BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024M05

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO51889.1|  hypothetical protein CISIN_1g003205mg                   247   3e-75   Citrus sinensis [apfelsine]
gb|AFK37940.1|  unknown                                                 243   2e-74   Lotus japonicus
gb|KDO51888.1|  hypothetical protein CISIN_1g003205mg                   247   2e-73   Citrus sinensis [apfelsine]
ref|XP_011082899.1|  PREDICTED: protein VACUOLELESS1                    250   2e-73   Sesamum indicum [beniseed]
ref|XP_007214933.1|  hypothetical protein PRUPE_ppa001364mg             250   3e-73   Prunus persica
ref|XP_007048987.1|  Vacuoleless1 (VCL1) isoform 3                      249   4e-73   
ref|XP_007048986.1|  Vacuoleless1 (VCL1) isoform 2                      249   6e-73   
ref|XP_008229565.1|  PREDICTED: protein VACUOLELESS1                    249   6e-73   Prunus mume [ume]
ref|XP_006387719.1|  hypothetical protein POPTR_0647s00230g             233   7e-73   
ref|XP_007048985.1|  Vacuoleless1 (VCL1) isoform 1                      249   1e-72   
emb|CDP06151.1|  unnamed protein product                                248   1e-72   Coffea canephora [robusta coffee]
ref|XP_011026233.1|  PREDICTED: protein VACUOLELESS1-like isoform X2    243   2e-72   Populus euphratica
gb|EYU33990.1|  hypothetical protein MIMGU_mgv1a001320mg                248   2e-72   Erythranthe guttata [common monkey flower]
gb|KHN35900.1|  Vacuolar protein sorting-associated protein 16 like     243   6e-72   Glycine soja [wild soybean]
ref|XP_006437140.1|  hypothetical protein CICLE_v10030701mg             246   8e-72   Citrus clementina [clementine]
gb|KDO51887.1|  hypothetical protein CISIN_1g003205mg                   246   1e-71   Citrus sinensis [apfelsine]
ref|XP_002526647.1|  vacuolar protein sorting vps16, putative           245   2e-71   Ricinus communis
gb|KHG27227.1|  Vacuolar sorting-associated protein 16                  243   1e-70   Gossypium arboreum [tree cotton]
gb|KJB10618.1|  hypothetical protein B456_001G211500                    243   1e-70   Gossypium raimondii
ref|XP_011026232.1|  PREDICTED: protein VACUOLELESS1-like isoform X1    241   5e-70   Populus euphratica
ref|XP_003551927.1|  PREDICTED: vacuolar protein sorting-associat...    241   6e-70   
ref|XP_004243213.1|  PREDICTED: protein VACUOLELESS1                    241   6e-70   Solanum lycopersicum
ref|XP_010053830.1|  PREDICTED: protein VACUOLELESS1                    241   7e-70   Eucalyptus grandis [rose gum]
ref|XP_003599782.1|  Vacuolar protein sorting-associated protein-...    241   1e-69   
gb|KEH16900.1|  vacuolar protein sorting-associated-like protein        241   1e-69   Medicago truncatula
gb|KJB10616.1|  hypothetical protein B456_001G211500                    241   1e-69   Gossypium raimondii
gb|AES70033.2|  vacuolar protein sorting-associated-like protein        240   1e-69   Medicago truncatula
ref|XP_009625096.1|  PREDICTED: protein VACUOLELESS1                    240   1e-69   Nicotiana tomentosiformis
ref|XP_002302135.2|  MANGLED family protein                             240   1e-69   
ref|XP_004499978.1|  PREDICTED: vacuolar protein sorting-associat...    239   2e-69   Cicer arietinum [garbanzo]
ref|XP_009790374.1|  PREDICTED: protein VACUOLELESS1                    239   4e-69   Nicotiana sylvestris
ref|XP_003532091.1|  PREDICTED: vacuolar protein sorting-associat...    238   7e-69   Glycine max [soybeans]
gb|KDP24238.1|  hypothetical protein JCGZ_26643                         238   9e-69   Jatropha curcas
ref|XP_002283428.1|  PREDICTED: protein VACUOLELESS1                    238   1e-68   Vitis vinifera
ref|XP_008342344.1|  PREDICTED: protein VACUOLELESS1                    237   2e-68   Malus domestica [apple tree]
ref|XP_009377216.1|  PREDICTED: LOW QUALITY PROTEIN: protein VACU...    237   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_006348963.1|  PREDICTED: vacuolar protein sorting-associat...    237   2e-68   
ref|XP_008465445.1|  PREDICTED: protein VACUOLELESS1                    236   3e-68   Cucumis melo [Oriental melon]
ref|XP_004144632.1|  PREDICTED: vacuolar protein sorting-associat...    236   4e-68   Cucumis sativus [cucumbers]
ref|XP_011044765.1|  PREDICTED: protein VACUOLELESS1-like               235   1e-67   Populus euphratica
ref|XP_010271337.1|  PREDICTED: protein VACUOLELESS1 isoform X1         234   3e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010087860.1|  Vacuolar protein sorting-associated protein ...    233   4e-67   Morus notabilis
ref|XP_007146219.1|  hypothetical protein PHAVU_006G022400g             233   6e-67   Phaseolus vulgaris [French bean]
ref|XP_002306748.1|  MANGLED family protein                             233   8e-67   
ref|XP_008811095.1|  PREDICTED: protein VACUOLELESS1                    232   1e-66   Phoenix dactylifera
ref|XP_010557595.1|  PREDICTED: protein VACUOLELESS1                    232   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_010918871.1|  PREDICTED: protein VACUOLELESS1                    229   2e-65   Elaeis guineensis
ref|XP_009416537.1|  PREDICTED: protein VACUOLELESS1                    226   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303883.1|  PREDICTED: protein VACUOLELESS1 isoform X2         224   7e-64   Fragaria vesca subsp. vesca
ref|XP_011467591.1|  PREDICTED: protein VACUOLELESS1 isoform X1         224   1e-63   Fragaria vesca subsp. vesca
ref|XP_010681470.1|  PREDICTED: protein VACUOLELESS1                    221   8e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW83495.1|  hypothetical protein ZEAMMB73_843554                    200   5e-60   
ref|XP_006854657.1|  hypothetical protein AMTR_s00030p00200210          210   1e-58   Amborella trichopoda
ref|XP_004969467.1|  PREDICTED: vacuolar protein sorting-associat...    203   3e-56   Setaria italica
ref|XP_002456108.1|  hypothetical protein SORBIDRAFT_03g030590          202   6e-56   
dbj|BAB90498.1|  vacuolar protein sorting-associated protein VPS1...    201   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55144.1|  hypothetical protein OsJ_02938                          201   3e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646183.1|  PREDICTED: vacuolar protein sorting-associat...    200   3e-55   Oryza brachyantha
ref|XP_008656726.1|  PREDICTED: protein VACUOLELESS1                    199   1e-54   Zea mays [maize]
ref|XP_001777594.1|  predicted protein                                  194   5e-53   
ref|XP_010232114.1|  PREDICTED: protein VACUOLELESS1                    192   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_002963395.1|  hypothetical protein SELMODRAFT_80688              188   6e-51   
ref|XP_002974680.1|  hypothetical protein SELMODRAFT_101752             187   9e-51   
ref|XP_006296131.1|  hypothetical protein CARUB_v10025283mg             187   2e-50   Capsella rubella
ref|XP_002883710.1|  predicted protein                                  184   6e-50   
emb|CDY14496.1|  BnaC03g20990D                                          185   6e-50   Brassica napus [oilseed rape]
emb|CDY07756.1|  BnaA03g17550D                                          185   6e-50   Brassica napus [oilseed rape]
ref|XP_009133226.1|  PREDICTED: protein VACUOLELESS1                    185   7e-50   Brassica rapa
ref|XP_010505412.1|  PREDICTED: protein VACUOLELESS1-like               185   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002881559.1|  hypothetical protein ARALYDRAFT_321506             185   8e-50   Arabidopsis lyrata subsp. lyrata
dbj|BAJ97322.1|  predicted protein                                      185   9e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_565879.1|  vacuoleless1                                          184   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517084.1|  PREDICTED: protein VACUOLELESS1-like               183   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010509236.1|  PREDICTED: protein VACUOLELESS1                    183   3e-49   Camelina sativa [gold-of-pleasure]
dbj|BAJ33734.1|  unnamed protein product                                181   1e-48   Eutrema halophilum
ref|XP_006411003.1|  hypothetical protein EUTSA_v10016232mg             181   2e-48   Eutrema salsugineum [saltwater cress]
gb|KJB10617.1|  hypothetical protein B456_001G211500                    175   2e-46   Gossypium raimondii
dbj|BAD95263.1|  hypothetical protein                                   154   9e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19612.1|  AT2G38020                                              155   7e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EMS54442.1|  Vacuolar protein sorting-associated protein 16-li...    153   1e-39   Triticum urartu
ref|NP_001078020.1|  vacuoleless1                                       155   5e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10619.1|  hypothetical protein B456_001G211500                    120   7e-27   Gossypium raimondii
ref|XP_004367009.1|  hypothetical protein DFA_07142                     115   3e-25   Cavenderia fasciculata
gb|EFA85317.1|  hypothetical protein PPL_02318                          107   1e-22   Heterostelium album PN500
emb|CEG84393.1|  hypothetical protein RMATCC62417_18202                 101   3e-22   Rhizopus microsporus
ref|XP_646623.2|  hypothetical protein DDB_G0270754                     102   6e-21   Dictyostelium discoideum AX4
dbj|GAN01171.1|  vacuolar protein sorting vps16 protein                 102   1e-20   Mucor ambiguus
ref|XP_003287306.1|  hypothetical protein DICPUDRAFT_32286              102   1e-20   Dictyostelium purpureum
gb|EPB85961.1|  hypothetical protein HMPREF1544_07293                   101   2e-20   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG71651.1|  hypothetical protein RMATCC62417_07353                 101   2e-20   Rhizopus microsporus
ref|XP_005650736.1|  vacuolar protein sorting-associated protein 16     101   2e-20   Coccomyxa subellipsoidea C-169
dbj|GAM26637.1|  hypothetical protein SAMD00019534_098120               100   2e-20   Acytostelium subglobosum LB1
emb|CEP18375.1|  hypothetical protein                                   100   2e-20   Parasitella parasitica
ref|XP_002678979.1|  predicted protein                                  100   4e-20   Naegleria gruberi strain NEG-M
gb|ABC94505.1|  hypothetical protein                                  91.3    5e-19   Ictalurus punctatus
ref|XP_007248949.1|  PREDICTED: vacuolar protein sorting-associat...  97.1    6e-19   
gb|ERZ97236.1|  hypothetical protein GLOINDRAFT_334475                96.3    9e-19   
ref|XP_002591465.1|  hypothetical protein BRAFLDRAFT_105238           96.3    9e-19   Branchiostoma floridae
ref|XP_002598771.1|  hypothetical protein BRAFLDRAFT_212848           95.9    1e-18   Branchiostoma floridae
ref|XP_008121385.1|  PREDICTED: vacuolar protein sorting-associat...  95.9    1e-18   
emb|CDH59927.1|  vacuolar protein sorting vps16                       95.5    2e-18   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007850547.1|  vacuolar protein sorting vps16                   95.1    2e-18   
ref|XP_001641101.1|  predicted protein                                94.4    4e-18   Nematostella vectensis
ref|XP_005518015.1|  PREDICTED: vacuolar protein sorting-associat...  94.0    4e-18   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005431022.1|  PREDICTED: vacuolar protein sorting-associat...  94.4    4e-18   
ref|XP_009462172.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    7e-18   Nipponia nippon
ref|NP_001091659.1|  vacuolar protein sorting-associated protein ...  93.6    7e-18   Danio rerio [leopard danio]
ref|XP_009098195.1|  PREDICTED: vacuolar protein sorting-associat...  94.0    7e-18   
ref|XP_010726024.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    7e-18   Meleagris gallopavo [common turkey]
ref|XP_001943896.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    8e-18   Acyrthosiphon pisum
ref|XP_005435468.1|  PREDICTED: vacuolar protein sorting-associat...  93.6    8e-18   
emb|CDS07252.1|  hypothetical protein LRAMOSA01201                    93.2    8e-18   Lichtheimia ramosa
ref|XP_010566769.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    9e-18   Haliaeetus leucocephalus
ref|XP_005239614.1|  PREDICTED: vacuolar protein sorting-associat...  93.2    9e-18   
ref|XP_005062211.1|  PREDICTED: vacuolar protein sorting-associat...  92.8    1e-17   
gb|EDL80192.1|  vacuolar protein sorting 16 (yeast), isoform CRA_b    87.4    2e-17   Rattus norvegicus [brown rat]
ref|XP_002072009.1|  GK22550                                          92.4    2e-17   Drosophila willistoni
ref|NP_001258079.1|  vacuolar protein sorting-associated protein ...  92.4    2e-17   Gallus gallus [bantam]
ref|XP_004345413.1|  vacuolar assembling/sorting protein VPS16        92.4    2e-17   Capsaspora owczarzaki ATCC 30864
gb|AAH64406.1|  VPS16 protein                                         89.4    2e-17   Homo sapiens [man]
gb|AAI26432.1|  VPS16 protein                                         89.0    2e-17   Homo sapiens [man]
ref|XP_009883933.1|  PREDICTED: vacuolar protein sorting-associat...  92.0    2e-17   Charadrius vociferus
ref|XP_010862318.1|  PREDICTED: vacuolar protein sorting-associat...  92.0    2e-17   Esox lucius
gb|EAX10565.1|  hCG2039972, isoform CRA_b                             89.0    3e-17   Homo sapiens [man]
gb|KIK56666.1|  hypothetical protein GYMLUDRAFT_230051                92.0    3e-17   Gymnopus luxurians FD-317 M1
ref|XP_008495020.1|  PREDICTED: vacuolar protein sorting-associat...  91.7    3e-17   Calypte anna
ref|XP_002096919.1|  GE25939                                          91.7    3e-17   Drosophila yakuba
gb|KDQ31847.1|  hypothetical protein PLEOSDRAFT_48878                 91.7    3e-17   Pleurotus ostreatus PC15
gb|EGU11808.1|  Vacuolar assembling/sorting protein VPS16             91.7    3e-17   Rhodotorula toruloides ATCC 204091
gb|AAH21291.2|  VPS16 protein                                         89.0    4e-17   Homo sapiens [man]
gb|AAH03944.1|  Vps16 protein                                         89.4    4e-17   Mus musculus [mouse]
gb|KIM91586.1|  hypothetical protein PILCRDRAFT_133551                91.3    5e-17   Piloderma croceum F 1598
ref|XP_011238156.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    5e-17   
ref|XP_004661527.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    6e-17   Jaculus jaculus
gb|AAH12422.1|  VPS16 protein                                         89.0    6e-17   Homo sapiens [man]
gb|EHB04285.1|  Vacuolar protein sorting-associated protein 16-li...  90.5    6e-17   Heterocephalus glaber [naked mole rat]
ref|XP_004661526.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    7e-17   Jaculus jaculus
ref|XP_006272323.1|  PREDICTED: vacuolar protein sorting-associat...  90.5    8e-17   Alligator mississippiensis
gb|KFO20539.1|  Vacuolar protein sorting-associated protein 16 li...  90.1    9e-17   Fukomys damarensis [Damara mole rat]
ref|XP_005735068.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   
ref|XP_003030158.1|  hypothetical protein SCHCODRAFT_69044            90.1    1e-16   Schizophyllum commune H4-8
ref|XP_005951517.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   
ref|XP_004886773.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   
ref|XP_005463829.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   
ref|XP_005735066.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   Pundamilia nyererei
ref|XP_005951516.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   Haplochromis burtoni
ref|XP_005951515.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   Haplochromis burtoni
ref|XP_004575656.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   Maylandia zebra
ref|XP_005735067.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   Pundamilia nyererei
ref|XP_004886769.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   
ref|XP_003458681.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    1e-16   Oreochromis niloticus
ref|XP_003134377.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    1e-16   
gb|EPS95124.1|  hypothetical protein FOMPIDRAFT_1043679               89.7    1e-16   Fomitopsis pinicola FP-58527 SS1
ref|XP_002020368.1|  GL13948                                          89.7    1e-16   
gb|AAH73959.1|  VPS16 protein                                         89.0    1e-16   Homo sapiens [man]
gb|EMS22549.1|  vacuolar protein sorting VPS16                        89.7    1e-16   Rhodotorula toruloides NP11
ref|XP_005380824.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   
ref|XP_004634302.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   
ref|XP_006038082.1|  PREDICTED: vacuolar protein sorting-associat...  89.7    2e-16   
gb|KIY47376.1|  vacuolar protein sorting-associated protein 16        89.4    2e-16   Fistulina hepatica ATCC 64428
ref|XP_005380823.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   Chinchilla lanigera
ref|XP_010609328.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   Fukomys damarensis [Damara mole rat]
ref|XP_007636110.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   
ref|XP_005006664.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   
ref|XP_010609327.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   Fukomys damarensis [Damara mole rat]
ref|XP_003134376.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   Sus scrofa [pigs]
ref|XP_003476674.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16   
ref|XP_004634301.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   Octodon degus
ref|XP_003476673.1|  PREDICTED: vacuolar protein sorting-associat...  89.4    2e-16   Cavia porcellus [guinea pig]
ref|XP_005604575.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16   
gb|ERE69810.1|  putative vacuolar protein sorting-associated prot...  89.0    2e-16   Cricetulus griseus [Chinese hamsters]
ref|XP_003499087.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    2e-16   Cricetulus griseus [Chinese hamsters]
ref|XP_001357562.2|  GA21090                                          89.0    3e-16   Drosophila pseudoobscura pseudoobscura
ref|XP_003941102.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16   Saimiri boliviensis boliviensis
ref|XP_004585724.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Ochotona princeps [southern American pika]
ref|XP_008525819.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16   Equus przewalskii [Przewalski horse]
ref|XP_006636484.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    3e-16   Lepisosteus oculatus
dbj|BAC33966.1|  unnamed protein product                              89.0    3e-16   Mus musculus [mouse]
ref|NP_085036.3|  vacuolar protein sorting-associated protein 16 ...  89.0    3e-16   Mus musculus [mouse]
emb|CAD39063.1|  hypothetical protein                                 88.6    3e-16   Homo sapiens [man]
ref|XP_002806793.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  88.6    3e-16   
gb|AAH25626.1|  Vacuolar protein sorting 16 (yeast)                   88.6    3e-16   synthetic construct
gb|KIP07308.1|  hypothetical protein PHLGIDRAFT_426170                88.6    3e-16   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_006500493.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Mus musculus [mouse]
ref|XP_006164053.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   
dbj|BAB64892.1|  Vps16                                                88.6    3e-16   Mus musculus [mouse]
ref|XP_001980849.1|  GG16085                                          88.6    3e-16   Drosophila erecta
ref|XP_005068684.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   
ref|XP_004585723.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Ochotona princeps [southern American pika]
sp|Q920Q4.3|VPS16_MOUSE  RecName: Full=Vacuolar protein sorting-a...  88.6    3e-16   Mus musculus [mouse]
ref|XP_001496814.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   
ref|XP_005320597.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    3e-16   
ref|XP_005068683.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Mesocricetus auratus [Syrian golden hamster]
ref|XP_008852713.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Nannospalax galili
ref|XP_005320596.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Ictidomys tridecemlineatus
ref|XP_007195890.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    3e-16   Balaenoptera acutorostrata scammoni
ref|XP_005874819.1|  PREDICTED: vacuolar protein sorting-associat...  88.6    3e-16   Myotis brandtii
ref|XP_004285369.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
gb|EPQ13004.1|  Vacuolar protein sorting-associated protein 16 li...  88.2    4e-16   Myotis brandtii
ref|NP_001004976.1|  vacuolar protein sorting 16 homolog              88.2    4e-16   Xenopus tropicalis [western clawed frog]
ref|XP_004433876.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_007195891.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Balaenoptera acutorostrata scammoni
ref|XP_007465456.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Lipotes vexillifer [baiji]
ref|NP_536338.1|  vacuolar protein sorting-associated protein 16 ...  88.2    4e-16   Homo sapiens [man]
ref|XP_008017290.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Chlorocebus sabaeus
ref|XP_009214732.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_006894253.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005568560.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_004061764.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_003788109.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_011279227.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Felis catus [cat]
ref|XP_001660915.1|  AAEL010559-PA                                    88.2    4e-16   Aedes aegypti
ref|XP_007195888.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Balaenoptera acutorostrata scammoni
ref|XP_008139241.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_007958199.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Orycteropus afer afer
dbj|BAB71013.1|  unnamed protein product                              88.2    4e-16   Homo sapiens [man]
ref|XP_008568868.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006042778.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_007073325.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Panthera tigris altaica
ref|XP_007898277.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Callorhinchus milii [Australian ghost shark]
ref|XP_005894002.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Bos mutus
ref|XP_004285368.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Orcinus orca [Orca]
ref|XP_006042780.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_004383068.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    4e-16   
gb|KFQ96045.1|  Vacuolar protein sorting-associated protein 16        88.2    4e-16   Nipponia nippon
ref|XP_007958197.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Orycteropus afer afer
ref|XP_010377297.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Rhinopithecus roxellana
ref|XP_008139240.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Eptesicus fuscus
ref|XP_006096450.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  88.2    4e-16   Myotis lucifugus
ref|XP_004317401.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    4e-16   
ref|XP_007195886.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Balaenoptera acutorostrata scammoni
ref|XP_008568869.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004061763.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004433875.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_004014429.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    4e-16   
ref|XP_005894001.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Bos mutus
ref|NP_072097.2|  vacuolar protein sorting-associated protein 16 ...  88.2    4e-16   Homo sapiens [man]
gb|EHH65496.1|  Vacuolar protein sorting-associated protein 16-li...  88.2    4e-16   Macaca fascicularis [crab eating macaque]
ref|XP_009434986.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_007195887.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Balaenoptera acutorostrata scammoni
ref|XP_006042777.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Bubalus bubalis [domestic water buffalo]
ref|XP_004014428.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_008017280.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Chlorocebus sabaeus
tpg|DAA23165.1|  TPA: vacuolar protein sorting-associated protein...  88.2    4e-16   Bos taurus [bovine]
ref|XP_004383066.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_009434988.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   
ref|XP_010834814.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Bison bison bison
ref|NP_001015522.1|  vacuolar protein sorting-associated protein ...  88.2    4e-16   Bos taurus [bovine]
ref|XP_003788108.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Otolemur garnettii
ref|XP_008568870.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    4e-16   Galeopterus variegatus [Malayan flying lemur]
ref|NP_001253119.1|  vacuolar protein sorting-associated protein ...  88.2    4e-16   Macaca mulatta [rhesus macaque]
ref|XP_006894252.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005974817.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005688275.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Capra hircus [domestic goat]
ref|XP_003905036.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Papio anubis [baboon]
ref|XP_005278471.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   
ref|XP_007465455.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Lipotes vexillifer [baiji]
gb|KIO15844.1|  hypothetical protein M407DRAFT_235273                 87.4    5e-16   Tulasnella calospora MUT 4182
ref|XP_002710925.2|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003411664.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  88.2    5e-16   Loxodonta africana [African bush elephant]
ref|XP_004317400.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   
ref|XP_006984591.1|  PREDICTED: vacuolar protein sorting-associat...  88.2    5e-16   Peromyscus maniculatus bairdii
ref|XP_006207386.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    5e-16   
ref|XP_002110165.1|  hypothetical protein TRIADDRAFT_20725            87.8    5e-16   Trichoplax adhaerens
ref|XP_006187202.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    5e-16   Camelus ferus
ref|XP_007539587.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    5e-16   Erinaceus europaeus [common hedgehog]
ref|XP_003639899.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    6e-16   
ref|XP_007539586.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   Erinaceus europaeus [common hedgehog]
ref|XP_010971081.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   Camelus bactrianus [camel]
ref|XP_010971080.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   Camelus bactrianus [camel]
ref|XP_007497007.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   Monodelphis domestica
ref|XP_008046183.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   Carlito syrichta
ref|XP_006207385.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   Vicugna pacos
ref|XP_009565616.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    6e-16   Cuculus canorus
ref|XP_003774363.1|  PREDICTED: vacuolar protein sorting-associat...  87.8    6e-16   
ref|XP_003639898.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    7e-16   Canis lupus familiaris [dogs]
ref|XP_004697935.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    7e-16   Echinops telfairi [lesser hedgehog tenrec]
gb|ELU17286.1|  hypothetical protein CAPTEDRAFT_168734                87.4    8e-16   Capitella teleta
gb|EPY79196.1|  vacuolar protein sorting-associated protein 16 is...  87.4    8e-16   Camelus ferus
ref|XP_006758181.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16   
ref|XP_004697934.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16   
ref|XP_008200104.1|  PREDICTED: vacuolar protein sorting-associat...  87.4    8e-16   
gb|ELK04019.1|  Vacuolar protein sorting-associated protein 16 li...  87.4    9e-16   
gb|EFA13302.1|  hypothetical protein TcasGA2_TC001384                 87.0    9e-16   
gb|AAG34678.1|AF308801_1  vacuolar protein sorting protein 16         87.0    9e-16   
ref|XP_006921721.1|  PREDICTED: vacuolar protein sorting-associat...  87.0    9e-16   
ref|XP_011367811.1|  PREDICTED: vacuolar protein sorting-associat...  87.0    9e-16   
gb|KFP03155.1|  Vacuolar protein sorting-associated protein 16        87.0    1e-15   
ref|XP_005176360.1|  PREDICTED: vacuolar protein sorting-associat...  87.0    1e-15   
ref|XP_004772965.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
gb|ELK34510.1|  Vacuolar protein sorting-associated protein 16 li...  87.0    1e-15   
ref|XP_006732343.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
ref|XP_004398209.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
gb|KGL93811.1|  Vacuolar protein sorting-associated protein 16        86.7    1e-15   
ref|XP_002918844.2|  PREDICTED: vacuolar protein sorting-associat...  87.0    1e-15   
gb|EFB15467.1|  hypothetical protein PANDA_007366                     87.0    1e-15   
ref|XP_006732342.1|  PREDICTED: vacuolar protein sorting-associat...  87.0    1e-15   
ref|XP_004772964.1|  PREDICTED: vacuolar protein sorting-associat...  87.0    1e-15   
gb|KIM67291.1|  hypothetical protein SCLCIDRAFT_179253                86.7    1e-15   
ref|XP_004398208.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
ref|NP_001005541.1|  vacuolar protein sorting-associated protein ...  86.7    1e-15   
ref|XP_008701652.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
ref|XP_011191448.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
ref|XP_004523432.1|  PREDICTED: vacuolar protein sorting-associat...  86.7    1e-15   
ref|XP_005365673.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    2e-15   
ref|XP_007127204.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    2e-15   
ref|XP_005365672.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    2e-15   
ref|NP_649877.1|  vacuolar protein sorting 16A                        86.3    2e-15   
ref|XP_004930556.1|  PREDICTED: vacuolar protein sorting-associat...  86.3    2e-15   
ref|XP_009231695.1|  PREDICTED: vacuolar protein sorting-associat...  85.9    3e-15   
ref|XP_009231696.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    3e-15   
ref|XP_006874900.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    3e-15   
ref|XP_006874899.1|  PREDICTED: vacuolar protein sorting-associat...  85.5    3e-15   
ref|XP_004687407.1|  PREDICTED: vacuolar protein sorting-associat...  85.1    3e-15   
ref|XP_003488666.1|  PREDICTED: vacuolar protein sorting-associat...  85.1    4e-15   
ref|XP_009052918.1|  hypothetical protein LOTGIDRAFT_115951           85.1    4e-15   
gb|EMD35361.1|  hypothetical protein CERSUDRAFT_66538                 85.1    4e-15   
ref|XP_004687406.1|  PREDICTED: vacuolar protein sorting-associat...  85.1    4e-15   
gb|KIK92586.1|  hypothetical protein PAXRUDRAFT_146989                85.1    4e-15   
ref|XP_001699374.1|  VPS16-like protein                               85.1    5e-15   
ref|XP_004611017.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    5e-15   
ref|XP_003394905.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    5e-15   
gb|KIK24542.1|  hypothetical protein PISMIDRAFT_645755                84.7    6e-15   
ref|XP_004611016.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    6e-15   
ref|XP_002000799.1|  GI10429                                          84.3    7e-15   
ref|XP_002055907.1|  GJ10645                                          84.3    8e-15   
ref|XP_011212493.1|  PREDICTED: vacuolar protein sorting-associat...  84.3    8e-15   
ref|XP_004340672.1|  vacuolar protein sorting 16, putative            84.3    8e-15   
gb|ETN68096.1|  vacuolar protein sorting vps16                        84.0    9e-15   
gb|KDR80313.1|  hypothetical protein GALMADRAFT_62817                 84.0    9e-15   
ref|XP_007869321.1|  vacuolar assembling/sorting protein VPS16        84.0    1e-14   
ref|XP_002031925.1|  GM23792                                          83.6    1e-14   
ref|XP_005812181.1|  PREDICTED: vacuolar protein sorting-associat...  83.6    1e-14   
ref|XP_002104149.1|  GD18603                                          83.6    1e-14   
ref|XP_005812180.1|  PREDICTED: vacuolar protein sorting-associat...  83.6    1e-14   
ref|XP_007540621.1|  PREDICTED: vacuolar protein sorting-associat...  83.6    1e-14   
ref|XP_008434411.1|  PREDICTED: vacuolar protein sorting-associat...  83.6    1e-14   
ref|XP_007371512.1|  vacuolar protein sorting-associated protein 16   83.2    2e-14   
ref|XP_007301979.1|  vacuolar assembling/sorting protein VPS16        83.2    2e-14   
gb|KIY70700.1|  vacuolar assembling/sorting protein VPS16             83.2    2e-14   
ref|XP_003332386.2|  hypothetical protein PGTG_13771                  82.8    3e-14   
emb|CCL98206.1|  predicted protein                                    82.8    3e-14   
emb|CDO74588.1|  hypothetical protein BN946_scf184583.g15             82.4    3e-14   
ref|XP_001954740.1|  GF16588                                          82.4    3e-14   
ref|XP_499728.1|  YALI0A03553p                                        82.4    3e-14   
gb|KIJ15884.1|  hypothetical protein PAXINDRAFT_168867                82.4    3e-14   
gb|KIK32973.1|  hypothetical protein CY34DRAFT_813942                 82.4    3e-14   
ref|XP_007876459.1|  hypothetical protein PFL1_00766                  82.4    3e-14   
ref|XP_001842734.1|  vacuolar protein sorting vps16                   82.4    3e-14   
ref|XP_004469198.1|  PREDICTED: vacuolar protein sorting-associat...  82.0    4e-14   
gb|KIM47049.1|  hypothetical protein M413DRAFT_440594                 82.0    4e-14   
ref|XP_004210014.1|  PREDICTED: vacuolar protein sorting-associat...  79.0    4e-14   
gb|KIJ59378.1|  hypothetical protein HYDPIDRAFT_118596                82.0    4e-14   
gb|KDR24089.1|  Vacuolar protein sorting-associated protein 16-li...  82.0    4e-14   
dbj|GAA99834.1|  hypothetical protein E5Q_06537                       82.0    5e-14   
gb|EHJ78397.1|  putative vacuolar protein sorting vps16               81.3    5e-14   
ref|XP_008469959.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    5e-14   
ref|XP_008042309.1|  vacuolar protein sorting-associated protein 16   81.6    5e-14   
ref|XP_008323608.1|  PREDICTED: vacuolar protein sorting-associat...  81.6    6e-14   
ref|XP_781126.3|  PREDICTED: vacuolar protein sorting-associated ...  81.6    6e-14   
gb|KII87631.1|  hypothetical protein PLICRDRAFT_111626                81.3    7e-14   
ref|XP_011348407.1|  PREDICTED: vacuolar protein sorting-associat...  81.3    7e-14   
ref|XP_798591.3|  PREDICTED: vacuolar protein sorting-associated ...  81.3    7e-14   
gb|KJA15614.1|  hypothetical protein HYPSUDRAFT_1068261               80.9    1e-13   
ref|XP_011056171.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    1e-13   
ref|XP_005839798.1|  hypothetical protein GUITHDRAFT_161084           80.9    1e-13   
ref|XP_007384243.1|  vacuolar assembling/sorting protein VPS16        80.9    1e-13   
emb|CEI87038.1|  hypothetical protein RMCBS344292_01458               80.9    1e-13   
ref|XP_001832533.2|  vacuolar protein sorting 16 isoform 1            80.5    1e-13   
ref|XP_011173487.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    1e-13   
ref|XP_006463395.1|  hypothetical protein AGABI2DRAFT_208148          80.5    1e-13   
ref|XP_001996143.1|  GH14334                                          80.5    1e-13   
ref|XP_007331990.1|  hypothetical protein AGABI1DRAFT_77347           80.1    2e-13   
gb|ENN73877.1|  hypothetical protein YQE_09530                        80.1    2e-13   
gb|ENN73876.1|  hypothetical protein YQE_09530                        80.1    2e-13   
gb|KFH65750.1|  hypothetical protein MVEG_07854                       80.1    2e-13   
ref|XP_011500721.1|  PREDICTED: vacuolar protein sorting-associat...  76.6    2e-13   
ref|XP_009550055.1|  hypothetical protein HETIRDRAFT_325388           79.7    2e-13   
gb|KIL59455.1|  hypothetical protein M378DRAFT_85025                  79.7    2e-13   
gb|ERL93903.1|  hypothetical protein D910_11189                       79.7    2e-13   
gb|KIO05251.1|  hypothetical protein M404DRAFT_141113                 79.7    3e-13   
ref|XP_007270430.1|  vacuolar protein sorting-associated protein 16   79.3    3e-13   
gb|KFB37904.1|  AGAP000529-PA-like protein                            79.3    3e-13   
ref|XP_005511806.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  79.3    3e-13   
gb|EPY49689.1|  HOPS complex subunit Vps16                            79.3    3e-13   
ref|XP_011251370.1|  PREDICTED: vacuolar protein sorting-associat...  79.3    3e-13   
emb|CCJ28605.1|  unnamed protein product                              79.3    3e-13   
emb|CBK22798.2|  unnamed protein product                              73.9    3e-13   
ref|XP_007393336.1|  hypothetical protein PHACADRAFT_193129           79.0    4e-13   
ref|XP_007351763.1|  vacuolar protein sorting-associated protein 16   78.6    5e-13   
ref|XP_011420359.1|  PREDICTED: vacuolar protein sorting-associat...  78.6    5e-13   
ref|XP_003706212.1|  PREDICTED: vacuolar protein sorting-associat...  78.6    5e-13   
ref|XP_003706213.1|  PREDICTED: vacuolar protein sorting-associat...  78.6    5e-13   
ref|XP_011420366.1|  PREDICTED: vacuolar protein sorting-associat...  78.6    5e-13   
gb|KFM68340.1|  hypothetical protein X975_12661                       78.2    6e-13   
emb|CCA70355.1|  related to vacuolar protein sorting VACUOLELESS1     78.2    7e-13   
ref|XP_009859508.1|  PREDICTED: vacuolar protein sorting-associat...  78.2    7e-13   
ref|XP_002428971.1|  vacuolar protein sorting, putative               78.2    8e-13   
gb|EJU02203.1|  vacuolar protein sorting-associated protein 16        77.8    9e-13   
ref|XP_003690002.1|  PREDICTED: vacuolar protein sorting-associat...  77.8    1e-12   
ref|XP_007771096.1|  vacuolar assembling sorting protein VPS16        77.8    1e-12   
ref|XP_006567258.1|  PREDICTED: vacuolar protein sorting-associat...  77.4    1e-12   
ref|XP_006567257.1|  PREDICTED: vacuolar protein sorting-associat...  77.4    1e-12   
ref|XP_006617477.1|  PREDICTED: vacuolar protein sorting-associat...  77.4    1e-12   
ref|XP_006617476.1|  PREDICTED: vacuolar protein sorting-associat...  77.4    1e-12   
ref|XP_006617475.1|  PREDICTED: vacuolar protein sorting-associat...  77.4    1e-12   
gb|EZA48287.1|  Vacuolar protein sorting-associated protein 16-li...  77.4    1e-12   
ref|XP_392642.2|  PREDICTED: vacuolar protein sorting-associated ...  77.4    1e-12   
gb|KDQ19047.1|  hypothetical protein BOTBODRAFT_28535                 77.0    2e-12   
gb|EPX74952.1|  HOPS complex subunit Vps16                            77.0    2e-12   
ref|XP_007873550.1|  hypothetical protein PNEG_01594                  76.6    2e-12   
ref|XP_007873551.1|  hypothetical protein, variant                    76.6    2e-12   
ref|XP_011500724.1|  PREDICTED: vacuolar protein sorting-associat...  76.6    2e-12   
ref|XP_310557.3|  AGAP000529-PA                                       76.6    2e-12   
ref|XP_002401625.1|  vacuolar protein-sorting protein, putative       76.3    3e-12   
ref|XP_007313955.1|  hypothetical protein SERLADRAFT_365727           76.3    3e-12   
ref|XP_004084634.2|  PREDICTED: vacuolar protein sorting-associat...  75.9    3e-12   
ref|XP_009267078.1|  putative vacuolar protein sorting-associated...  76.3    3e-12   
dbj|GAC75011.1|  predicted metalloprotease with chaperone activity    76.3    3e-12   
gb|KIK00029.1|  hypothetical protein K443DRAFT_101182                 76.3    3e-12   
gb|EIE83259.1|  hypothetical protein RO3G_07964                       75.9    3e-12   
dbj|GAK67926.1|  vacuolar assembling/sorting protein VPS16            75.9    4e-12   
gb|ETS65113.1|  hypothetical protein PaG_00571                        75.9    4e-12   
ref|XP_011305829.1|  PREDICTED: vacuolar protein sorting-associat...  75.5    5e-12   
emb|CAG01327.1|  unnamed protein product                              75.5    5e-12   
gb|KDE08398.1|  hypothetical protein MVLG_01434                       75.5    5e-12   
dbj|GAC99770.1|  hypothetical protein PHSY_007373                     75.5    6e-12   
ref|XP_007440032.1|  PREDICTED: vacuolar protein sorting-associat...  75.1    6e-12   
emb|CEJ04542.1|  Putative Vacuolar protein sorting protein vps16      69.7    7e-12   
ref|XP_003966794.1|  PREDICTED: vacuolar protein sorting-associat...  75.1    7e-12   
gb|KHJ32046.1|  putative vacuolar protein sorting-associated protein  74.7    9e-12   
ref|XP_001881053.1|  vacuolar assembling/sorting protein VPS16        74.7    1e-11   
ref|XP_009015970.1|  hypothetical protein HELRODRAFT_106217           74.3    1e-11   
ref|XP_011403010.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    1e-11   
gb|KDQ58687.1|  hypothetical protein JAAARDRAFT_57575                 74.3    1e-11   
ref|NP_593444.1|  HOPS complex subunit Vps16 (predicted)              74.3    1e-11   
ref|XP_011154335.1|  PREDICTED: vacuolar protein sorting-associat...  74.3    1e-11   
gb|EFX68012.1|  hypothetical protein DAPPUDRAFT_63503                 74.3    1e-11   
gb|KEQ80575.1|  vacuolar protein sorting-associated protein 16        74.3    1e-11   
gb|KDN52476.1|  hypothetical protein K437DRAFT_214166                 73.9    2e-11   
ref|XP_002837491.1|  hypothetical protein                             73.6    2e-11   
gb|KFM13117.1|  Vacuolar protein sorting-associated protein 16        73.6    2e-11   
ref|XP_002679841.1|  predicted protein                                73.6    2e-11   
ref|XP_009285828.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    2e-11   
ref|XP_008298594.1|  PREDICTED: vacuolar protein sorting-associat...  73.2    3e-11   
ref|XP_006010586.1|  PREDICTED: vacuolar protein sorting-associat...  72.8    3e-11   
ref|XP_007004384.1|  hypothetical protein TREMEDRAFT_71557            72.8    3e-11   
gb|EST04654.1|  hypothetical protein PSEUBRA_SCAF9g01385              72.8    3e-11   
gb|KEQ63929.1|  vacuolar protein sorting-associated protein 16        72.8    4e-11   
ref|NP_001153367.1|  vacuolar protein sorting 16 homolog A            72.8    4e-11   
gb|KFH03825.1|  Vps16, N-terminal region protein                      72.0    4e-11   
ref|XP_006959833.1|  hypothetical protein WALSEDRAFT_61128            72.4    5e-11   
gb|KFG58808.1|  Vps16, N-terminal region protein                      72.0    5e-11   
emb|CBQ68702.1|  related to vacuolar protein sorting 16               72.4    6e-11   
ref|XP_010747877.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    6e-11   
ref|XP_008558295.1|  PREDICTED: vacuolar protein sorting-associat...  72.0    6e-11   
ref|XP_011117417.1|  hypothetical protein AOL_s00004g466              72.0    7e-11   
gb|KFG43286.1|  Vps16, N-terminal region protein                      71.6    7e-11   
gb|EPS57825.1|  hypothetical protein M569_16992                       68.6    8e-11   
gb|KEQ96076.1|  hypothetical protein AUEXF2481DRAFT_64917             71.6    8e-11   
gb|EPR58066.1|  putative vacuolar protein sorting 16                  71.6    9e-11   
ref|XP_002369923.1|  hypothetical protein, conserved                  71.6    9e-11   
gb|ESS29871.1|  putative vacuolar protein sorting 16                  71.6    9e-11   
ref|XP_009823468.1|  hypothetical protein H257_01794                  71.6    9e-11   
ref|XP_008866355.1|  hypothetical protein H310_04019                  71.6    9e-11   
gb|KFQ73920.1|  Vacuolar protein sorting-associated protein 16        71.2    1e-10   
gb|KGB80280.1|  vacuolar assembling/sorting protein VPS16             71.2    1e-10   
ref|XP_007674604.1|  hypothetical protein BAUCODRAFT_66530            71.2    1e-10   
ref|XP_010284296.1|  PREDICTED: vacuolar protein sorting-associat...  71.2    1e-10   
ref|XP_003740727.1|  PREDICTED: vacuolar protein sorting-associat...  71.2    1e-10   
ref|XP_009908341.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  71.2    1e-10   
gb|KIY31247.1|  vacuolar protein sorting-associated protein           70.9    1e-10   
emb|CCX31232.1|  Similar to Probable vacuolar protein sorting-ass...  70.9    2e-10   
gb|KFG27752.1|  Vps16, amine-terminal domain protein                  66.2    2e-10   
ref|XP_569075.1|  vacuole organization and biogenesis-related pro...  70.9    2e-10   
ref|XP_776977.1|  hypothetical protein CNBB5050                       70.5    2e-10   
ref|XP_007404251.1|  hypothetical protein MELLADRAFT_32963            70.5    2e-10   
gb|KDO30335.1|  hypothetical protein SPRG_05046                       70.5    2e-10   
gb|KIR50703.1|  vacuolar protein sorting-associated protein           70.1    2e-10   
gb|KIR45019.1|  vacuolar protein sorting-associated protein           70.1    2e-10   
gb|KJE01407.1|  vacuolar protein sorting-associated protein           70.1    3e-10   
gb|KIR83430.1|  vacuolar protein sorting-associated protein           70.1    3e-10   
gb|KIR57748.1|  vacuolar protein sorting-associated protein           70.1    3e-10   
ref|XP_008606140.1|  hypothetical protein SDRG_02337                  70.1    3e-10   
ref|XP_003192484.1|  vacuole organization and biogenesis-related ...  70.1    3e-10   
gb|KIR76852.1|  vacuolar protein sorting-associated protein           70.1    3e-10   
gb|EFQ25156.1|  hypothetical protein GLRG_00300                       70.1    3e-10   
gb|KIR25553.1|  vacuolar protein sorting-associated protein           70.1    3e-10   
gb|KIR31200.1|  vacuolar protein sorting-associated protein           70.1    3e-10   
ref|XP_005713227.1|  unnamed protein product                          65.9    4e-10   
emb|CDJ38705.1|  hypothetical protein, conserved                      68.9    4e-10   
ref|XP_001744942.1|  hypothetical protein                             69.7    4e-10   
ref|XP_009658018.1|  vacuolar protein sorting-associated protein      69.7    4e-10   
ref|XP_007922652.1|  hypothetical protein MYCFIDRAFT_60175            69.3    4e-10   
ref|XP_008887993.1|  vacuolar protein sorting 16, putative            69.7    4e-10   
ref|XP_003655439.1|  hypothetical protein THITE_2119126               69.3    5e-10   
gb|KFV61198.1|  Vacuolar protein sorting-associated protein 16        69.3    5e-10   
gb|KEQ75501.1|  vacuolar protein sorting-associated protein 16        69.3    5e-10   
emb|CCF48914.1|  related to vacuolar protein sorting 16               69.3    5e-10   
gb|EWC48561.1|  hypothetical protein DRE_01783                        68.9    7e-10   



>gb|KDO51889.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=449

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALAT RDWDALE+FSKEKRPPIGY
Sbjct  305  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGY  364

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  365  RPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  424

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  425  TFAQNAAASSIFDTLRDRLSFQGVS  449



>gb|AFK37940.1| unknown [Lotus japonicus]
Length=375

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  231  SDTIRTCIVLGNHRAATKVKTEFKVSEKRWYWLKVFALATIKDWVALEKFSKEKKPPIGY  290

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA +KGEA+KYIPKLADPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  291  RPFVEACIEANEKGEAIKYIPKLADPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  350

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA+SIFDTLRDRL+F G S
Sbjct  351  TFSQNAAASSIFDTLRDRLSFPGAS  375



>gb|KDO51888.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=618

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALAT RDWDALE+FSKEKRPPIGY
Sbjct  474  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGY  533

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  534  RPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  593

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  594  TFAQNAAASSIFDTLRDRLSFQGVS  618



>ref|XP_011082899.1| PREDICTED: protein VACUOLELESS1 [Sesamum indicum]
Length=840

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAANKVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  696  SDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  755

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A +K +ALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  756  RPFVEACVDAGEKDQALKYIPKLADPRERAEAYAKIGMAKEAADAASQAKDGELLGRLKL  815

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAAASIFDTLRDRL+FQG S
Sbjct  816  TFAQNAAAASIFDTLRDRLSFQGVS  840



>ref|XP_007214933.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
 gb|EMJ16132.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
Length=844

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEALKYIPKL DPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIEADEKGEALKYIPKLTDPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  820  TFSQNAAASSIFDTLRDRLSFQGVS  844



>ref|XP_007048987.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
 gb|EOX93144.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
Length=809

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  665  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  724

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  725  RPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  784

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  785  TFAQNAAASSLFDTLRDRLSFQGVS  809



>ref|XP_007048986.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
 gb|EOX93143.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
Length=844

 Score =   249 bits (637),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  820  TFAQNAAASSLFDTLRDRLSFQGVS  844



>ref|XP_008229565.1| PREDICTED: protein VACUOLELESS1 [Prunus mume]
Length=841

 Score =   249 bits (637),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWD LEKFSKEKRPPIGY
Sbjct  697  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDVLEKFSKEKRPPIGY  756

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACVEA++KGEALKYIPKL DPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  757  RPFVEACVEADEKGEALKYIPKLTDPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  816

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  817  TFSQNAAASSIFDTLRDRLSFQGVS  841



>ref|XP_006387719.1| hypothetical protein POPTR_0647s00230g, partial [Populus trichocarpa]
 gb|ERP46633.1| hypothetical protein POPTR_0647s00230g, partial [Populus trichocarpa]
Length=201

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LGNHRAA +VK EFKVSEKRWYWLKV AL TIRDW+ALEKFSKEKRPP+G+
Sbjct  57   SDTIRTCIALGNHRAAMRVKTEFKVSEKRWYWLKVLALVTIRDWEALEKFSKEKRPPMGF  116

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  117  RPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  176

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  177  SFAQNTAASSIFDTLRDRLSFQGVS  201



>ref|XP_007048985.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
 gb|EOX93142.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
Length=874

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  730  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  789

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  790  RPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  849

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  850  TFAQNAAASSLFDTLRDRLSFQGVS  874



>emb|CDP06151.1| unnamed protein product [Coffea canephora]
Length=840

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  696  SDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  755

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++KGEALKYIPKL+DPRERAEAYA IGMAKEAADAASQAKD ELLGRLKL
Sbjct  756  RPFVEACIDADEKGEALKYIPKLSDPRERAEAYARIGMAKEAADAASQAKDNELLGRLKL  815

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  816  TFSQNAAASSIFDTLRDRLSFQGVS  840



>ref|XP_011026233.1| PREDICTED: protein VACUOLELESS1-like isoform X2 [Populus euphratica]
Length=575

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPP G+
Sbjct  431  SDTIRTCIALGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPNGF  490

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  491  RPFVEACIDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  550

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  551  SFAQNTAASSIFDTLRDRLSFQGVS  575



>gb|EYU33990.1| hypothetical protein MIMGU_mgv1a001320mg [Erythranthe guttata]
Length=840

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAANKVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  696  SDTIRTCIVLGNHRAANKVKVEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  755

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A +K EALKYIPKLADPRE+AEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  756  RPFVEACVDAGEKDEALKYIPKLADPREKAEAYARIGMAKEAADAASQAKDGELLGRLKL  815

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QNAAA+SIFDTLRDRL+FQG S
Sbjct  816  SFAQNAAASSIFDTLRDRLSFQGVS  840



>gb|KHN35900.1| Vacuolar protein sorting-associated protein 16 like [Glycine 
soja]
Length=613

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  470  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIKDWVALEKFSKEKKPPIGY  529

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  530  RPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  589

Query  397  TFSQNAAAASIFDTLRDRLTFQG  329
            TF+QNAAA+SIFDTLRDRL+FQG
Sbjct  590  TFAQNAAASSIFDTLRDRLSFQG  612



>ref|XP_006437140.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
 ref|XP_006484899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Citrus sinensis]
 gb|ESR50380.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
Length=839

 Score =   246 bits (629),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALAT RDWDALE+FSKEKRPPIGY
Sbjct  695  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGY  754

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  755  RPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  814

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  815  TFAQNAAASSIFDTLRDRLSFQGVS  839



>gb|KDO51887.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=839

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALAT RDWDALE+FSKEKRPPIGY
Sbjct  695  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGY  754

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  755  RPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  814

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  815  TFAQNAAASSIFDTLRDRLSFQGVS  839



>ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis]
 gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis]
Length=851

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  708  SDTIRTCIVLGNHRAAIKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  767

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++KGEALKYIPKLADPRERAEAYA +GMAKEAADAASQAKDGELLGRLKL
Sbjct  768  RPFVEACIDADEKGEALKYIPKLADPRERAEAYARVGMAKEAADAASQAKDGELLGRLKL  827

Query  397  TFSQNAAAASIFDTLRDRLTFQGT  326
            +F+QN AA+SIFDTLRDRL+FQG 
Sbjct  828  SFAQNTAASSIFDTLRDRLSFQGV  851



>gb|KHG27227.1| Vacuolar sorting-associated protein 16 [Gossypium arboreum]
Length=789

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIGY
Sbjct  645  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIGY  704

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++KGEALKYIPKLAD RERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  705  RPFVEACIDADEKGEALKYIPKLADLRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  764

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  765  TFAQNAAASSLFDTLRDRLSFQGVS  789



>gb|KJB10618.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=844

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKLAD RERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACVDADEKGEALKYIPKLADLRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  820  TFAQNAAASSLFDTLRDRLSFQGVS  844



>ref|XP_011026232.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Populus euphratica]
Length=844

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPP G+
Sbjct  700  SDTIRTCIALGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPNGF  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  820  SFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIKDWVALEKFSKEKKPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQG  329
            TF+QNAAA+SIFDTLRDRL+FQG
Sbjct  820  TFAQNAAASSIFDTLRDRLSFQG  842



>ref|XP_004243213.1| PREDICTED: protein VACUOLELESS1 [Solanum lycopersicum]
Length=843

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHR AN+VK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  699  SDTIRTCIVLGNHRGANRVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  758

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A +KGEALKYIPKL DPRERAEAYA IGMAKEAADAA+QAKD ELLGRLK 
Sbjct  759  RPFVEACVDANEKGEALKYIPKLTDPRERAEAYARIGMAKEAADAATQAKDNELLGRLKQ  818

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA+SIFDTLRDRL+F   S
Sbjct  819  TFSQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_010053830.1| PREDICTED: protein VACUOLELESS1 [Eucalyptus grandis]
Length=843

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KV+ EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  702  SDTIRTCIVLGNHRAAMKVRTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  761

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  762  RPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  821

Query  397  TFSQNAAAASIFDTLRDRL  341
            TFSQNAAA+SIFDTLRDRL
Sbjct  822  TFSQNAAASSIFDTLRDRL  840



>ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=856

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  712  SDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWAALEKFSKEKKPPIGY  771

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADAA+Q+KDGELLGRLKL
Sbjct  772  RPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADAAAQSKDGELLGRLKL  831

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  832  TFAQNAAASSIFDTLRDRLSFQGAS  856



>gb|KEH16900.1| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  706  SDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWAALEKFSKEKKPPIGY  765

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADAA+Q+KDGELLGRLKL
Sbjct  766  RPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADAAAQSKDGELLGRLKL  825

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  826  TFAQNAAASSIFDTLRDRLSFQGAS  850



>gb|KJB10616.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=888

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKLAD RERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACVDADEKGEALKYIPKLADLRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQG  329
            TF+QNAAA+S+FDTLRDRL+FQG
Sbjct  820  TFAQNAAASSLFDTLRDRLSFQG  842



>gb|AES70033.2| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  706  SDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWAALEKFSKEKKPPIGY  765

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADAA+Q+KDGELLGRLKL
Sbjct  766  RPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADAAAQSKDGELLGRLKL  825

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  826  TFAQNAAASSIFDTLRDRLSFQGAS  850



>ref|XP_009625096.1| PREDICTED: protein VACUOLELESS1 [Nicotiana tomentosiformis]
Length=843

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  699  SDTIRTCIVLGNHRAAAKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  758

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADAASQAKD ELLGRLK 
Sbjct  759  RPFVEACVDADEKGEALKYIPKLTDPRERAEAYARIGMAKEAADAASQAKDNELLGRLKQ  818

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+F   S
Sbjct  819  TFAQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_002302135.2| MANGLED family protein [Populus trichocarpa]
 gb|EEE81408.2| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPP G+
Sbjct  700  SDTIRTCIALGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPNGF  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A +KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIDAAEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  820  SFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_004499978.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cicer arietinum]
Length=850

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  706  SDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWAALEKFSKEKKPPIGY  765

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  766  RPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADAASQAKDGELLGRLKL  825

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNA A+SIFDTLRDRL+FQG S
Sbjct  826  TFAQNAGASSIFDTLRDRLSFQGAS  850



>ref|XP_009790374.1| PREDICTED: protein VACUOLELESS1 [Nicotiana sylvestris]
Length=843

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  699  SDTIRTCIVLGNHRAAAKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  758

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAEAYA +GMAKEAADAASQAKD ELLGRLK 
Sbjct  759  RPFVEACVDADEKGEALKYIPKLTDPRERAEAYARVGMAKEAADAASQAKDNELLGRLKQ  818

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRL+F   S
Sbjct  819  TFAQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGN+RAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PPIGY
Sbjct  700  SDTIRTCIVLGNNRAAMKVKTEFKVSEKRWYWLKVFALATIKDWVALEKFSKEKKPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQG  329
            TF+QNAAA+SIFDTLRDRL+FQG
Sbjct  820  TFAQNAAASSIFDTLRDRLSFQG  842



>gb|KDP24238.1| hypothetical protein JCGZ_26643 [Jatropha curcas]
Length=847

 Score =   238 bits (607),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI +GNHRAA KVK EFKVSEKRWYWLKVF LAT RDWDALEKFSKEKRPPIGY
Sbjct  703  SDTIRTCIAMGNHRAAMKVKTEFKVSEKRWYWLKVFGLATKRDWDALEKFSKEKRPPIGY  762

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++K EALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  763  RPFVEACIDADEKSEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  822

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  823  SFAQNTAASSIFDTLRDRLSFQGVS  847



>ref|XP_002283428.1| PREDICTED: protein VACUOLELESS1 [Vitis vinifera]
 emb|CBI22093.3| unnamed protein product [Vitis vinifera]
Length=838

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  697  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  756

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++KGEALKYIPKL DPRERAE+YA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  757  RPFVEACIDADEKGEALKYIPKLTDPRERAESYARIGMAKEAADAASQAKDGELLGRLKL  816

Query  397  TFSQNAAAASIFDTLRDRL  341
            TF+QNAAA+SIFDTLRDRL
Sbjct  817  TFAQNAAASSIFDTLRDRL  835



>ref|XP_008342344.1| PREDICTED: protein VACUOLELESS1 [Malus domestica]
Length=840

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAE+YA IGMAKEAADAASQAKDGELLGRLK+
Sbjct  760  RPFVEACVDADEKGEALKYIPKLTDPRERAESYARIGMAKEAADAASQAKDGELLGRLKM  819

Query  397  TFSQNAAAASIFDTLRDRLT  338
            TFSQNAAA+SIFDTLRDR  
Sbjct  820  TFSQNAAASSIFDTLRDRFV  839



>ref|XP_009377216.1| PREDICTED: LOW QUALITY PROTEIN: protein VACUOLELESS1 [Pyrus x 
bretschneideri]
Length=831

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY
Sbjct  691  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  750

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEACV+A++KGEALKYIPKL DPRERAE+YA IGMAKEAADAASQAKDGELLGRLK+
Sbjct  751  RPFVEACVDADEKGEALKYIPKLTDPRERAESYARIGMAKEAADAASQAKDGELLGRLKM  810

Query  397  TFSQNAAAASIFDTLRDRLT  338
            TFSQNAAA+SIFDTLRDR  
Sbjct  811  TFSQNAAASSIFDTLRDRFV  830



>ref|XP_006348963.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solanum tuberosum]
Length=844

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKV-SEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  581
            SDTIRTCIVLGNHRAA KVK EFKV SEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG
Sbjct  699  SDTIRTCIVLGNHRAAMKVKTEFKVLSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  758

Query  580  YKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLK  401
            Y+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADAA+QAKD ELLGRLK
Sbjct  759  YRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARIGMAKEAADAATQAKDNELLGRLK  818

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNAAA+SIFDTLRDRL+F   S
Sbjct  819  QTFSQNAAASSIFDTLRDRLSFPSVS  844



>ref|XP_008465445.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
 ref|XP_008465446.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
Length=844

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALAT RDW ALE FSKEKRPPIGY
Sbjct  700  NDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATTRDWVALETFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEACVEA++K EA+KYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  KPFVEACVEADEKAEAVKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QN+AA+SIFDTLRDRL+F G S
Sbjct  820  TFAQNSAASSIFDTLRDRLSFPGVS  844



>ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cucumis sativus]
 gb|KGN54934.1| hypothetical protein Csa_4G608100 [Cucumis sativus]
Length=844

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALAT RDW ALE FSKEKRPPIGY
Sbjct  700  NDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATTRDWVALETFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEACVEA++K EA+KYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  KPFVEACVEADEKAEAVKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QN+AA+SIFDTLRDRL+F G S
Sbjct  820  TFAQNSAASSIFDTLRDRLSFPGVS  844



>ref|XP_011044765.1| PREDICTED: protein VACUOLELESS1-like [Populus euphratica]
Length=844

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LGNHRAA +VK EFKVSEKRWYWLKVFAL TIRDW+ALEKFSKEKRPP+G+
Sbjct  700  SDTIRTCIALGNHRAAMRVKTEFKVSEKRWYWLKVFALVTIRDWEALEKFSKEKRPPMGF  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  820  SFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_010271337.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Nelumbo nucifera]
Length=841

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGNHRAA KV+ EFKVSEKRWYWLKVFAL T RDWDALEKFSKEKRPP GY
Sbjct  697  NDTIRTCIVLGNHRAAMKVRTEFKVSEKRWYWLKVFALVTTRDWDALEKFSKEKRPPTGY  756

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEACV+A +K EA+KYIPKLADPRE+AEAYA +GMAKEAADAASQ+KD ELLG+LKL
Sbjct  757  KPFVEACVDAGEKDEAIKYIPKLADPREKAEAYARLGMAKEAADAASQSKDNELLGKLKL  816

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TF+QNAAA+SIFDTLRDRLTFQG S
Sbjct  817  TFAQNAAASSIFDTLRDRLTFQGGS  841



>ref|XP_010087860.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
 gb|EXB30296.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
Length=842

 Score =   233 bits (595),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFAL+TIRDWDALEKFS+EKRPPIG+
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALSTIRDWDALEKFSREKRPPIGF  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEALKYIPKL DPRERAE+YA IGMAKEAADAASQAKDGELLGRLK 
Sbjct  760  RPFVEACIEADEKGEALKYIPKLTDPRERAESYARIGMAKEAADAASQAKDGELLGRLKS  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA+SIFDTLR   +FQG S
Sbjct  820  TFSQNAAASSIFDTLRS--SFQGVS  842



>ref|XP_007146219.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
 gb|ESW18213.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
Length=843

 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATI+DW ALEKFSKEK+PP+G+
Sbjct  700  NDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWVALEKFSKEKKPPMGF  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++K EA+KYIPKLADPRERAE+YA IG+AKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIEADEKAEAIKYIPKLADPRERAESYARIGLAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQG  329
            TF+QNAAA+SIFDTLRDRL+FQG
Sbjct  820  TFAQNAAASSIFDTLRDRLSFQG  842



>ref|XP_002306748.1| MANGLED family protein [Populus trichocarpa]
 gb|EEE93744.1| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LGNHRAA +VK EFKVSEKRWYWLKV AL TIRDW+ALEKFSKEKRPP+G+
Sbjct  700  SDTIRTCIALGNHRAAMRVKTEFKVSEKRWYWLKVLALVTIRDWEALEKFSKEKRPPMGF  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL
Sbjct  760  RPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            +F+QN AA+SIFDTLRDRL+FQG S
Sbjct  820  SFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_008811095.1| PREDICTED: protein VACUOLELESS1 [Phoenix dactylifera]
Length=844

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA +V+ EFKVSEKRWYWLK FALAT+RDWDALEKFSKEKRPP GY
Sbjct  700  SDTIRTCIVLGNHRAAMRVRAEFKVSEKRWYWLKAFALATVRDWDALEKFSKEKRPPGGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEAC++A++K EALKYIPKLA+PRER+EAYA IGMAKEAADAASQAKDGEL GRLKL
Sbjct  760  KPFVEACIDADEKAEALKYIPKLAEPRERSEAYARIGMAKEAADAASQAKDGELFGRLKL  819

Query  397  TFSQNAAAASIFDTLRDRLTFQGT  326
            T +QNAAA+SIFDTLRDRL+FQG 
Sbjct  820  TLAQNAAASSIFDTLRDRLSFQGV  843



>ref|XP_010557595.1| PREDICTED: protein VACUOLELESS1 [Tarenaya hassleriana]
Length=861

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 2/145 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIGY
Sbjct  719  SDTIRTCIVLGNHRAAVKVKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIGY  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC++A++K EALKYIPKL+DPRERAEAYA IGMAKEAADAASQAKDGELLGRLK+
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKM  838

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNA+  SIFDTL  R++FQG S
Sbjct  839  TFSQNASTTSIFDTL--RMSFQGMS  861



>ref|XP_010918871.1| PREDICTED: protein VACUOLELESS1 [Elaeis guineensis]
Length=846

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA +V+ EFKVSEKRWYWLK FALAT+RDWDALEKFSKEKRPP GY
Sbjct  702  SDTIRTCIVLGNHRAAMRVRAEFKVSEKRWYWLKAFALATVRDWDALEKFSKEKRPPGGY  761

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEAC++A +K EALKYIPKLA+PRER+EAYA IGMAKEAADAASQAKD EL GRLKL
Sbjct  762  KPFVEACIDANEKAEALKYIPKLAEPRERSEAYARIGMAKEAADAASQAKDSELFGRLKL  821

Query  397  TFSQNAAAASIFDTLRDRLTFQGT  326
            T +QNAAA+SIFDTLRDRL+FQG 
Sbjct  822  TLAQNAAASSIFDTLRDRLSFQGV  845



>ref|XP_009416537.1| PREDICTED: protein VACUOLELESS1 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHR A +V+ EFKVSEKRWYWLK FALAT+RDWDALEKFSKEKRPP GY
Sbjct  698  SDTIRTCIVLGNHREAMRVRTEFKVSEKRWYWLKAFALATVRDWDALEKFSKEKRPPGGY  757

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEAC++A++K EA+KYIPKL +PRER+EAYA IGMAKEAADAASQAKD EL GRLKL
Sbjct  758  KPFVEACIDADEKAEAIKYIPKLTEPRERSEAYARIGMAKEAADAASQAKDSELFGRLKL  817

Query  397  TFSQNAAAASIFDTLRDRLTFQGT  326
            T +QNAAA+SIFDTLRDRL+FQG 
Sbjct  818  TLAQNAAASSIFDTLRDRLSFQGV  841



>ref|XP_004303883.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=857

 Score =   224 bits (572),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNH+AA KVK +FKVSEKRWYWLK FALAT+RDWD LEKFSKEKRPPIG+
Sbjct  716  SDTIRTCIVLGNHKAAMKVKTDFKVSEKRWYWLKAFALATVRDWDTLEKFSKEKRPPIGF  775

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEALKYIPKL DPRERAEAY  IGMAKEAADAASQA DGELLGRL+ 
Sbjct  776  RPFVEACIEADEKGEALKYIPKLTDPRERAEAYGRIGMAKEAADAASQANDGELLGRLRS  835

Query  397  TFSQNAAAASIFDTLRDRL  341
            TFSQN AA+SIFDT+RD+L
Sbjct  836  TFSQNPAASSIFDTIRDKL  854



>ref|XP_011467591.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=891

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNH+AA KVK +FKVSEKRWYWLK FALAT+RDWD LEKFSKEKRPPIG+
Sbjct  750  SDTIRTCIVLGNHKAAMKVKTDFKVSEKRWYWLKAFALATVRDWDTLEKFSKEKRPPIGF  809

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVEAC+EA++KGEALKYIPKL DPRERAEAY  IGMAKEAADAASQA DGELLGRL+ 
Sbjct  810  RPFVEACIEADEKGEALKYIPKLTDPRERAEAYGRIGMAKEAADAASQANDGELLGRLRS  869

Query  397  TFSQNAAAASIFDTLRDRL  341
            TFSQN AA+SIFDT+RD+L
Sbjct  870  TFSQNPAASSIFDTIRDKL  888



>ref|XP_010681470.1| PREDICTED: protein VACUOLELESS1 [Beta vulgaris subsp. vulgaris]
Length=844

 Score =   221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEK+PPIGY
Sbjct  703  SDTIRTCIVLGNHRAAMKVKNEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKKPPIGY  762

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEAC++A+++ EALKYIPKL DP ERAEAYA IGMAKEAADAASQAKD ELLGRL+L
Sbjct  763  KPFVEACIDADERNEALKYIPKLTDPGERAEAYARIGMAKEAADAASQAKDSELLGRLRL  822

Query  397  TFSQNAAAASIFDTLRDRL  341
            +FSQN AA SIFDT+R+RL
Sbjct  823  SFSQNTAATSIFDTIRERL  841



>gb|AFW83495.1| hypothetical protein ZEAMMB73_843554 [Zea mays]
Length=197

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA +VK EFKV +KRWYWLK  ALAT+ +WD LEKFS+EKRPP GY
Sbjct  52   SDTIKTCIAMGNERAALRVKSEFKVPDKRWYWLKTCALATVGNWDGLEKFSREKRPPGGY  111

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EA+KYIPKL DPRER+EAYA +GMAKEA DAASQAKD  EL GRLK
Sbjct  112  KPFVEACIDAGQKNEAVKYIPKLTDPRERSEAYARMGMAKEAQDAASQAKDSDELFGRLK  171

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
            +T +Q++AAASIFDTLRDRL+FQG
Sbjct  172  ITLAQSSAAASIFDTLRDRLSFQG  195



>ref|XP_006854657.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
 gb|ERN16124.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
Length=855

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCI LG  +AA KV+ EFKV EKRWYWLK+ ALA   DWD LEKFSKEKRPPIGY
Sbjct  711  SDTIRTCITLGYEQAAAKVRAEFKVPEKRWYWLKLLALAAKGDWDGLEKFSKEKRPPIGY  770

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEAC++A+ KGEALKYIPKL DPRE+AE YA IGMAKEAADAASQAKDGELL RLK 
Sbjct  771  KPFVEACIDADAKGEALKYIPKLTDPREKAEFYARIGMAKEAADAASQAKDGELLIRLKQ  830

Query  397  TFSQNAAAASIFDTLRDRLTFQGTS  323
            TFSQNAAA +IFDTLRDRL+ QG S
Sbjct  831  TFSQNAAATAIFDTLRDRLSLQGVS  855



>ref|XP_004969467.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Setaria italica]
Length=874

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALEKFS+E+RPP GY
Sbjct  729  SDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKTCALATVGNWDALEKFSRERRPPGGY  788

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EALKYIPKL DPRER+EAYA +GMAKEAADAASQAKD  EL GRLK
Sbjct  789  KPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARMGMAKEAADAASQAKDSDELFGRLK  848

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
            +T +QN+AAASIFDTLRDRL+FQG
Sbjct  849  ITLAQNSAAASIFDTLRDRLSFQG  872



>ref|XP_002456108.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
 gb|EES01228.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
Length=825

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALEKFS+EKRPP GY
Sbjct  680  SDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKTCALATVGNWDALEKFSREKRPPGGY  739

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EA+KYIPKLADPRER+EAYA +GMA+EA +AASQAKD  EL GRLK
Sbjct  740  KPFVEACIDAGQKNEAVKYIPKLADPRERSEAYARMGMAREAEEAASQAKDSDELFGRLK  799

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
            +T +Q++AAASIFDTLRDRL+FQG
Sbjct  800  ITLAQSSAAASIFDTLRDRLSFQG  823



>dbj|BAB90498.1| vacuolar protein sorting-associated protein VPS16-like [Oryza 
sativa Japonica Group]
Length=892

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALEKFSKE+RPP GY
Sbjct  747  SDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKSCALATVGNWDALEKFSKERRPPGGY  806

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EALKYIPKL DPRER+EAYA I MAKEAA+AASQ KD  EL GRLK
Sbjct  807  KPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARIKMAKEAAEAASQVKDSDELFGRLK  866

Query  400  LTFSQNAAAASIFDTLRDRLTFQGT  326
            LT +QN AAASIFDTLRDRL+FQGT
Sbjct  867  LTLAQNTAAASIFDTLRDRLSFQGT  891



>gb|EEE55144.1| hypothetical protein OsJ_02938 [Oryza sativa Japonica Group]
Length=988

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALEKFSKE+RPP GY
Sbjct  843  SDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKSCALATVGNWDALEKFSKERRPPGGY  902

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EALKYIPKL DPRER+EAYA I MAKEAA+AASQ KD  EL GRLK
Sbjct  903  KPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARIKMAKEAAEAASQVKDSDELFGRLK  962

Query  400  LTFSQNAAAASIFDTLRDRLTFQGT  326
            LT +QN AAASIFDTLRDRL+FQGT
Sbjct  963  LTLAQNTAAASIFDTLRDRLSFQGT  987



>ref|XP_006646183.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog, 
partial [Oryza brachyantha]
Length=825

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA KVK +FKV +KRWYWLK  ALAT+ +WDALEKFSKEKRPP GY
Sbjct  680  SDTIKTCIAMGNERAALKVKTDFKVPDKRWYWLKSCALATVGNWDALEKFSKEKRPPGGY  739

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EA+KYIPKL DPRER+EAYA I MAKEAA+AASQ KD  EL GRLK
Sbjct  740  KPFVEACIDAGQKTEAVKYIPKLTDPRERSEAYARIKMAKEAAEAASQVKDSDELFGRLK  799

Query  400  LTFSQNAAAASIFDTLRDRLTFQGT  326
            LT +QN AAASIFDTLRDRL+FQGT
Sbjct  800  LTLAQNTAAASIFDTLRDRLSFQGT  824



>ref|XP_008656726.1| PREDICTED: protein VACUOLELESS1 [Zea mays]
Length=877

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA +VK EFKV +KRWYWLK  ALAT+ +WD LEKFS+EKRPP GY
Sbjct  732  SDTIKTCIAMGNERAALRVKSEFKVPDKRWYWLKTCALATVGNWDGLEKFSREKRPPGGY  791

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EA+KYIPKL DPRER+EAYA +GMAKEA DAASQAKD  EL GRLK
Sbjct  792  KPFVEACIDAGQKNEAVKYIPKLTDPRERSEAYARMGMAKEAQDAASQAKDSDELFGRLK  851

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
            +T +Q++AAASIFDTLRDRL+FQG
Sbjct  852  ITLAQSSAAASIFDTLRDRLSFQG  875



>ref|XP_001777594.1| predicted protein [Physcomitrella patens]
 gb|EDQ57637.1| predicted protein [Physcomitrella patens]
Length=837

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRT I LGNHRAA +VK +FKV +KR+YWLKVFALAT + WDALEKFSKE++PPIGY
Sbjct  696  SDTIRTLITLGNHRAAQRVKVDFKVPDKRYYWLKVFALATAKQWDALEKFSKERKPPIGY  755

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            KPFVEAC+E E+  EALKYI KL +P ERAEAYA IGM KEA +AA+QAKD ELLGRL+ 
Sbjct  756  KPFVEACIEEEENQEALKYIVKLTNPEERAEAYARIGMVKEATEAAAQAKDNELLGRLRS  815

Query  397  TFSQNAAAASIFDTLRDRLTF  335
            TF QN  A ++FD+LRDRL+ 
Sbjct  816  TFGQNTPAGALFDSLRDRLSL  836



>ref|XP_010232114.1| PREDICTED: protein VACUOLELESS1 [Brachypodium distachyon]
Length=877

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCI +GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALE FSKE++PP G+
Sbjct  730  SDTIKTCIAMGNERAAVKVKSEFKVPDKRWYWLKSCALATVGNWDALETFSKERKPPGGF  789

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EALKY+PKL DP ER+EAYA + M KEAA+AASQAKDG EL GRLK
Sbjct  790  KPFVEACIDAGKKTEALKYVPKLTDPGERSEAYARLKMDKEAAEAASQAKDGDELFGRLK  849

Query  400  LTFSQ--NAAAASIFDTLRDRLTFQGT  326
            LT +Q  N AAASIFDTLRDRL+FQGT
Sbjct  850  LTLAQNTNTAAASIFDTLRDRLSFQGT  876



>ref|XP_002963395.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
 gb|EFJ35266.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
Length=839

 Score =   188 bits (477),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKV-SEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  581
            SDTIRTCIVL NHR A +++ EFKV  +KR+YWLKV ALA I+DWDALEKFSKE+RPP+G
Sbjct  695  SDTIRTCIVLKNHREAQRIRVEFKVVPDKRFYWLKVLALAYIKDWDALEKFSKERRPPVG  754

Query  580  YKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLK  401
            +KPFVEAC++     EALKYI KL+DP E+AEAYA  GMAKEAA+ A+QAKD E+LGRLK
Sbjct  755  FKPFVEACLQEGQTSEALKYIQKLSDPEEKAEAYAQAGMAKEAAEVAAQAKDSEILGRLK  814

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
            LTF Q+  AA++FD++RDRL+ QG
Sbjct  815  LTFGQSTTAAALFDSIRDRLSLQG  838



>ref|XP_002974680.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
 gb|EFJ24200.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
Length=839

 Score =   187 bits (476),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKV-SEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  581
            SDTIRTCIVL NHR A +++ EFKV  +KR+YWLK+ ALA I+DWDALEKFSKE+RPP+G
Sbjct  695  SDTIRTCIVLKNHREAQRIRVEFKVVPDKRFYWLKILALAYIKDWDALEKFSKERRPPVG  754

Query  580  YKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLK  401
            +KPFVEAC++     EALKYI KL+DP E+AEAYA  GMAKEAA+ A+QAKD E+LGRLK
Sbjct  755  FKPFVEACLQEGQTSEALKYIQKLSDPEEKAEAYAQAGMAKEAAEVAAQAKDSEILGRLK  814

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
            LTF Q+  AA++FD++RDRL+ QG
Sbjct  815  LTFGQSTTAAALFDSIRDRLSLQG  838



>ref|XP_006296131.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
 gb|EOA29029.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
Length=858

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KMPFQGAS  858



>ref|XP_002883710.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59969.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALA I+DW ALEKFSKEKRPP+G+
Sbjct  497  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALARIKDWAALEKFSKEKRPPMGF  556

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAAD A+QA D GELL R +
Sbjct  557  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADCAAQANDGGELLERFR  616

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TF QNA    IFDTL  ++ FQG S
Sbjct  617  KTFVQNA----IFDTL--KMPFQGAS  636



>emb|CDY14496.1| BnaC03g20990D [Brassica napus]
Length=858

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVL N+RAA KVK EFKVS+KRWYWLK FALATI+DW+ALEKFSKEKRPP G+
Sbjct  719  NDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYWLKTFALATIKDWEALEKFSKEKRPPTGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KMPFQGVS  858



>emb|CDY07756.1| BnaA03g17550D [Brassica napus]
Length=858

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVL N+RAA KVK EFKVS+KRWYWLK FALATI+DW+ALEKFSKEKRPP G+
Sbjct  719  NDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYWLKTFALATIKDWEALEKFSKEKRPPTGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KMPFQGVS  858



>ref|XP_009133226.1| PREDICTED: protein VACUOLELESS1 [Brassica rapa]
Length=858

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVL N+RAA KVK EFKVS+KRWYWLK FALATI+DW+ALEKFSKEKRPP G+
Sbjct  719  NDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYWLKTFALATIKDWEALEKFSKEKRPPTGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KMPFQGVS  858



>ref|XP_010505412.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWY+LK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYFLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQGTS
Sbjct  839  KTFSQNA----IFDTL--KIPFQGTS  858



>ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TF QNA    IFDTL  ++ FQG S
Sbjct  839  KTFVQNA----IFDTL--KMPFQGAS  858



>dbj|BAJ97322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=899

 Score =   185 bits (470),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 5/145 (3%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCIV+GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALE FS+EKRPP GY
Sbjct  758  SDTIKTCIVMGNERAAVKVKSEFKVPDKRWYWLKSCALATVGNWDALETFSREKRPPGGY  817

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLK  401
            KPFVEAC++A  K EA+KYIPKL DP ER+EAYA + M  EA  AAS+A +G EL GRLK
Sbjct  818  KPFVEACIDAGQKMEAIKYIPKLTDPGERSEAYARLNMTDEAEKAASEANNGDELFGRLK  877

Query  400  LTFSQNAAAASIFDTLRDRLTFQGT  326
             T +QN    ++ DTLRDRL+FQGT
Sbjct  878  STLAQN----TLIDTLRDRLSFQGT  898



>ref|NP_565879.1| vacuoleless1 [Arabidopsis thaliana]
 sp|Q93VQ0.1|VCL1_ARATH RecName: Full=Protein VACUOLELESS1; AltName: Full=Vacuolar protein 
sorting-associated protein 16 homolog [Arabidopsis thaliana]
 gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana]
 gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AEC09479.1| vacuoleless1 [Arabidopsis thaliana]
Length=858

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAAD A+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADCAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TF QNA    IFDTL   + FQG S
Sbjct  839  KTFVQNA----IFDTL--LMPFQGAS  858



>ref|XP_010517084.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWY+LK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYFLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KMPFQGAS  858



>ref|XP_010509236.1| PREDICTED: protein VACUOLELESS1 [Camelina sativa]
Length=858

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWY+LK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYFLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KIPFQGAS  858



>dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila]
Length=833

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 123/146 (84%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVL N+RAA KVK EFKVS+KRWY+LK FALATI+DW+ALEKFSKEKRPP G+
Sbjct  694  NDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYFLKAFALATIKDWEALEKFSKEKRPPTGF  753

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  754  RPFVEACIDADEKAEALKYIPKLSDLGERGEAYARIGMAKEAADAAAQANDGGELLERFR  813

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  814  KTFSQNA----IFDTL--KMPFQGVS  833



>ref|XP_006411003.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
 gb|ESQ52456.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
Length=858

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 123/146 (84%), Gaps = 7/146 (5%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVL N+RAA KVK EFKVS+KRWY+LK FALATI+DW+ALEKFSKEKRPP G+
Sbjct  719  NDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYFLKAFALATIKDWEALEKFSKEKRPPTGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakD-GELLGRLK  401
            +PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADAA+QA D GELL R +
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLGERGEAYARIGMAKEAADAAAQANDGGELLERFR  838

Query  400  LTFSQNAAAASIFDTLRDRLTFQGTS  323
             TFSQNA    IFDTL  ++ FQG S
Sbjct  839  KTFSQNA----IFDTL--KMPFQGVS  858



>gb|KJB10617.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=795

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIGY
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEA  482
            +PFVEACV+A++KGEALKYIPKLAD RERAE 
Sbjct  760  RPFVEACVDADEKGEALKYIPKLADLRERAEV  791



>dbj|BAD95263.1| hypothetical protein [Arabidopsis thaliana]
Length=346

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  231  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGF  290

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAE  485
            +PFVEAC++A++K EALKYIPKL+D  ER E
Sbjct  291  RPFVEACIDADEKAEALKYIPKLSDLVERGE  321



>dbj|BAH19612.1| AT2G38020 [Arabidopsis thaliana]
Length=526

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  411  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGF  470

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAE  485
            +PFVEAC++A++K EALKYIPKL+D  ER E
Sbjct  471  RPFVEACIDADEKAEALKYIPKLSDLVERGE  501



>gb|EMS54442.1| Vacuolar protein sorting-associated protein 16-like protein [Triticum 
urartu]
Length=419

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI+TCIV+GN RAA KVK EFKV +KRWYWLK  ALAT+ +WDALE FS+EKRPP GY
Sbjct  283  SDTIKTCIVMGNERAAVKVKSEFKVPDKRWYWLKSCALATVGNWDALETFSREKRPPGGY  342

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGM  464
            KPFVEAC++A  K EALKYIPKL DP ER+E YA I +
Sbjct  343  KPFVEACIDAGQKTEALKYIPKLTDPGERSEGYAQISI  380



>ref|NP_001078020.1| vacuoleless1 [Arabidopsis thaliana]
 gb|AEC09480.1| vacuoleless1 [Arabidopsis thaliana]
Length=834

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTIRTCIVLGN+RAA KVK EFKVS+KRWYWLK FALATI+DW ALEKFSKEKRPP+G+
Sbjct  719  NDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGF  778

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEA  482
            +PFVEAC++A++K EALKYIPKL+D  ER E 
Sbjct  779  RPFVEACIDADEKAEALKYIPKLSDLVERGEV  810



>gb|KJB10619.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=772

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  581
            SDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIG
Sbjct  700  SDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIG  758



>ref|XP_004367009.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
 gb|EGG20026.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
Length=835

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI   I+LG H+  +K+K EFKVS++R++W+K+ AL+ + DW+ L  F+KEK+ P+GY
Sbjct  696  SDTIYQLILLGEHKRVSKIKSEFKVSDRRFWWIKIKALSQVGDWEELHNFAKEKKSPVGY  755

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVE C++  +  EAL+YIPK+ D   RA+AY  I   +EAA+ A + K+ +LL  +  
Sbjct  756  EPFVEVCMDFSNPVEALRYIPKIQDHVNRAQAYLQINYFREAAETAFKEKNLDLLNFIAR  815

Query  397  TFSQNAAAASIFDTLRDRLT  338
              + N  A++I D +R +L+
Sbjct  816  KCT-NPEASNIIDQMRAQLS  834



>gb|EFA85317.1| hypothetical protein PPL_02318 [Polysphondylium pallidum PN500]
Length=860

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 90/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DT+   ++LG  +  +K+K EFKV++KR++W K+ AL+    W+ L  FSKEK+ PIGY
Sbjct  720  ADTMYQLVLLGEQKRVSKIKSEFKVTDKRFWWTKIKALSISGQWEELNNFSKEKKSPIGY  779

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +PFVE C++   + EALKYIPK+ D   R ++Y  +G  +EAA+ A + K+ +LL  +  
Sbjct  780  EPFVEVCLDQNQQVEALKYIPKIQDTVNRCQSYIQVGYFREAAETAFKDKNLDLLNFVAK  839

Query  397  TFSQNAAAASIFDTLRDRLT  338
              + N    ++ D +R +L+
Sbjct  840  KCTNNEVVLNLIDQMRAQLS  859



>emb|CEG84393.1| hypothetical protein RMATCC62417_18202 [Rhizopus microsporus]
Length=213

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TI  C  LG H  A+KVK +FKV +KR++W+K+ AL  +RDWD LEK +K ++ PIGY
Sbjct  99   SETIYKCTTLGQHNKASKVKTDFKVPDKRFWWVKLRALVEVRDWDNLEKLAKSRKSPIGY  158

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  159  EPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  194



>ref|XP_646623.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
 sp|Q55C58.2|VPS16_DICDI RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog [Dictyostelium discoideum]
 gb|EAL72727.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
Length=832

 Score =   102 bits (255),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTI   I +   + A  ++ EFKV +KR++W+K+ AL+ + DW+ L KFSKEK+ PIGY
Sbjct  693  NDTIYKLITMNQPKKAQSIRSEFKVPDKRFWWIKIKALSIMNDWEELMKFSKEKKSPIGY  752

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++ +++ EALKYIPK+ D   + + Y  IG
Sbjct  753  EPFVEVCLDQKNQIEALKYIPKITDILPKIQFYIQIG  789



>dbj|GAN01171.1| vacuolar protein sorting vps16 protein [Mucor ambiguus]
Length=820

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -3

Query  760  SSDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  581
            +S+TI  C  LG H  A+K+K +FKV +KR++W+K+ AL  +RDW+ LEK SK K+ PIG
Sbjct  680  TSETIYKCTTLGQHNKASKIKTDFKVPDKRFWWVKLRALVEVRDWENLEKLSKSKKSPIG  739

Query  580  YKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            Y+PFVE C++A    EA KYI K  DP  R   +  IG
Sbjct  740  YEPFVEECIKARQYQEASKYILK-CDPPVRPMLFVKIG  776



>ref|XP_003287306.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
 gb|EGC36173.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
Length=831

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI   I L   + AN +K EFKV +KR++W+K+ AL+ + DW+ L KFSK+K+ PIGY
Sbjct  692  SDTIYKLISLNQGKRANSIKSEFKVPDKRFWWIKIKALSIMCDWEELMKFSKDKKSPIGY  751

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C+E +++ EALKYIP++ +   + + Y  I 
Sbjct  752  EPFVEVCLEQKNQIEALKYIPRITESLPKVQFYIQIS  788



>gb|EPB85961.1| hypothetical protein HMPREF1544_07293 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=760

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -3

Query  760  SSDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIG  581
            +S+TI  C  LG H  A+K+K +FK+ +KR++W+K+ AL  +RDW+ LEK SK K+ PIG
Sbjct  645  TSETIYKCTTLGQHNKASKIKTDFKIPDKRFWWVKLRALVEVRDWENLEKLSKSKKSPIG  704

Query  580  YKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            Y+PFVE C++A    EA KYI K  DP  R   +  IG
Sbjct  705  YEPFVEECIKARQYQEASKYILK-CDPPVRPMLFVKIG  741



>emb|CEG71651.1| hypothetical protein RMATCC62417_07353 [Rhizopus microsporus]
Length=820

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TI  C  +G H  A+KVK +FKV +KR++W+K+ AL  +RDWD LEK +K ++ PIGY
Sbjct  681  SETIYKCTTIGQHNKASKVKTDFKVPDKRYWWVKLRALVEVRDWDNLEKLAKSRKSPIGY  740

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  741  EPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  776



>ref|XP_005650736.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26192.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
Length=859

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 90/144 (63%), Gaps = 1/144 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DT+R C+ LGNHRAA +++ +FKVSE+R++WLK+  LA  +DW+ LE F++EK+ PIG 
Sbjct  715  ADTLRQCVRLGNHRAAARLRADFKVSERRFWWLKLKTLAAAKDWEGLESFAREKKSPIGI  774

Query  577  KPFVEACVE-AEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLK  401
            +PFV A  +         + I +L D + +AE YA  G+ +EAA+ A++ +D ++L +L+
Sbjct  775  EPFVAAAKQHGAPDATVSRIIARLPDGKRKAEEYAAAGLLQEAAECAARVRDNDMLSKLQ  834

Query  400  LTFSQNAAAASIFDTLRDRLTFQG  329
                  +        L+DRL   G
Sbjct  835  DMIGTVSPLGVAVSQLKDRLQSGG  858



>dbj|GAM26637.1| hypothetical protein SAMD00019534_098120 [Acytostelium subglobosum 
LB1]
Length=836

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI   +++G H+   K+  EFKVS+KR++W+K+ AL+  R W+ L  F+ EK+ PIGY
Sbjct  697  SDTIFQLVLMGEHKRVAKMLKEFKVSDKRFWWIKIKALSVSRQWEELSLFANEKKSPIGY  756

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++     EALKYIPK+ D   R + Y  + 
Sbjct  757  EPFVEVCLDQSQHVEALKYIPKIQDVVNRCQCYVQVN  793



>emb|CEP18375.1| hypothetical protein [Parasitella parasitica]
Length=820

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TI  C  LG H  A+K+K +FKV +KR++W+K+ AL  +RDW+ LEK SK K+ PIGY
Sbjct  681  SETIYKCTTLGQHNKASKIKTDFKVPDKRFWWVKLRALVEVRDWENLEKLSKSKKSPIGY  740

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C+ A    EA KYI K  DP  R   +  IG
Sbjct  741  EPFVEECIRARQYQEASKYILK-CDPPVRPMLFVKIG  776



>ref|XP_002678979.1| predicted protein [Naegleria gruberi]
 gb|EFC46235.1| predicted protein [Naegleria gruberi]
Length=846

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TI  C++ GN + A KVK EF+VS+K+++WLK+ A + +  W+ +EKFSK K+ PIGY
Sbjct  711  SETIYQCLLNGN-KQAKKVKKEFQVSDKKFWWLKIAAFSKLGKWNKMEKFSK-KKSPIGY  768

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYA  476
            +PFVEAC++ ++  EA KYIPK+ DP E+ E Y 
Sbjct  769  RPFVEACLQQKNTVEAHKYIPKVTDPWEKIELYV  802



>gb|ABC94505.1| hypothetical protein [Ictalurus punctatus]
Length=152

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T +  G H+ A ++  +F+V +KR+ WLK+ ALA   DW+ LEKF+K K+ PIGY 
Sbjct  41   DTLSTLLSSGFHKHAEQLYKDFRVPDKRYLWLKLTALADKADWEELEKFAKSKKSPIGYM  100

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY+ K+  P ++ +A+  +G
Sbjct  101  PFVEECVKRNNKFEAQKYVSKVT-PEQKVKAHLAVG  135



>ref|XP_007248949.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Astyanax mexicanus]
Length=835

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+RT + +G H+ A ++  +FKV +KR++WLK+ ALA   DW+ LEKF+K K+ PIGY 
Sbjct  694  DTLRTLLAVGLHKHAEQLYKDFKVPDKRFWWLKLTALAEKEDWEELEKFAKSKKSPIGYL  753

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY+ ++  P ++ +A+  +G
Sbjct  754  PFVEVCVKHHNKYEAKKYVSRVT-PEQKVKAHLAVG  788



>gb|ERZ97236.1| hypothetical protein GLOINDRAFT_334475 [Rhizophagus irregularis 
DAOM 181602]
Length=820

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++T+  CI   N   ANK+K +FK+ +KR++W+K+ AL  +RDW  LE+ SK K+ PIGY
Sbjct  681  NETVHKCITTNNPNKANKLKSDFKIPDKRFWWIKLKALVEMRDWPELERLSKSKKSPIGY  740

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++A    EA+KYI K  DP  R   +  IG
Sbjct  741  EPFVEECIKAIQHKEAIKYITK-CDPAVRPGLFIKIG  776



>ref|XP_002591465.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
 gb|EEN47476.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
Length=795

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI      GNH+ A +++ EFKV +KR++WLK+ ALA   DW  L++F+K K+ PIGY+
Sbjct  654  DTISQLTTEGNHKLAEQLRKEFKVPDKRFWWLKIQALAEGSDWAELDRFAKSKKSPIGYE  713

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PF++ C++ +++ EA KY+ ++ADP  + +AY  IG
Sbjct  714  PFIDVCLKHQNRYEANKYVGRIADP-AKVKAYIKIG  748



>ref|XP_002598771.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
 gb|EEN54783.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
Length=761

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI      GNH+ A +++ EFKV +KR++WLK+ ALA   DW  L++F+K K+ PIGY+
Sbjct  620  DTISQLTTEGNHKLAEQLRKEFKVPDKRFWWLKIQALAEGSDWAELDRFAKSKKSPIGYE  679

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PF++ C++ +++ EA KY+ ++ADP  + +AY  IG
Sbjct  680  PFIDVCLKHQNRYEANKYVGRIADP-AKVKAYIKIG  714



>ref|XP_008121385.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Anolis carolinensis]
Length=866

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ GNH+ A ++  +FK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  728  DTVYNLILEGNHKRAEQLYRDFKIPDKRFWWLKINALAEQGDWEEMEKFSKSKKSPIGYL  787

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  ++ EA K+ P++A P +R +A+  +G
Sbjct  788  PFVEICMKHHNRHEARKFAPRVA-PEQRVKAFLLVG  822



>emb|CDH59927.1| vacuolar protein sorting vps16 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=785

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TI  C +LG    ++KVK EFKV +KR++W+K+ AL  +RDW+ LEK +K K  PIGY
Sbjct  646  SETIYKCTMLGQQSKSSKVKSEFKVPDKRYWWIKLRALVEVRDWENLEKLAKTKNSPIGY  705

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++A+   EA KYI K  D   R   +  IG
Sbjct  706  EPFVEECIKAKQYQEASKYILK-CDTSVRPMLFVKIG  741



>ref|XP_007850547.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
 gb|ESK90169.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
Length=846

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++TIRTCI+ G  + A+K+K +FKV +KR++++K+FAL  IRD++ L+ FSK KR PIGY
Sbjct  709  NETIRTCIINGMMKRADKLKSDFKVPDKRFWYIKLFALTEIRDFEGLDAFSKSKRSPIGY  768

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAY  479
            +PFV   VE +   EA+ Y+ +  DP +RA+ Y
Sbjct  769  EPFVRHLVEKKHVKEAIPYVAR-CDPPKRADLY  800



>ref|XP_001641101.1| predicted protein [Nematostella vectensis]
 gb|EDO49038.1| predicted protein [Nematostella vectensis]
Length=770

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI  CI LG+ + A K++ +FKV +  ++W+KV ALA  R+W  LEKFSK ++ PIGY
Sbjct  675  SDTIEKCIELGHLKDAEKLRKDFKVPDVHYHWIKVKALAGSRNWTELEKFSKSRKSPIGY  734

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFV+ C++   + EA KYI K+  P  +A+ Y  IG
Sbjct  735  EPFVDFCLQQNHRIEAEKYIAKV-QPENKAKYYLKIG  770



>ref|XP_005518015.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Pseudopodoces humilis]
Length=693

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+H+ A ++  +F++ +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY 
Sbjct  552  DTVSTLILDGHHKRAEQLCRDFRIPDKRYWWLKINALATRGDWEEVEKFSKSKKSPIGYL  611

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  612  PFVEVAVKHHNRYEARKYAPRVP-PEQRVKAFVLVG  646



>ref|XP_005431022.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Geospiza fortis]
Length=799

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+H+ A ++  +F++ +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY 
Sbjct  658  DTVATLILDGHHKRAEQLYRDFRIPDKRYWWLKINALATRGDWEEMEKFSKSKKSPIGYL  717

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  718  PFVEVAVKHHNRYEAKKYAPRVP-PEQRVKAFVLVG  752



>ref|XP_009462172.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Nipponia nippon]
Length=803

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  662  DTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWEEMEKFSKSKKSPIGYL  721

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  722  PFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  756



>ref|NP_001091659.1| vacuolar protein sorting-associated protein 16 homolog [Danio 
rerio]
 gb|AAI39871.1| MGC162584 protein [Danio rerio]
Length=835

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T + +G H+ A ++  +F+V +KR++WLK+ ALA   DWD LEKF+K K+ PIGY 
Sbjct  694  DTMTTLLSVGLHKHAEQLYKDFRVPDKRFWWLKLKALAEKEDWDELEKFAKSKKSPIGYL  753

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFV+ C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  754  PFVDVCIKHHNKYEARKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_009098195.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Serinus canaria]
Length=1408

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = -3

Query  754   DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
             DT+ T I+ G+H+ A ++  +F++ +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY 
Sbjct  1267  DTVATLILDGHHKRAEQLYRDFRIPDKRYWWLKINALATRGDWEEMEKFSKSKKSPIGYL  1326

Query  574   PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
             PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  1327  PFVEVAVKHHNRYEAKKYAPRVP-PEQRVKAFVLVG  1361



>ref|XP_010726024.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Meleagris gallopavo]
Length=980

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            +T+ T I  G+H+ A ++  EFK+ +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY 
Sbjct  839  NTVSTLIQDGHHKKAEQLYREFKIPDKRYWWLKISALATRGDWEEMEKFSKSKKSPIGYL  898

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  899  PFVEIAVKHHNRYEAKKYAPRVT-PEQRVKAFILVG  933



>ref|XP_001943896.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Acyrthosiphon pisum]
Length=798

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DT+   I +   + A+K++ EFKV E+R++W ++  LA  +DW+ LEK SK K+ PIGY
Sbjct  700  NDTLLKLIEINELKLADKLRSEFKVPERRYWWARLTILAKQQDWNELEKLSKVKKSPIGY  759

Query  577  KPFVEACVEAEDKGEALKYIPKLAD  503
            +PFV+ C+E  +K EALKY+PK+ D
Sbjct  760  EPFVDVCIEHGNKYEALKYLPKVRD  784



>ref|XP_005435468.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Falco cherrug]
Length=855

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  714  DTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWEEMEKFSKSKKSPIGYL  773

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  774  PFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  808



>emb|CDS07252.1| hypothetical protein LRAMOSA01201 [Absidia idahoensis var. thermophila]
Length=773

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TI  C +LG    ++KVK EFKV +KR++W+K+ AL  ++DW+ LEK +K K  PIGY
Sbjct  634  SETIYKCTMLGQQSKSSKVKSEFKVPDKRYWWIKLRALVEVQDWENLEKLAKSKSSPIGY  693

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFVE C++A+   EA KYI K  D   R   +  IG
Sbjct  694  EPFVEECIKAKQYQEASKYILK-CDTAVRPMLFVKIG  729



>ref|XP_010566769.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Haliaeetus leucocephalus]
Length=838

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  697  DTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWEEMEKFSKSKKSPIGYL  756

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  757  PFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  791



>ref|XP_005239614.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Falco peregrinus]
Length=852

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  711  DTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWEEMEKFSKSKKSPIGYL  770

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  771  PFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  805



>ref|XP_005062211.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Ficedula albicollis]
Length=857

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+H+ A ++  +F++ +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY 
Sbjct  716  DTVATLILDGHHKRAEQLYRDFRIPDKRYWWLKINALATRGDWEEMEKFSKSKKSPIGYL  775

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R  A+  +G
Sbjct  776  PFVEVAVKHHNRYEAKKYAPRVP-PEQRVRAFVLVG  810



>gb|EDL80192.1| vacuolar protein sorting 16 (yeast), isoform CRA_b [Rattus norvegicus]
Length=166

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + +W+ LEKFSK K+ PIGY 
Sbjct  25   DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLSALADLEEWEELEKFSKSKKSPIGYL  84

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  85   PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  119



>ref|XP_002072009.1| GK22550 [Drosophila willistoni]
 gb|EDW82995.1| GK22550 [Drosophila willistoni]
Length=832

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            +TI   + LG+ + A KVK ++KV ++R++WL++  +A    WD LEKF+K K+ PIGY+
Sbjct  692  NTISNLLKLGDLKEAEKVKNDYKVPDRRFWWLRILTMAEFSHWDQLEKFAKSKKSPIGYE  751

Query  574  PFVEACVEAEDKGEALKYIPKLADPR  497
            PFVE CV+ ++K EA KYIP+  + R
Sbjct  752  PFVEVCVKHKNKVEAQKYIPRCRETR  777



>ref|NP_001258079.1| vacuolar protein sorting-associated protein 16 homolog [Gallus 
gallus]
Length=838

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            +T+ T I  G+H+ A ++  +FK+ +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY 
Sbjct  697  NTVSTLIQDGHHKKAEQLYRDFKIPDKRYWWLKISALATRGDWEEMEKFSKSKKSPIGYL  756

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  757  PFVEIAVKHHNRYEAKKYAPRVT-PEQRVKAFILVG  791



>ref|XP_004345413.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE95370.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
Length=835

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            SDTI  C+  G  + A+ V+  FKV ++R++W+K+ A A   +W  LEKF+K K+ PIGY
Sbjct  694  SDTIYKCLTSGYPKKASDVQSLFKVPDRRFWWIKIRATADTGNWIELEKFAKSKKSPIGY  753

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
             PF++ C+E  + GEA KYI +LA P ER  AY  +G
Sbjct  754  GPFIDVCMEKGNPGEAKKYIDRLA-PEERVAAYIRVG  789



>gb|AAH64406.1| VPS16 protein, partial [Homo sapiens]
Length=283

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  142  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  201

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  202  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  236



>gb|AAI26432.1| VPS16 protein, partial [Homo sapiens]
Length=315

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  174  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  233

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  234  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  268



>ref|XP_009883933.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Charadrius vociferus]
Length=859

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  EFK+ +K+++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  718  DTVSNLILDGHHKRAEQLYREFKIPDKKYWWLKISALANRGDWEEMEKFSKSKKSPIGYL  777

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  778  PFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  812



>ref|XP_010862318.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Esox lucius]
Length=835

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   +    H+ A ++  +F+V +KR++WLK+ ALA   DWD LEKF+K K+ PIGY 
Sbjct  694  DTLHALLSANYHKQAEQLYRDFRVPDKRYWWLKLTALAEKEDWDELEKFAKSKKSPIGYL  753

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY+ K+  P ++ +A+  IG
Sbjct  754  PFVEVCVKRHNKYEAKKYVSKVT-PEQKVKAHLAIG  788



>gb|EAX10565.1| hCG2039972, isoform CRA_b [Homo sapiens]
Length=323

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  182  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  241

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  242  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  276



>gb|KIK56666.1| hypothetical protein GYMLUDRAFT_230051 [Gymnopus luxurians FD-317 
M1]
Length=846

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -3

Query  766  QVSSDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPP  587
            Q  ++TI TCIV G  + A+K+K +FKV +KR+++ K++AL  IRD++ L+ F+K KR P
Sbjct  706  QSVNETIHTCIVNGMVKRADKIKSDFKVPDKRFWYTKLYALTEIRDFEGLDAFAKSKRSP  765

Query  586  IGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYA  476
            IGY+PFV   VE     EA+ Y+ +  DP +RA+ YA
Sbjct  766  IGYEPFVRHLVEKGHNKEAVPYVAR-CDPPKRADLYA  801



>ref|XP_008495020.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Calypte anna]
Length=799

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  +FK+ +KR++WLK+ ALAT  DW+ +EKFS+ K+ PIGY 
Sbjct  658  DTVSNLILEGHHKRAEQLYRDFKIPDKRYWWLKISALATRGDWEEMEKFSRSKKSPIGYW  717

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE  V+  ++ EA KY P++  P +R  A+  +G
Sbjct  718  PFVEISVKHHNRYEAKKYAPRVP-PEQRVRAFVLVG  752



>ref|XP_002096919.1| GE25939 [Drosophila yakuba]
 gb|EDW96631.1| GE25939 [Drosophila yakuba]
Length=833

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI   +++G  + A +++ +FKV E+R++WL++  L++   WD LEKF+K K+ P+GY 
Sbjct  692  DTIHELLLIGELKEAERIRSDFKVPERRFWWLRILTLSSQHKWDELEKFAKSKKSPVGYD  751

Query  574  PFVEACVEAEDKGEALKYIPKLADPR  497
            PFVE C++ ++  EA KYIP+  D R
Sbjct  752  PFVEVCLKQDNTVEARKYIPRCRDNR  777



>gb|KDQ31847.1| hypothetical protein PLEOSDRAFT_48878 [Pleurotus ostreatus PC15]
Length=846

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            +DTI TC+V G  + A+KVK +FKV +KR+++LK++AL + RD++ LE F+K KR PIGY
Sbjct  709  NDTIHTCLVNGMAKRADKVKSDFKVPDKRFWYLKLYALTSTRDFEGLEAFTKSKRSPIGY  768

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFV   VE     EA  Y+ +   PR R + Y   G
Sbjct  769  EPFVNHLVEKGFSKEAATYVSRCDSPR-RPDLYVKCG  804



>gb|EGU11808.1| Vacuolar assembling/sorting protein VPS16 [Rhodotorula glutinis 
ATCC 204091]
Length=956

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 81/137 (59%), Gaps = 1/137 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++TIR CI+ G  + A KV+ EFKV +KR+++LK+ +L ++RDWDAL+ F++ K+ PIGY
Sbjct  816  NETIRQCILAGMDKKAEKVRSEFKVPDKRFWYLKLRSLISLRDWDALDTFARSKKSPIGY  875

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  398
            +P+V+  + A    +A+KY+ K  D R R E Y   G    A     +  +   L  LK 
Sbjct  876  EPWVDNLIRAGAHRQAVKYVEK-CDVRNRVELYVKCGEWVMAGQECVRRGESGRLHDLKA  934

Query  397  TFSQNAAAASIFDTLRD  347
                N  AA + + L+D
Sbjct  935  RSPNNIIAAQLDELLQD  951



>gb|AAH21291.2| VPS16 protein, partial [Homo sapiens]
Length=371

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  230  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  289

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  290  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  324



>gb|AAH03944.1| Vps16 protein [Mus musculus]
Length=419

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  278  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  337

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  338  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  372



>gb|KIM91586.1| hypothetical protein PILCRDRAFT_133551 [Piloderma croceum F 1598]
Length=845

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            S+TIRTC++ G  R A+K+K EFKV +KR++++K+ AL  IRD+D L+ F+K KR PIGY
Sbjct  708  SETIRTCLLNGMSRRADKIKSEFKVPDKRFWYIKLQALTAIRDFDGLDTFAKSKRSPIGY  767

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFV   VE     EA  Y+ +  D  +R + Y   G
Sbjct  768  QPFVHHLVEKGYSKEAAGYVVR-CDANQRVDLYVECG  803



>ref|XP_011238156.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mus musculus]
 ref|XP_011238157.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mus musculus]
Length=452

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  311  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  370

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  371  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  405



>ref|XP_004661527.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Jaculus jaculus]
Length=695

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ +LA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTSLANLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY  ++A P ++ +A   +G
Sbjct  614  PFVEICVKQHNKYEAKKYTSRVA-PEQKVKALLLVG  648



>gb|AAH12422.1| VPS16 protein, partial [Homo sapiens]
Length=415

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  274  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  333

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  334  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  368



>gb|EHB04285.1| Vacuolar protein sorting-associated protein 16-like protein [Heterocephalus 
glaber]
Length=666

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  525  DTVTTLIVGGHNKRAEQLSRDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  584

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  585  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  619



>ref|XP_004661526.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Jaculus jaculus]
Length=839

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ +LA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTSLANLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY  ++A P ++ +A   +G
Sbjct  758  PFVEICVKQHNKYEAKKYTSRVA-PEQKVKALLLVG  792



>ref|XP_006272323.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Alligator mississippiensis]
Length=838

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI   I+ G H+ A ++  EFK+ +KR++WLK+ +LA   DW+ +EKFSK K+ PIGY 
Sbjct  697  DTISHLILDGKHKRAEQLYREFKIPDKRFWWLKISSLAECGDWEEMEKFSKSKKSPIGYL  756

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  ++ EA KY  ++  P ++ +A+  +G
Sbjct  757  PFVEICVKYHNRHEAKKYAARVV-PEQKVKAFILVG  791



>gb|KFO20539.1| Vacuolar protein sorting-associated protein 16 like protein [Fukomys 
damarensis]
Length=686

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  545  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  604

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  605  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  639



>ref|XP_005735068.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Pundamilia nyererei]
Length=690

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  551  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  610

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  611  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_003030158.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
 gb|EFI95255.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
Length=848

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++TIR C+  G  + A+K+K +FKV +KR+++ K++AL ++RDW+AL+ F+K KR PIGY
Sbjct  711  NETIRACLTNGLSKRADKIKSDFKVPDKRFWYTKLYALTSVRDWEALDTFAKSKRSPIGY  770

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFV   +E     +A+ Y+ +   P+ RA+ Y   G
Sbjct  771  EPFVRHLIEKGHPTQAVPYVARCDSPK-RADLYVECG  806



>ref|XP_005951517.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Haplochromis burtoni]
Length=690

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  551  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  610

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  611  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_004886773.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X5 [Heterocephalus glaber]
 ref|XP_004840740.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X5 [Heterocephalus glaber]
Length=695

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLIVGGHNKRAEQLSRDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005463829.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Oreochromis niloticus]
Length=690

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  551  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  610

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  611  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_005735066.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Pundamilia nyererei]
Length=834

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  695  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  754

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  755  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005951516.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Haplochromis burtoni]
Length=811

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  672  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  731

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  732  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  765



>ref|XP_005951515.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Haplochromis burtoni]
Length=834

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  695  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  754

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  755  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_004575656.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Maylandia zebra]
Length=834

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  695  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  754

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  755  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005735067.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Pundamilia nyererei]
Length=811

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  672  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  731

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  732  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  765



>ref|XP_004886769.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Heterocephalus glaber]
 ref|XP_004840736.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Heterocephalus glaber]
Length=839

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLIVGGHNKRAEQLSRDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003458681.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Oreochromis niloticus]
Length=834

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD LEKFSK K+ PIGY  
Sbjct  695  TMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWDELEKFSKSKKSPIGYLA  754

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  755  FVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_003134377.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX2 [Sus scrofa]
Length=695

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A +V  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQVARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>gb|EPS95124.1| hypothetical protein FOMPIDRAFT_1043679 [Fomitopsis pinicola 
FP-58527 SS1]
Length=844

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  766  QVSSDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPP  587
            Q  ++TIRTC++ G  + A+K+K +FKV +KR++++K+ AL   RD+D L+ F++ KR P
Sbjct  704  QSINETIRTCLINGMAKRADKLKADFKVPDKRFWYVKLHALTATRDFDGLDTFARSKRSP  763

Query  586  IGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  479
            IGY+PFV   VE + K EA  ++P+  D  +R + Y
Sbjct  764  IGYEPFVRHLVEKDHKKEAATFVPR-CDAHKRVDLY  798



>ref|XP_002020368.1| GL13948 [Drosophila persimilis]
 gb|EDW39180.1| GL13948 [Drosophila persimilis]
Length=832

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI   ++LG  + A K++ ++KV ++R++WL++  LA  + WD LEKFSK K+ PIGY+
Sbjct  690  DTIEQLLLLGELKEAEKIRNDYKVPDRRFWWLRILTLAEQQKWDELEKFSKSKKSPIGYE  749

Query  574  PFVEACVEAEDKGEALKYIPKLADPR  497
            PFVE C++  +  EA KYIP+  + R
Sbjct  750  PFVEVCLKPGNAREARKYIPRCRENR  775



>gb|AAH73959.1| VPS16 protein [Homo sapiens]
 gb|AIC60603.1| VPS16, partial [synthetic construct]
Length=524

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  383  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  442

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  443  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  477



>gb|EMS22549.1| vacuolar protein sorting VPS16 [Rhodosporidium toruloides NP11]
 emb|CDR46740.1| RHTO0S13e00848g1_1 [Rhodosporidium toruloides]
Length=956

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++TIR CI+ G  + A KV+ EFKV +KR+++LK+ +L ++RDWDAL+ F++ K+ PIGY
Sbjct  816  NETIRQCILAGMDKKAEKVRSEFKVPDKRFWYLKLRSLISLRDWDALDTFARTKKSPIGY  875

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +P+V+  + A    +A+KY+ +  D R R E Y   G
Sbjct  876  EPWVDELIRAGAHRQAVKYVER-CDVRNRVELYVKCG  911



>ref|XP_005380824.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Chinchilla lanigera]
Length=695

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004634302.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Octodon degus]
Length=695

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_006038082.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Alligator sinensis]
Length=868

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -3

Query  751  TIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  572
            TI   I+ G H+ A ++  EFK+ +KR++WLK+ +LA   DW+ +EKFSK K+ PIGY P
Sbjct  728  TISHLILDGKHKRAEQLYREFKIPDKRFWWLKISSLAECGDWEEMEKFSKSKKSPIGYLP  787

Query  571  FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            FVE CV+  ++ EA KY  ++  P +R +A+  +G
Sbjct  788  FVEICVKYHNRHEAKKYAARVT-PEQRVKAFILVG  821



>gb|KIY47376.1| vacuolar protein sorting-associated protein 16 [Fistulina hepatica 
ATCC 64428]
Length=839

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++TIR CIV G+ + A+K+K +FKV +KR++++K+ AL +IRD+  LE FSK KR PIGY
Sbjct  702  NETIRQCIVNGHSKRADKIKSDFKVPDKRFWYVKLHALTSIRDFAQLEAFSKSKRSPIGY  761

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            +PFV   VE     +A  Y+ +   P+ R + YA  G
Sbjct  762  EPFVRHLVERGHLKQAAAYVSRCDSPK-RVDLYADCG  797



>ref|XP_005380823.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Chinchilla lanigera]
Length=839

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_010609328.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Fukomys damarensis]
Length=794

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  653  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  712

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  713  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  747



>ref|XP_007636110.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Cricetulus griseus]
Length=778

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  637  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALANLEDWEELEKFSKSKKSPIGYL  696

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  697  PFVEICMKQHNKYEAKKYASRVS-PEQKVKALLLVG  731



>ref|XP_005006664.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Cavia porcellus]
Length=815

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  674  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKTKKSPIGYL  733

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  734  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  768



>ref|XP_010609327.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Fukomys damarensis]
Length=838

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  697  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  756

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  757  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  791



>ref|XP_003134376.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX1 [Sus scrofa]
Length=839

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A +V  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQVARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003476674.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX2 [Cavia porcellus]
Length=695

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKTKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004634301.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Octodon degus]
Length=839

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003476673.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX1 [Cavia porcellus]
Length=839

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T IV G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLIVGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKTKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_005604575.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Equus caballus]
Length=766

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  625  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  684

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  685  PFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLVG  719



>gb|ERE69810.1| putative vacuolar protein sorting-associated protein 16 isoform 
1 [Cricetulus griseus]
Length=827

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  686  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALANLEDWEELEKFSKSKKSPIGYL  745

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  746  PFVEICMKQHNKYEAKKYASRVS-PEQKVKALLLVG  780



>ref|XP_003499087.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Cricetulus griseus]
 ref|XP_007636109.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Cricetulus griseus]
 gb|EGV92437.1| Vacuolar protein sorting-associated protein 16-like [Cricetulus 
griseus]
Length=839

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALANLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  +++ P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVS-PEQKVKALLLVG  792



>ref|XP_001357562.2| GA21090 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26696.2| GA21090 [Drosophila pseudoobscura pseudoobscura]
Length=834

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI   +++G  + A K++ ++KV ++R++WL++  LA  + WD LEKFSK K+ PIGY+
Sbjct  692  DTIEQLLLMGELKEAEKIRNDYKVPDRRFWWLRILTLAEQQKWDELEKFSKSKKSPIGYE  751

Query  574  PFVEACVEAEDKGEALKYIPKLADPR  497
            PFVE C++  +  EA KYIP+  + R
Sbjct  752  PFVEVCLKPGNAREARKYIPRCRENR  777



>ref|XP_003941102.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Saimiri boliviensis boliviensis]
Length=839

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICIKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004585724.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Ochotona princeps]
Length=695

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALANLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYAARVG-PEQKVKALLLVG  648



>ref|XP_008525819.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Equus przewalskii]
Length=825

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  684  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  743

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  744  PFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLVG  778



>ref|XP_006636484.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Lepisosteus oculatus]
Length=835

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            +T+ + ++ G  R A ++  +F++ +KR++WLK+ ALA   DW+ LEKFS+ K+ PIGY 
Sbjct  694  ETLHSLLMEGRIRPAEQLYKDFRIPDKRYWWLKISALAEKEDWEELEKFSRSKKSPIGYL  753

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY+ K+  P ++ +A+  +G
Sbjct  754  PFVEICVKHHNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>dbj|BAC33966.1| unnamed protein product [Mus musculus]
Length=839

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|NP_085036.3| vacuolar protein sorting-associated protein 16 homolog [Mus musculus]
 gb|EDL28271.1| vacuolar protein sorting 16 (yeast) [Mus musculus]
Length=839

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>emb|CAD39063.1| hypothetical protein [Homo sapiens]
Length=694

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  553  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  612

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  613  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  647



>ref|XP_002806793.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated 
protein 16 homolog [Callithrix jacchus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICIKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>gb|AAH25626.1| Vacuolar protein sorting 16 (yeast) [Mus musculus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>gb|KIP07308.1| hypothetical protein PHLGIDRAFT_426170 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=845

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -3

Query  757  SDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  578
            ++T+RTC++ G  + A+K++ +FKV +KR+++LK+ AL  + DW++L+ F++ KR PIGY
Sbjct  708  NETLRTCLINGMGKRADKIRSDFKVPDKRYWYLKLHALTEVHDWESLDTFARSKRSPIGY  767

Query  577  KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            + FV+  VE     EA+ Y+P+  D  +R + Y   G
Sbjct  768  QAFVQHLVEKGHTREAISYVPR-CDSNKRVDLYVLCG  803



>ref|XP_006500493.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Mus musculus]
Length=836

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  695  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  754

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  755  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  789



>ref|XP_006164053.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Tupaia chinensis]
Length=851

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = -3

Query  766  QVSSDTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPP  587
            Q   DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ P
Sbjct  706  QSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSP  765

Query  586  IGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            IGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  766  IGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  804



>dbj|BAB64892.1| Vps16 [Mus musculus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_001980849.1| GG16085 [Drosophila erecta]
 gb|EDV49807.1| GG16085 [Drosophila erecta]
Length=833

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DTI+  +++G  + A +++ +FKV E+R++WL++  L++   W+ LEK +K K+ P+GY 
Sbjct  692  DTIQELLLIGELKEAERIRSDFKVPERRFWWLRILTLSSQHKWEELEKLAKSKKSPVGYD  751

Query  574  PFVEACVEAEDKGEALKYIPKLADPR  497
            PFVE C++ ++  EA KYIP+  D R
Sbjct  752  PFVEVCLKQDNASEARKYIPRCRDNR  777



>ref|XP_005068684.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mesocricetus auratus]
Length=695

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALANLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004585723.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Ochotona princeps]
Length=841

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  700  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALANLEDWEELEKFSKSKKSPIGYL  759

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  760  PFVEICMKQHNKYEAKKYAARVG-PEQKVKALLLVG  794



>sp|Q920Q4.3|VPS16_MOUSE RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog; Short=mVPS16 [Mus musculus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_001496814.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX1 [Equus caballus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLVG  792



>ref|XP_005320597.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Ictidomys tridecemlineatus]
Length=695

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILNGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005068683.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Mesocricetus auratus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALANLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008852713.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Nannospalax galili]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_005320596.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Ictidomys tridecemlineatus]
Length=839

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILNGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_007195890.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X5 [Balaenoptera acutorostrata scammoni]
Length=729

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  588  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  647

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  648  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  682



>ref|XP_005874819.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Myotis brandtii]
Length=836

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  695  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  754

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  755  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  789



>ref|XP_004285369.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Orcinus orca]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>gb|EPQ13004.1| Vacuolar protein sorting-associated protein 16 like protein [Myotis 
brandtii]
Length=815

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  674  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  733

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  734  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  768



>ref|NP_001004976.1| vacuolar protein sorting 16 homolog [Xenopus (Silurana) tropicalis]
 gb|AAH75508.1| vacuolar protein sorting 16 homolog [Xenopus (Silurana) tropicalis]
Length=834

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G H+ A ++  EFK+ +KR++WLK+ ALA   DW+ LEKFSK K+  IGY 
Sbjct  693  DTVYNLILDGMHKKAEQLYKEFKIPDKRYWWLKISALAEKEDWEELEKFSKSKKSAIGYL  752

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++ ++K EA KYI ++    +R +A+  +G
Sbjct  753  PFVEICMKHQNKVEAKKYIARVG-IEQRVKAFLLVG  787



>ref|XP_004433876.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Ceratotherium simum simum]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ + I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTSLILSGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   IG
Sbjct  614  PFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLIG  648



>ref|XP_007195891.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X6 [Balaenoptera acutorostrata scammoni]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_007465456.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Lipotes vexillifer]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADMEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|NP_536338.1| vacuolar protein sorting-associated protein 16 homolog isoform 
3 [Homo sapiens]
 gb|EAX10564.1| hCG2039972, isoform CRA_a [Homo sapiens]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_008017290.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Chlorocebus sabaeus]
Length=787

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  646  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  705

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  706  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  740



>ref|XP_009214732.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Papio anubis]
Length=787

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  646  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  705

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  706  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  740



>ref|XP_006894253.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Elephantulus edwardii]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALAELEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005568560.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Macaca fascicularis]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004061764.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Gorilla gorilla gorilla]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_003788109.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Otolemur garnettii]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_011279227.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Felis catus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_001660915.1| AAEL010559-PA [Aedes aegypti]
 gb|EAT37446.1| AAEL010559-PA [Aedes aegypti]
Length=841

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            +TIR  ++LG+ + A+++K EFKV E+R++WL++  L+    WD LEKF+K K+ PIGY+
Sbjct  701  ETIRQLLLLGDIKYADRLKSEFKVPERRYWWLRISVLSQQFQWDELEKFAKSKKSPIGYE  760

Query  574  PFVEACVEAEDKGEALKYIPKLAD  503
            PFVE C++  +  +A KY+P+ ++
Sbjct  761  PFVEVCLKQSNLEQAKKYLPRCSE  784



>ref|XP_007195888.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Balaenoptera acutorostrata scammoni]
Length=830

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  689  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  748

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  749  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  783



>ref|XP_008139241.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Eptesicus fuscus]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_007958199.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Orycteropus afer afer]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>dbj|BAB71013.1| unnamed protein product [Homo sapiens]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_008568868.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Galeopterus variegatus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_006042778.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Bubalus bubalis]
Length=830

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  689  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  748

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  749  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  783



>ref|XP_007073325.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Panthera tigris altaica]
Length=834

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  693  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  752

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  753  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  787



>ref|XP_007898277.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Callorhinchus milii]
Length=838

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   ++    + A ++  +FK+ +KR++WLK+ ALA  +DW+ LEKFSK K+ P+GY 
Sbjct  697  DTVYNLLLDSKLKQAEQLYKDFKIPDKRFWWLKISALAEKQDWEELEKFSKSKKSPVGYM  756

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE CV+  +K EA KY+ K++ P ++ +A+  +G
Sbjct  757  PFVEICVKHHNKYEAKKYVTKVS-PEQKVKAFIMVG  791



>ref|XP_005894002.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Bos mutus]
Length=695

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_004285368.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Orcinus orca]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_006042780.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X4 [Bubalus bubalis]
Length=700

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  559  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  618

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  619  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  653



>ref|XP_004383068.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 3 [Trichechus manatus latirostris]
Length=695

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>gb|KFQ96045.1| Vacuolar protein sorting-associated protein 16, partial [Nipponia 
nippon]
Length=714

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY 
Sbjct  627  DTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWEEMEKFSKSKKSPIGYL  686

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERA  488
            PFVE  V+  ++ EA KY P++  P +R 
Sbjct  687  PFVEISVKHHNRYEAKKYAPRVT-PEQRV  714



>ref|XP_007958197.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Orycteropus afer afer]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_010377297.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Rhinopithecus roxellana]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008139240.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Eptesicus fuscus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_006096450.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated 
protein 16 homolog [Myotis lucifugus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004317401.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Tursiops truncatus]
Length=698

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  557  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  616

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  617  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  651



>ref|XP_007195886.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Balaenoptera acutorostrata scammoni]
Length=873

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  732  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  791

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  792  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  826



>ref|XP_008568869.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Galeopterus variegatus]
Length=799

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004061763.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Gorilla gorilla gorilla]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004433875.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Ceratotherium simum simum]
Length=843

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ + I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  702  DTVTSLILSGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  761

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   IG
Sbjct  762  PFVEICMKQHNKYEAKKYTSRVG-PEQKVKALLLIG  796



>ref|XP_004014429.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Ovis aries]
 ref|XP_005688276.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Capra hircus]
 ref|XP_005974818.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Pantholops hodgsonii]
Length=695

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  554  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  613

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  614  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005894001.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Bos mutus]
 gb|ELR57626.1| Vacuolar protein sorting-associated protein 16-like protein [Bos 
mutus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|NP_072097.2| vacuolar protein sorting-associated protein 16 homolog isoform 
1 [Homo sapiens]
 ref|XP_008973006.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Pan paniscus]
 ref|XP_009434987.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Pan troglodytes]
 sp|Q9H269.2|VPS16_HUMAN RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog; Short=hVPS16 [Homo sapiens]
 gb|EAX10566.1| hCG2039972, isoform CRA_c [Homo sapiens]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>gb|EHH65496.1| Vacuolar protein sorting-associated protein 16-like protein [Macaca 
fascicularis]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_009434986.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Pan troglodytes]
Length=871

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  730  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  789

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  790  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  824



>ref|XP_007195887.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Balaenoptera acutorostrata scammoni]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_006042777.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Bubalus bubalis]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004014428.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Ovis aries]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008017280.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Chlorocebus sabaeus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>tpg|DAA23165.1| TPA: vacuolar protein sorting-associated protein 16 homolog [Bos 
taurus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_004383066.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Trichechus manatus latirostris]
 ref|XP_004383067.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 2 [Trichechus manatus latirostris]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_009434988.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Pan troglodytes]
Length=805

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  664  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  723

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  724  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  758



>ref|XP_010834814.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bison bison bison]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|NP_001015522.1| vacuolar protein sorting-associated protein 16 homolog [Bos taurus]
 sp|Q5E9L7.1|VPS16_BOVIN RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog [Bos taurus]
 gb|AAX08920.1| vacuolar protein sorting 16 isoform 1 [Bos taurus]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G ++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_003788108.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform 1 [Otolemur garnettii]
Length=839

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_008568870.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Galeopterus variegatus]
Length=799

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -3

Query  754  DTIRTCIVLGNHRAANKVKXEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYK  575
            DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LEKFSK K+ PIGY 
Sbjct  698  DTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYL  757

Query  574  PFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  467
            PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  758  PFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520