEFMDQYEDHR  144
            + +F  +Y   +
Sbjct  480  HAKFTQEYSQRQ  491



>ref|XP_006465804.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Citrus 
sinensis]
Length=533

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  344  SFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKV  403

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  404  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  463

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  464  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  523

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  524  HKNFMDKFRN  533



>gb|KDO53767.1| hypothetical protein CISIN_1g009517mg [Citrus sinensis]
Length=533

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  344  SFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKV  403

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  404  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  463

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  464  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  523

Query  179  NDEFMDQYED  150
            +  FMD++ +
Sbjct  524  HKNFMDKFRN  533



>ref|XP_006300438.1| hypothetical protein CARUB_v10020102mg [Capsella rubella]
 gb|EOA33336.1| hypothetical protein CARUB_v10020102mg [Capsella rubella]
Length=543

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 130/190 (68%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKP
Sbjct  354  SFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKP  413

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP++ LP +AIE 
Sbjct  414  GDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRMNLPQKAIEA  473

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TIL  E+ +PAI+    +F
Sbjct  474  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILSQEDKIPAIVNRLTEF  533

Query  179  NDEFMDQYED  150
            +  FMD++ D
Sbjct  534  HKSFMDEFRD  543



>ref|XP_004345426.2| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=489

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG+RGGY EM  I     E+IYKVASISL PNV GQ+ + LMVNPPK 
Sbjct  300  SFHSVSKGFIGECGKRGGYMEMIGIDAYVREQIYKVASISLCPNVQGQVIVDLMVNPPKE  359

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ SY+ + RE   IL SL+ R+  + D FN    V C   +GAMY+FPQIRLP +A+E 
Sbjct  360  GEPSYELYARERDQILGSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTFPQIRLPKKAVEA  419

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPD +YC+ LLEATG+S VPG+GF Q+EG +H R T LP ++  PA  ++  +F
Sbjct  420  AKAAGKAPDSFYCMALLEATGVSVVPGTGFKQREGTYHFRCTFLPPQDTFPAFTDAIVRF  479

Query  179  NDEFMDQYED  150
            ++EFM +Y+D
Sbjct  480  HNEFMAKYKD  489



>gb|EMT23015.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=508

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+ +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++NPPK 
Sbjct  319  SYQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKA  378

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
             D SY  +  E  GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE 
Sbjct  379  SDESYASYKAEKDGILASLARRAKALEVAFSKLEGITCNKAEGAMYLFPQICLPQKAIEA  438

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F
Sbjct  439  AKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVF  498

Query  179  NDEFMDQYED  150
            ++ FM +Y D
Sbjct  499  HETFMAEYRD  508



>gb|ETL42327.1| hypothetical protein L916_06840 [Phytophthora parasitica]
Length=207

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+ 
Sbjct  12   SFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQS  71

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY +++ +  G L SL++RA  +   FN+   + CN TEGA+Y+FP   LP +A+E 
Sbjct  72   GDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGITCNETEGALYTFPSTSLPAKAVEA  131

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E   KF
Sbjct  132  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKF  191

Query  179  NDEFMDQYEDH  147
            + +FMD+Y ++
Sbjct  192  HAKFMDKYREN  202



>ref|XP_007441689.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Python 
bivittatus]
Length=507

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 133/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V GQI L  MVN P+P
Sbjct  315  SFHSISKGFMGECGFRGGYMEVINMDPAVQQQLTKLVSVRLCPPVTGQILLDAMVNQPQP  374

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ 
Sbjct  375  GDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQD  434

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F
Sbjct  435  AEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQF  494

Query  179  NDEFMDQYEDHR  144
            + +F  +Y   +
Sbjct  495  HAKFTQEYSQRQ  506



>ref|XP_010685211.1| PREDICTED: alanine aminotransferase 2 [Beta vulgaris subsp. vulgaris]
Length=535

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  346  SFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNITGQILASLVMSPPKV  405

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E +GIL SL +RA+ + D F+S   V CN  EGAMY FP++ L  +AI+ 
Sbjct  406  GDESYEVYSAEKEGILSSLARRAKTLEDAFSSLEGVTCNKAEGAMYLFPRLNLSQKAIKA  465

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+    APD +Y  +LLE TGI  VPGSGFGQ  G +H+R TILP E+ +PAI+E    F
Sbjct  466  AEADKTAPDAFYARRLLEETGIVVVPGSGFGQVLGTWHIRCTILPQEDKIPAIVERLTAF  525

Query  179  NDEFMDQYED  150
            + +FMD++ D
Sbjct  526  HKKFMDEFRD  535



>ref|XP_007441688.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Python 
bivittatus]
Length=518

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 133/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V GQI L  MVN P+P
Sbjct  326  SFHSISKGFMGECGFRGGYMEVINMDPAVQQQLTKLVSVRLCPPVTGQILLDAMVNQPQP  385

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ 
Sbjct  386  GDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQD  445

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F
Sbjct  446  AEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQF  505

Query  179  NDEFMDQYEDHR  144
            + +F  +Y   +
Sbjct  506  HAKFTQEYSQRQ  517



>ref|XP_009826737.1| hypothetical protein H257_04062 [Aphanomyces astaci]
 gb|ETV83307.1| hypothetical protein H257_04062 [Aphanomyces astaci]
Length=486

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ N     +EE+YK+ SI+L  N+ GQ+ + LM NPPK 
Sbjct  298  SFHSTSKGFTGECGRRGGYMELVNFDDDVMEELYKLVSINLCSNIEGQLMVALMTNPPKA  357

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ SYD +V +   I+ SL++RA  +   FN    V CN TEGAMY+FP+I +P +A+  
Sbjct  358  GEPSYDLYVAQRDEIVSSLKRRAVKLVASFNELEGVTCNVTEGAMYTFPRITVPAKAVAE  417

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   G+APD +Y   LL ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF
Sbjct  418  ANKAGQAPDAFYAFALLNATGIVVVPGSGFGQQDGTFHFRSTILPPEEAIDEVIEKTAKF  477

Query  179  NDEFMDQY  156
            + +FM++Y
Sbjct  478  HADFMNKY  485



>emb|CCA27196.1| unnamed protein product [Albugo laibachii Nc14]
Length=504

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 130/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ NI   + E++YK+ SI+L  N+ GQ+ +GLMVNPPK 
Sbjct  316  SFHSTSKGFTGECGRRGGYMELVNISECAREQLYKLMSINLCSNIEGQLMVGLMVNPPKT  375

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY ++  +   IL SL++RA  +   FN    V CN TEGA+Y+FP+IRL   A++ 
Sbjct  376  GDASYQKYCHQRDSILASLKRRALKLVAAFNKLEGVTCNATEGALYTFPRIRLSENAVQA  435

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A     APD YYC+++L+ TGI  VPGSGFGQ++G FH R+TILP E+++  ++     F
Sbjct  436  AAKSSMAPDTYYCIQMLDKTGIVVVPGSGFGQRDGTFHFRSTILPPEDEVNEVIAKMSTF  495

Query  179  NDEFMDQY  156
            + EFM+ +
Sbjct  496  HLEFMNSH  503



>gb|EMS46317.1| Alanine aminotransferase 2 [Triticum urartu]
Length=519

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 128/190 (67%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            S+ +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++NPPK 
Sbjct  330  SYQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKA  389

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
             D SY  +  E  GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE 
Sbjct  390  SDESYASYKAEKDGILASLARRAKALEIAFSKLEGITCNKAEGAMYLFPQICLPQKAIEA  449

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F
Sbjct  450  AKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVF  509

Query  179  NDEFMDQYED  150
            ++ FM +Y D
Sbjct  510  HETFMAEYRD  519



>gb|KDO24164.1| hypothetical protein SPRG_10592 [Saprolegnia parasitica CBS 223.65]
Length=489

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 129/188 (69%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+ SKG+ GECG+RGGY E+ N    ++E++YK+ SI+L  N+ GQ+ + LM NPP  
Sbjct  301  SFHSTSKGFTGECGRRGGYMELVNFNADAMEQLYKLVSINLCSNIEGQLMVALMTNPPVE  360

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +V +  GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+  
Sbjct  361  GDESYELYVAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVAE  420

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A   G APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF
Sbjct  421  ATKRGVAPDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKF  480

Query  179  NDEFMDQY  156
            + EFMD Y
Sbjct  481  HAEFMDLY  488



>gb|EPS60556.1| hypothetical protein M569_14246, partial [Genlisea aurea]
Length=491

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 126/188 (67%), Gaps = 0/188 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SF +VSKGY+GECG+RGGY E+T   P   ++IYKVAS++L  N+ GQI   L+++PPK 
Sbjct  303  SFQSVSKGYYGECGKRGGYMEITGFSPEIRDQIYKVASVNLCSNISGQILASLVMSPPKV  362

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            GD SY+ +  E   IL SL +RA+ + D  N    V CN  EGAMY FP+I LP +AIE 
Sbjct  363  GDESYESYFAEKDAILSSLARRAKTLEDALNGLEGVTCNRAEGAMYLFPRIELPKKAIEA  422

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+ +  APD +Y   LL ATGI  VPGSGFGQ  G +H R TILP EE +PAI+    +F
Sbjct  423  AKAVDTAPDAFYARLLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVNRLTEF  482

Query  179  NDEFMDQY  156
            +  FMD+Y
Sbjct  483  HQGFMDEY  490



>gb|KJE95383.1| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=553

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  719  SFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKP  540
            SFH+VSKG+ GECG+RGGY EM  I     E+IYKVASISL PNV GQ+ + LMVNPPK 
Sbjct  364  SFHSVSKGFIGECGKRGGYMEMIGIDAYVREQIYKVASISLCPNVQGQVIVDLMVNPPKE  423

Query  539  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  360
            G+ SY+ + RE   IL SL+ R+  + D FN    V C   +GAMY+FPQIRLP +A+E 
Sbjct  424  GEPSYELYARERDQILGSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTFPQIRLPKKAVEA  483

Query  359  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  180
            A+  GKAPD +YC+ LLEATG+S VPG+GF Q+EG +H R T LP ++  PA  ++  +F
Sbjct  484  AKAAGKAPDSFYCMALLEATGVSVVPGTGFKQREGTYHFRCTFLPPQDTFPAFTDAIVRF  543

Query  179  NDEFMDQYED  150
            ++EFM +Y+D
Sbjct  544  HNEFMAKYKD  553



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425