BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024I12

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    210   2e-58   Nicotiana tomentosiformis
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    209   3e-58   Nicotiana sylvestris
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    207   1e-57   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...    206   2e-57   Solanum tuberosum [potatoes]
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    207   3e-57   Solanum lycopersicum
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...    206   3e-57   Vitis vinifera
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...    206   3e-57   Vitis vinifera
emb|CAN61169.1|  hypothetical protein VITISV_010446                     202   1e-56   Vitis vinifera
emb|CBI30745.3|  unnamed protein product                                207   1e-56   Vitis vinifera
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             203   5e-56   Prunus persica
emb|CAN65055.1|  hypothetical protein VITISV_012378                     199   8e-56   Vitis vinifera
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...    202   8e-56   
emb|CBI30743.3|  unnamed protein product                                196   5e-55   Vitis vinifera
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    200   8e-55   Prunus mume [ume]
ref|XP_007025271.1|  Leucine-rich repeat transmembrane protein ki...    191   9e-55   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    199   2e-54   Prunus mume [ume]
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    198   3e-54   Vitis vinifera
emb|CBI30748.3|  unnamed protein product                                198   4e-54   Vitis vinifera
ref|XP_008349229.1|  PREDICTED: probable LRR receptor-like serine...    187   6e-54   
emb|CDO96888.1|  unnamed protein product                                197   7e-54   Coffea canephora [robusta coffee]
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             197   1e-53   Prunus persica
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...    195   1e-53   
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...    195   5e-53   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...    194   5e-53   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    194   6e-53   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    194   8e-53   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...    194   9e-53   
ref|XP_011460364.1|  PREDICTED: probable LRR receptor-like serine...    194   1e-52   Fragaria vesca subsp. vesca
ref|XP_011461827.1|  PREDICTED: probable leucine-rich repeat rece...    194   1e-52   Fragaria vesca subsp. vesca
ref|XP_004296585.2|  PREDICTED: probable LRR receptor-like serine...    182   1e-52   Fragaria vesca subsp. vesca
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...    191   3e-52   
ref|XP_006388189.1|  hypothetical protein POPTR_0294s002001g            183   5e-52   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...    191   1e-51   
ref|XP_006495027.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-51   
ref|XP_009758721.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-51   Nicotiana sylvestris
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...    190   1e-51   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-51   
gb|KJB57354.1|  hypothetical protein B456_009G159400                    189   4e-51   Gossypium raimondii
gb|KJB57353.1|  hypothetical protein B456_009G159400                    189   5e-51   Gossypium raimondii
ref|XP_008225259.1|  PREDICTED: probable LRR receptor-like serine...    188   5e-51   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                         189   5e-51   Jatropha curcas
emb|CBI30752.3|  unnamed protein product                                185   5e-51   Vitis vinifera
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...    189   7e-51   
ref|XP_011460366.1|  PREDICTED: probable LRR receptor-like serine...    188   7e-51   Fragaria vesca subsp. vesca
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...    189   7e-51   Prunus mume [ume]
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...    188   8e-51   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg             188   8e-51   
gb|KJB57366.1|  hypothetical protein B456_009G159500                    188   8e-51   Gossypium raimondii
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...    188   1e-50   
ref|XP_006388928.1|  hypothetical protein POPTR_0073s00200g             181   2e-50   
gb|KJB57365.1|  hypothetical protein B456_009G159500                    188   2e-50   Gossypium raimondii
ref|XP_011460365.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-50   Fragaria vesca subsp. vesca
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...    184   5e-50   
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...    185   5e-50   Vitis vinifera
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    186   9e-50   
ref|XP_011461996.1|  PREDICTED: probable LRR receptor-like serine...    181   1e-49   Fragaria vesca subsp. vesca
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-49   Nicotiana tomentosiformis
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-49   Nicotiana tomentosiformis
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-49   Vitis vinifera
emb|CAN81177.1|  hypothetical protein VITISV_011951                     184   2e-49   Vitis vinifera
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-49   Vitis vinifera
emb|CBI30754.3|  unnamed protein product                                181   2e-49   Vitis vinifera
ref|XP_002522279.1|  ATP binding protein, putative                      185   2e-49   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-49   Vitis vinifera
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...    184   2e-49   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...    184   2e-49   
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg             184   3e-49   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    184   3e-49   
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...    184   3e-49   Nicotiana tomentosiformis
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g            181   3e-49   
ref|XP_002528777.1|  ATP binding protein, putative                      184   4e-49   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg             183   4e-49   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...    184   5e-49   Populus euphratica
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...    184   5e-49   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...    184   5e-49   Nicotiana tomentosiformis
ref|XP_006377514.1|  hypothetical protein POPTR_0011s06595g             174   7e-49   
ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...    180   8e-49   
ref|XP_006377482.1|  hypothetical protein POPTR_0011s06335g             180   9e-49   
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...    183   1e-48   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             182   1e-48   
ref|XP_010655590.1|  PREDICTED: probable LRR receptor-like serine...    181   1e-48   Vitis vinifera
ref|XP_006377521.1|  hypothetical protein POPTR_0011s06650g             174   1e-48   
ref|XP_010655582.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-48   Vitis vinifera
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             182   2e-48   
ref|XP_006377459.1|  hypothetical protein POPTR_0011s06130g             179   2e-48   
ref|XP_010655580.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-48   Vitis vinifera
ref|XP_011470947.1|  PREDICTED: probable leucine-rich repeat rece...    182   2e-48   Fragaria vesca subsp. vesca
ref|XP_010655581.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-48   Vitis vinifera
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-48   
gb|KHG06920.1|  hypothetical protein F383_33692                         169   2e-48   Gossypium arboreum [tree cotton]
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g             179   3e-48   
ref|XP_011470946.1|  PREDICTED: probable leucine-rich repeat rece...    181   3e-48   Fragaria vesca subsp. vesca
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...    182   3e-48   Populus euphratica
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...    182   3e-48   Populus euphratica
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g            175   3e-48   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg             182   3e-48   
gb|KJB57367.1|  hypothetical protein B456_009G159600                    179   3e-48   Gossypium raimondii
ref|XP_011470945.1|  PREDICTED: probable leucine-rich repeat rece...    182   3e-48   Fragaria vesca subsp. vesca
ref|XP_006377483.1|  putative receptor-like protein kinase RLPK1        179   3e-48   
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...    181   4e-48   
ref|XP_010655588.1|  PREDICTED: probable LRR receptor-like serine...    181   4e-48   Vitis vinifera
ref|XP_010655589.1|  PREDICTED: probable LRR receptor-like serine...    181   5e-48   Vitis vinifera
ref|XP_006371025.1|  hypothetical protein POPTR_0019s027401g            168   5e-48   
ref|XP_008384519.1|  PREDICTED: TMV resistance protein N-like iso...    180   6e-48   
ref|XP_008384518.1|  PREDICTED: TMV resistance protein N-like iso...    180   6e-48   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g             180   6e-48   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...    179   8e-48   Populus euphratica
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    180   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...    179   1e-47   Populus euphratica
ref|XP_006371027.1|  hypothetical protein POPTR_0019s02760g             178   1e-47   
ref|XP_006370931.1|  hypothetical protein POPTR_0019s01880g             174   1e-47   
gb|AAL73330.1|  putative receptor-like protein kinase RLPK1             168   2e-47   Glycine max [soybeans]
ref|XP_011462236.1|  PREDICTED: probable leucine-rich repeat rece...    179   2e-47   Fragaria vesca subsp. vesca
gb|KHF98741.1|  hypothetical protein F383_14220                         166   2e-47   Gossypium arboreum [tree cotton]
ref|XP_006377493.1|  hypothetical protein POPTR_0011s06440g             169   2e-47   
ref|XP_006377525.1|  putative receptor-like protein kinase RLPK1        176   2e-47   
ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-47   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...    179   2e-47   Populus euphratica
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...    179   2e-47   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-47   Populus euphratica
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-47   Populus euphratica
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-47   Populus euphratica
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...    179   3e-47   Populus euphratica
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...    179   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    178   4e-47   Populus euphratica
ref|XP_006377456.1|  hypothetical protein POPTR_0011s06100g             175   5e-47   
ref|XP_011461995.1|  PREDICTED: probable LRR receptor-like serine...    178   5e-47   Fragaria vesca subsp. vesca
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...    177   7e-47   Populus euphratica
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...    177   8e-47   Populus euphratica
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...    176   8e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...    177   8e-47   Populus euphratica
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...    177   8e-47   Populus euphratica
ref|XP_002317383.2|  hypothetical protein POPTR_0011s06220g             174   9e-47   
ref|XP_010112410.1|  putative LRR receptor-like serine/threonine-...    176   9e-47   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...    176   9e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006377501.1|  hypothetical protein POPTR_0011s06490g             174   1e-46   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW67550.1|  hypothetical protein EUGRSUZ_F013052                    169   2e-46   Eucalyptus grandis [rose gum]
ref|XP_006370934.1|  hypothetical protein POPTR_0019s01910g             164   3e-46   
emb|CAE54078.1|  receptor-like protein kinase                           165   3e-46   Fagus sylvatica
emb|CBI30750.3|  unnamed protein product                                172   3e-46   Vitis vinifera
emb|CBI30739.3|  unnamed protein product                                174   7e-46   Vitis vinifera
ref|XP_006377518.1|  hypothetical protein POPTR_0011s066201g            172   7e-46   
emb|CAN73789.1|  hypothetical protein VITISV_025000                     172   7e-46   Vitis vinifera
ref|XP_006377527.1|  hypothetical protein POPTR_0011s067102g            164   7e-46   
ref|XP_006377461.1|  hypothetical protein POPTR_0011s06150g             167   8e-46   
gb|KCW67576.1|  hypothetical protein EUGRSUZ_F013322                    167   1e-45   Eucalyptus grandis [rose gum]
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    174   1e-45   Populus euphratica
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...    174   2e-45   Vitis vinifera
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...    174   2e-45   
ref|XP_006377463.1|  hypothetical protein POPTR_0011s06170g             167   2e-45   
ref|XP_006449568.1|  hypothetical protein CICLE_v10015563mg             167   2e-45   
gb|KCW67582.1|  hypothetical protein EUGRSUZ_F01341                     165   3e-45   Eucalyptus grandis [rose gum]
ref|XP_011461991.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    173   3e-45   Fragaria vesca subsp. vesca
ref|XP_002305710.2|  hypothetical protein POPTR_0004s06240g             169   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011002042.1|  PREDICTED: probable LRR receptor-like serine...    172   4e-45   Populus euphratica
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...    172   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011002041.1|  PREDICTED: probable LRR receptor-like serine...    172   5e-45   Populus euphratica
ref|XP_010655585.1|  PREDICTED: probable LRR receptor-like serine...    172   5e-45   Vitis vinifera
ref|XP_011002039.1|  PREDICTED: probable LRR receptor-like serine...    172   5e-45   Populus euphratica
ref|XP_011002040.1|  PREDICTED: probable LRR receptor-like serine...    172   5e-45   Populus euphratica
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...    172   5e-45   Populus euphratica
ref|XP_011009666.1|  PREDICTED: probable LRR receptor-like serine...    169   5e-45   Populus euphratica
gb|KHN38783.1|  Putative LRR receptor-like serine/threonine-prote...    164   5e-45   Glycine soja [wild soybean]
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45   Populus euphratica
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45   Populus euphratica
ref|XP_011009667.1|  PREDICTED: probable LRR receptor-like serine...    169   6e-45   Populus euphratica
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45   Populus euphratica
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45   Populus euphratica
ref|XP_011470950.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45   Fragaria vesca subsp. vesca
gb|KJB57371.1|  hypothetical protein B456_009G159800                    168   6e-45   Gossypium raimondii
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45   Populus euphratica
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...    172   7e-45   Populus euphratica
ref|XP_006384080.1|  hypothetical protein POPTR_0004s06270g             167   7e-45   
ref|XP_011470949.1|  PREDICTED: probable LRR receptor-like serine...    172   7e-45   Fragaria vesca subsp. vesca
ref|XP_006384081.1|  hypothetical protein POPTR_0004s06270g             167   8e-45   Populus trichocarpa [western balsam poplar]
ref|NP_001235287.1|  receptor-like protein kinase                       163   8e-45   Glycine max [soybeans]
ref|XP_008443633.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-44   Cucumis melo [Oriental melon]
ref|XP_010655584.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-44   Vitis vinifera
ref|XP_010655583.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-44   Vitis vinifera
ref|XP_008443628.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-44   Cucumis melo [Oriental melon]
ref|XP_010064492.1|  PREDICTED: probable leucine-rich repeat rece...    163   2e-44   
ref|XP_008443627.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-44   Cucumis melo [Oriental melon]
ref|XP_008345927.1|  PREDICTED: probable LRR receptor-like serine...    158   2e-44   
ref|XP_008443626.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-44   Cucumis melo [Oriental melon]
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g            168   2e-44   
gb|KJB57372.1|  hypothetical protein B456_009G159800                    167   3e-44   Gossypium raimondii
ref|XP_010313922.1|  PREDICTED: probable LRR receptor-like serine...    170   3e-44   Solanum lycopersicum
gb|KDO35800.1|  hypothetical protein CISIN_1g028061mg                   159   3e-44   Citrus sinensis [apfelsine]
gb|KCW48256.1|  hypothetical protein EUGRSUZ_K01985                     168   3e-44   Eucalyptus grandis [rose gum]
ref|XP_006449567.1|  hypothetical protein CICLE_v10014126mg             170   3e-44   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g            168   3e-44   
ref|XP_010036442.1|  PREDICTED: probable leucine-rich repeat rece...    167   4e-44   
ref|XP_010038874.1|  PREDICTED: probable leucine-rich repeat rece...    167   4e-44   
gb|KCW48003.1|  hypothetical protein EUGRSUZ_K01737                     167   5e-44   Eucalyptus grandis [rose gum]
ref|XP_010036440.1|  PREDICTED: probable leucine-rich repeat rece...    167   5e-44   
ref|XP_006847775.1|  hypothetical protein AMTR_s00162p00056910          166   5e-44   
gb|KHG23496.1|  putative LRR receptor-like serine/threonine-prote...    167   5e-44   Gossypium arboreum [tree cotton]
ref|XP_004251900.1|  PREDICTED: probable LRR receptor-like serine...    169   6e-44   Solanum lycopersicum
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                     167   7e-44   Eucalyptus grandis [rose gum]
ref|XP_010046856.1|  PREDICTED: probable leucine-rich repeat rece...    160   7e-44   
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...    169   8e-44   
ref|XP_006467584.1|  PREDICTED: probable LRR receptor-like serine...    169   9e-44   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg             169   9e-44   
ref|XP_008225244.1|  PREDICTED: probable LRR receptor-like serine...    169   1e-43   Prunus mume [ume]
ref|XP_006377472.1|  hypothetical protein POPTR_0011s06260g             166   1e-43   
gb|KCW48028.1|  hypothetical protein EUGRSUZ_K01762                     167   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010038955.1|  PREDICTED: probable leucine-rich repeat rece...    167   1e-43   
gb|KCW48051.1|  hypothetical protein EUGRSUZ_K01793                     166   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010036439.1|  PREDICTED: probable leucine-rich repeat rece...    167   1e-43   
gb|KCW48268.1|  hypothetical protein EUGRSUZ_K020001                    162   2e-43   Eucalyptus grandis [rose gum]
gb|KJB57377.1|  hypothetical protein B456_009G159800                    167   2e-43   Gossypium raimondii
gb|KJB57376.1|  hypothetical protein B456_009G159800                    167   2e-43   Gossypium raimondii
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...    168   2e-43   
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g             166   2e-43   
ref|XP_010041838.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-43   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...    168   2e-43   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...    168   2e-43   Nelumbo nucifera [Indian lotus]
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                   167   3e-43   Citrus sinensis [apfelsine]
gb|KJB57375.1|  hypothetical protein B456_009G159800                    167   3e-43   Gossypium raimondii
gb|KJB57374.1|  hypothetical protein B456_009G159800                    167   3e-43   Gossypium raimondii
gb|KJB57373.1|  hypothetical protein B456_009G159800                    167   3e-43   Gossypium raimondii
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...    164   3e-43   
gb|AET04342.2|  LRR receptor-like Serine/Threonine-kinase RFK1, p...    167   3e-43   Medicago truncatula
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...    167   4e-43   Pyrus x bretschneideri [bai li]
gb|KCW48008.1|  hypothetical protein EUGRSUZ_K017432                    161   4e-43   Eucalyptus grandis [rose gum]
ref|XP_010063817.1|  PREDICTED: probable LRR receptor-like serine...    167   4e-43   
ref|XP_002522276.1|  kinase, putative                                   168   5e-43   
ref|XP_006358931.1|  PREDICTED: probable LRR receptor-like serine...    167   5e-43   Solanum tuberosum [potatoes]
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...    166   6e-43   Glycine soja [wild soybean]
ref|XP_007149532.1|  hypothetical protein PHAVU_005G078100g             164   7e-43   Phaseolus vulgaris [French bean]
ref|XP_006847776.1|  hypothetical protein AMTR_s00162p00057050          159   7e-43   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    166   7e-43   
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...    166   7e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW45029.1|  hypothetical protein EUGRSUZ_L013821                    160   8e-43   Eucalyptus grandis [rose gum]
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...    166   9e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008225247.1|  PREDICTED: probable LRR receptor-like serine...    166   9e-43   
gb|KJB66876.1|  hypothetical protein B456_010G162700                    166   1e-42   Gossypium raimondii
ref|XP_006370087.1|  hypothetical protein POPTR_0001s39420g             166   1e-42   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42   Prunus mume [ume]
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42   Nelumbo nucifera [Indian lotus]
gb|KHN36927.1|  Putative leucine-rich repeat receptor-like serine...    162   1e-42   Glycine soja [wild soybean]
gb|KCW48033.1|  hypothetical protein EUGRSUZ_K01771                     162   1e-42   Eucalyptus grandis [rose gum]
ref|XP_010094305.1|  putative LRR receptor-like serine/threonine-...    159   1e-42   
ref|XP_010064502.1|  PREDICTED: probable leucine-rich repeat rece...    166   1e-42   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                         166   1e-42   Jatropha curcas
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             165   1e-42   
ref|XP_011470943.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-42   Fragaria vesca subsp. vesca
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...    163   2e-42   Glycine max [soybeans]
ref|XP_011470944.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-42   Fragaria vesca subsp. vesca
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    165   2e-42   
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g             165   2e-42   
ref|XP_008346191.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-42   
ref|XP_010038894.1|  PREDICTED: probable leucine-rich repeat rece...    165   2e-42   
ref|XP_006370097.1|  hypothetical protein POPTR_0001s394901g            164   2e-42   
ref|XP_009798185.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-42   Nicotiana sylvestris
gb|EYU29542.1|  hypothetical protein MIMGU_mgv1a0269212mg               160   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_007025276.1|  Receptor-like kinase in flowers 1, putative        165   2e-42   
ref|XP_006377598.1|  hypothetical protein POPTR_0011s080251g            157   2e-42   
ref|XP_009798184.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-42   Nicotiana sylvestris
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...    165   2e-42   Eucalyptus grandis [rose gum]
gb|KCW67557.1|  hypothetical protein EUGRSUZ_F01307                     165   2e-42   Eucalyptus grandis [rose gum]
gb|KCW67564.1|  hypothetical protein EUGRSUZ_F01313                     162   2e-42   Eucalyptus grandis [rose gum]
gb|KCW67603.1|  hypothetical protein EUGRSUZ_F013601                    153   3e-42   Eucalyptus grandis [rose gum]
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...    164   3e-42   Cucumis melo [Oriental melon]
dbj|BAJ53166.1|  JHL10I11.12                                            164   3e-42   Jatropha curcas
ref|XP_009798183.1|  PREDICTED: probable LRR receptor-like serine...    164   3e-42   Nicotiana sylvestris
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                     162   3e-42   Eucalyptus grandis [rose gum]
ref|XP_010036641.1|  PREDICTED: probable leucine-rich repeat rece...    162   3e-42   
ref|XP_006388682.1|  hypothetical protein POPTR_0122s00210g             161   3e-42   
ref|XP_010036639.1|  PREDICTED: probable leucine-rich repeat rece...    162   4e-42   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...    164   4e-42   Cucumis melo [Oriental melon]
ref|XP_002316847.1|  receptor-like protein kinase                       164   5e-42   
ref|XP_011044591.1|  PREDICTED: probable LRR receptor-like serine...    164   5e-42   Populus euphratica
gb|KDP20042.1|  hypothetical protein JCGZ_05811                         164   5e-42   Jatropha curcas
ref|XP_010093466.1|  putative leucine-rich repeat receptor-like s...    159   6e-42   
gb|KCW67607.1|  hypothetical protein EUGRSUZ_F013621                    163   6e-42   
ref|XP_007025275.1|  Receptor-like kinase in flowers 1, putative        164   6e-42   
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                     163   7e-42   
ref|XP_006358079.1|  PREDICTED: probable LRR receptor-like serine...    163   7e-42   
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...    163   7e-42   
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...    163   8e-42   
ref|XP_009772943.1|  PREDICTED: probable LRR receptor-like serine...    163   8e-42   
ref|XP_010038964.1|  PREDICTED: probable LRR receptor-like serine...    161   8e-42   
gb|KCW75321.1|  hypothetical protein EUGRSUZ_E04067                     161   8e-42   
gb|KCW76049.1|  hypothetical protein EUGRSUZ_D00417                     160   8e-42   
ref|XP_010038877.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-42   
gb|KCW76050.1|  hypothetical protein EUGRSUZ_D00417                     160   9e-42   
ref|XP_010655570.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   
ref|XP_009352707.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
ref|XP_006346646.1|  PREDICTED: probable LRR receptor-like serine...    161   1e-41   
ref|XP_009352711.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
ref|XP_009352709.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
ref|XP_009352710.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   
ref|XP_009352708.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                     162   1e-41   
ref|XP_010064503.1|  PREDICTED: probable leucine-rich repeat rece...    162   1e-41   
ref|XP_002532988.1|  conserved hypothetical protein                     162   1e-41   
ref|XP_004504262.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    163   1e-41   
ref|NP_001238159.1|  receptor-like serine/threonine kinase              163   1e-41   
ref|XP_010273496.1|  PREDICTED: probable leucine-rich repeat rece...    162   1e-41   
gb|KCW48041.1|  hypothetical protein EUGRSUZ_K01781                     160   2e-41   
gb|KCW48261.1|  hypothetical protein EUGRSUZ_K019901                    151   2e-41   
gb|KEH28296.1|  LRR receptor-like kinase                                162   2e-41   
ref|XP_006592614.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-41   
ref|XP_010040667.1|  PREDICTED: probable leucine-rich repeat rece...    160   2e-41   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-41   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-41   
gb|KHN42594.1|  Putative LRR receptor-like serine/threonine-prote...    162   2e-41   
ref|XP_010052141.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
emb|CBI30742.3|  unnamed protein product                                162   2e-41   
ref|XP_010052142.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_010273495.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-41   
ref|XP_010655567.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_010316863.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_010655566.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_010316862.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
ref|XP_007149544.1|  hypothetical protein PHAVU_005G0791000g            161   2e-41   
ref|XP_010316864.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   
gb|KCW48258.1|  hypothetical protein EUGRSUZ_K01987                     162   2e-41   
ref|XP_004168262.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   
ref|XP_009788430.1|  PREDICTED: probable LRR receptor-like serine...    161   3e-41   
ref|XP_010655565.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   
emb|CBI30744.3|  unnamed protein product                                162   3e-41   
ref|XP_009788429.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   
ref|XP_010093471.1|  putative LRR receptor-like serine/threonine-...    161   3e-41   
gb|KCW67560.1|  hypothetical protein EUGRSUZ_F013102                    161   3e-41   
ref|XP_010060737.1|  PREDICTED: probable leucine-rich repeat rece...    161   3e-41   
ref|XP_004137308.1|  PREDICTED: probable LRR receptor-like serine...    161   4e-41   
ref|XP_004491064.1|  PREDICTED: probable leucine-rich repeat rece...    161   4e-41   
ref|XP_003616753.1|  Cysteine-rich receptor-like protein kinase         161   4e-41   
gb|KCW67601.1|  hypothetical protein EUGRSUZ_F01359                     160   4e-41   
ref|XP_006306238.1|  hypothetical protein CARUB_v10012061mg             161   4e-41   
ref|XP_006582117.1|  PREDICTED: probable LRR receptor-like serine...    161   4e-41   
ref|XP_007213739.1|  hypothetical protein PRUPE_ppa000808mg             161   4e-41   
ref|XP_008358125.1|  PREDICTED: probable leucine-rich repeat rece...    157   4e-41   
gb|KJB61521.1|  hypothetical protein B456_009G363600                    161   4e-41   
ref|XP_009604354.1|  PREDICTED: probable LRR receptor-like serine...    161   4e-41   
ref|XP_006593320.1|  PREDICTED: receptor-like kinase isoform X2         161   4e-41   
ref|XP_009619428.1|  PREDICTED: probable LRR receptor-like serine...    161   4e-41   
gb|KEH38591.1|  LRR receptor-like kinase                                161   4e-41   
ref|XP_010059621.1|  PREDICTED: probable leucine-rich repeat rece...    161   4e-41   
gb|KCW67547.1|  hypothetical protein EUGRSUZ_F01301                     161   4e-41   
emb|CAN66180.1|  hypothetical protein VITISV_025180                     158   4e-41   
ref|XP_002891752.1|  leucine-rich repeat family protein                 161   4e-41   
ref|XP_006593319.1|  PREDICTED: receptor-like kinase isoform X1         161   4e-41   
gb|KCW84087.1|  hypothetical protein EUGRSUZ_B00978                     159   4e-41   
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...    160   4e-41   
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...    161   5e-41   
ref|XP_011460817.1|  PREDICTED: probable leucine-rich repeat rece...    161   5e-41   
ref|XP_010060736.1|  PREDICTED: probable leucine-rich repeat rece...    159   5e-41   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...    161   5e-41   
gb|KCW67556.1|  hypothetical protein EUGRSUZ_F01306                     160   6e-41   
ref|XP_011085314.1|  PREDICTED: probable LRR receptor-like serine...    161   6e-41   
gb|ABF70100.1|  protein kinase, putative                                161   6e-41   
ref|XP_011085313.1|  PREDICTED: probable LRR receptor-like serine...    161   6e-41   
ref|XP_011461992.1|  PREDICTED: probable leucine-rich repeat rece...    160   6e-41   
ref|XP_008371516.1|  PREDICTED: probable LRR receptor-like serine...    154   6e-41   
gb|KHG20508.1|  hypothetical protein F383_03730                         160   6e-41   
ref|XP_010060732.1|  PREDICTED: probable LRR receptor-like serine...    160   6e-41   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase              160   6e-41   
ref|XP_010655560.1|  PREDICTED: probable LRR receptor-like serine...    160   6e-41   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...    160   7e-41   
ref|XP_011082787.1|  PREDICTED: probable LRR receptor-like serine...    160   7e-41   
emb|CBI20124.3|  unnamed protein product                                160   7e-41   
ref|XP_010052146.1|  PREDICTED: probable LRR receptor-like serine...    160   7e-41   
ref|XP_010064483.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    160   8e-41   
ref|XP_010479903.1|  PREDICTED: probable LRR receptor-like serine...    160   8e-41   
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...    160   9e-41   
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...    160   9e-41   
gb|EYU28129.1|  hypothetical protein MIMGU_mgv1a025582mg                160   9e-41   
ref|XP_006377469.1|  hypothetical protein POPTR_0011s062402g            157   9e-41   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...    160   9e-41   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...    160   9e-41   
gb|KCW67574.1|  hypothetical protein EUGRSUZ_F013302                    158   9e-41   
ref|XP_011098190.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
gb|KCW67583.1|  hypothetical protein EUGRSUZ_F013432                    160   1e-40   
ref|XP_010052145.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_010064506.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-40   
ref|XP_010909919.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_003629866.1|  ATP-binding/protein serine/threonine kinase        160   1e-40   
gb|KCW74195.1|  hypothetical protein EUGRSUZ_E02843                     160   1e-40   
ref|XP_010316865.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_006304589.1|  hypothetical protein CARUB_v10011641mg             160   1e-40   
ref|XP_010479902.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
emb|CBI20136.3|  unnamed protein product                                158   1e-40   
ref|XP_010060735.1|  PREDICTED: probable leucine-rich repeat rece...    158   1e-40   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_010052144.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_010057164.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_009628284.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_010462234.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_006304798.1|  hypothetical protein CARUB_v10012394mg             160   1e-40   
gb|KCW76047.1|  hypothetical protein EUGRSUZ_D00415                     160   1e-40   
ref|XP_004147391.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_004167247.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    159   1e-40   
gb|ACN59254.1|  leucine-rich repeat receptor-like protein kinase        159   1e-40   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g             160   2e-40   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...    160   2e-40   
ref|NP_001117479.1|  Leucine-rich repeat transmembrane protein ki...    159   2e-40   
gb|AAF78446.1|AC018748_25  Contains similarity to receptor-like s...    159   2e-40   
gb|AES66495.2|  LRR receptor-like kinase                                159   2e-40   
ref|XP_004488996.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-40   
ref|NP_175748.1|  Leucine-rich repeat transmembrane protein kinase      159   2e-40   
ref|XP_009628281.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_004488997.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-40   
ref|XP_007149541.1|  hypothetical protein PHAVU_005G078900g             159   2e-40   
ref|XP_008245552.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40   
sp|C0LGG8.1|Y5343_ARATH  RecName: Full=Probable LRR receptor-like...    159   2e-40   
ref|XP_010655573.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_008390667.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    156   2e-40   
ref|XP_010479904.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_009628282.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
gb|KCW67558.1|  hypothetical protein EUGRSUZ_F01308                     157   2e-40   
gb|KCW67586.1|  hypothetical protein EUGRSUZ_F013462                    154   2e-40   
gb|KHG04404.1|  putative LRR receptor-like serine/threonine-prote...    158   2e-40   
gb|KEH38577.1|  LRR receptor-like kinase                                159   2e-40   
ref|XP_010655572.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_010462239.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg             159   2e-40   
ref|XP_010655571.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase              159   2e-40   
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-40   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   
emb|CBI20142.3|  unnamed protein product                                159   3e-40   
gb|KEH19394.1|  LRR receptor-like kinase                                159   3e-40   
emb|CAN81779.1|  hypothetical protein VITISV_034284                     159   3e-40   
ref|XP_010921615.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   
ref|XP_010500994.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   
ref|XP_011009654.1|  PREDICTED: probable LRR receptor-like serine...    158   3e-40   
gb|AAF78445.1|AC018748_24  Contains a weak similarity to disease ...    159   3e-40   
ref|XP_011460822.1|  PREDICTED: probable leucine-rich repeat rece...    158   3e-40   
emb|CBI30740.3|  unnamed protein product                                159   3e-40   
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   
ref|NP_175749.1|  putative LRR receptor-like serine/threonine-pro...    159   3e-40   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...    159   4e-40   
ref|XP_009802917.1|  PREDICTED: probable LRR receptor-like serine...    159   4e-40   
ref|NP_001062936.1|  Os09g0345300                                       152   4e-40   
gb|AET02915.2|  LRR receptor-like kinase                                158   4e-40   
ref|XP_009802916.1|  PREDICTED: probable LRR receptor-like serine...    158   4e-40   
ref|XP_009802915.1|  PREDICTED: probable LRR receptor-like serine...    158   4e-40   
ref|XP_010064513.1|  PREDICTED: probable leucine-rich repeat rece...    158   4e-40   
gb|KDO77959.1|  hypothetical protein CISIN_1g045835mg                   155   4e-40   
ref|XP_010691210.1|  PREDICTED: probable leucine-rich repeat rece...    158   4e-40   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg             156   5e-40   
ref|XP_011470952.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-40   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...    158   5e-40   
ref|XP_010644091.1|  PREDICTED: probable LRR receptor-like serine...    158   5e-40   
emb|CAN70496.1|  hypothetical protein VITISV_042040                     157   5e-40   
ref|XP_010064487.1|  PREDICTED: probable leucine-rich repeat rece...    157   6e-40   
ref|XP_011460821.1|  PREDICTED: probable leucine-rich repeat rece...    158   6e-40   
gb|KHG04296.1|  hypothetical protein F383_04630                         157   6e-40   
ref|XP_008386286.1|  PREDICTED: probable leucine-rich repeat rece...    150   6e-40   
ref|XP_011460818.1|  PREDICTED: probable leucine-rich repeat rece...    158   6e-40   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg             156   6e-40   
gb|KCW74191.1|  hypothetical protein EUGRSUZ_E02839                     157   6e-40   
ref|XP_011009652.1|  PREDICTED: probable LRR receptor-like serine...    158   7e-40   
ref|XP_002317385.1|  hypothetical protein POPTR_0011s06740g             158   7e-40   
ref|XP_011009653.1|  PREDICTED: probable LRR receptor-like serine...    158   7e-40   
ref|XP_004488999.1|  PREDICTED: probable LRR receptor-like serine...    158   7e-40   
ref|XP_010248399.1|  PREDICTED: probable LRR receptor-like serine...    158   7e-40   
emb|CDY60204.1|  BnaCnng35830D                                          158   7e-40   
ref|XP_010273522.1|  PREDICTED: probable leucine-rich repeat rece...    153   7e-40   
ref|XP_010500990.1|  PREDICTED: probable LRR receptor-like serine...    158   7e-40   
ref|XP_010057167.1|  PREDICTED: probable LRR receptor-like serine...    157   7e-40   
ref|XP_010057166.1|  PREDICTED: probable LRR receptor-like serine...    157   7e-40   
gb|KCW67580.1|  hypothetical protein EUGRSUZ_F01336                     147   7e-40   
ref|XP_010064499.1|  PREDICTED: probable leucine-rich repeat rece...    157   8e-40   
ref|XP_010045768.1|  PREDICTED: probable LRR receptor-like serine...    157   8e-40   
emb|CBI20154.3|  unnamed protein product                                158   8e-40   
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g            155   8e-40   
ref|XP_002305711.2|  RECEPTOR-LIKE KINASE IN FLOWERS 1 family pro...    157   8e-40   
emb|CDY25853.1|  BnaA05g14440D                                          157   9e-40   
ref|XP_009144771.1|  PREDICTED: probable LRR receptor-like serine...    157   9e-40   
ref|XP_002882896.1|  leucine-rich repeat family protein                 157   9e-40   
gb|KHG04295.1|  hypothetical protein F383_04630                         157   9e-40   
ref|XP_010059064.1|  PREDICTED: probable LRR receptor-like serine...    157   9e-40   
ref|NP_001238397.1|  ATP-binding/protein serine/threonine kinase        154   9e-40   
gb|AAK32925.1|AF367338_1  At1g29720/T3M22_6                             150   9e-40   
gb|KCW74192.1|  hypothetical protein EUGRSUZ_E02840                     157   9e-40   
ref|XP_010247775.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-39   
ref|XP_011467565.1|  PREDICTED: probable LRR receptor-like serine...    157   1e-39   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...    157   1e-39   
ref|XP_007147979.1|  hypothetical protein PHAVU_006G170500g             157   1e-39   
ref|XP_007147980.1|  hypothetical protein PHAVU_006G170500g             157   1e-39   
emb|CDY35293.1|  BnaC03g59300D                                          156   1e-39   
gb|KHG25892.1|  putative leucine-rich repeat receptor-like serine...    155   1e-39   



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 133/167 (80%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  D++KTHI +TRVAGT GYMAPEY LWGYLT K D+YSFGVV LE+VAGKN ++
Sbjct  811  FGLAKLHDEEKTHI-TTRVAGTIGYMAPEYALWGYLTHKADLYSFGVVVLELVAGKNNMK  869

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  DEN +CLLDW L LQ++G  +EL+DPRLGSN++K++ALR+IKVALLCTNPSPALRP+
Sbjct  870  YNPDENYVCLLDWALVLQRKGKFLELVDPRLGSNYNKKEALRMIKVALLCTNPSPALRPN  929

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDS  264
            MS V+ MLEG  D+ E + D      EFNFQ +RD YD+M V+ S++
Sbjct  930  MSTVVKMLEGRLDVNESNIDSSAYDDEFNFQGLRDKYDEMQVNSSEN  976



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 133/167 (80%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  D++KTHI +TRVAGT GYMAPEY LWGYLT K D+YSFGVV LE+VAGKN ++
Sbjct  811  FGLAKLHDEEKTHI-TTRVAGTIGYMAPEYALWGYLTHKADLYSFGVVVLELVAGKNNMK  869

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  DEN +CLLDW L LQ++G  +EL+DPRLGSN++K++ALR+IKVALLCTNPSPALRP+
Sbjct  870  YNPDENYVCLLDWALVLQRKGKFLELVDPRLGSNYNKKEALRMIKVALLCTNPSPALRPN  929

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDS  264
            MS V+ MLEG  D+ E + D      EFNFQ +RD YD+M V+ S++
Sbjct  930  MSTVVKMLEGRLDVNESNIDSSAYDDEFNFQGLRDKYDEMQVNSSEN  976



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 136/177 (77%), Gaps = 7/177 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  D++KTH+ +TRVAGT GYMAPEY LWGYLT KVD+YSFGVV LE+VAGKN ++
Sbjct  811  FGLAKLHDEEKTHV-TTRVAGTIGYMAPEYALWGYLTHKVDLYSFGVVVLELVAGKNNMK  869

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  DEN +CLLDW L LQK+   +EL+DPRLGSN+DK++ALR+IKVAL CTNPSPALRP+
Sbjct  870  YHPDENYVCLLDWALVLQKKAKFLELVDPRLGSNYDKKEALRMIKVALQCTNPSPALRPN  929

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG  ++ E + D      EFNFQ +RD YD+M V  S++     FS+D 
Sbjct  930  MSAVVNMLEGRLNVDESNFDSSGYDDEFNFQGLRDKYDEMQVTSSEN-QSVFFSTDT  985



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 135/177 (76%), Gaps = 7/177 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  D++KTH+ +TRVAGT GYMAPEY LWGYLT KVD+YSFGVV LE+VAGKN ++
Sbjct  741  FGLAKLHDEEKTHV-TTRVAGTIGYMAPEYALWGYLTHKVDLYSFGVVVLELVAGKNNMK  799

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  DEN +CLLDW L LQK+G  +EL+DPRLGSN+DK++ALR+IKVAL CTNPSP LRP+
Sbjct  800  YHPDENYVCLLDWALVLQKKGKFLELVDPRLGSNYDKKEALRMIKVALRCTNPSPVLRPN  859

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG  +I E + D      E NFQ +RD YD+M V  S++     FS+D 
Sbjct  860  MSAVVNMLEGRLNIDESNFDSSGYGDELNFQGLRDKYDEMQVTSSEN-QSVFFSTDT  915



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  D++KTH+ +TRVAGT GYMAPEY LWGYLT K D+YSFGVV LE+VAGKN ++
Sbjct  811  FGLAKLHDEEKTHV-TTRVAGTIGYMAPEYALWGYLTHKADLYSFGVVVLELVAGKNNMK  869

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  DEN +CLLDW L LQK+G  +EL+DPRLGS +DKE+ALR+IKVAL CTNPSPALRP+
Sbjct  870  YHPDENYVCLLDWALVLQKKGKFLELVDPRLGSYYDKEEALRMIKVALRCTNPSPALRPN  929

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDS  264
            MS V+NMLEG  ++ E + D      EFNFQ +RD YD+M V  S++
Sbjct  930  MSAVVNMLEGRLNVDESNIDSSGYDDEFNFQGLRDKYDEMQVTSSEN  976



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  815  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  873

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+C CLLDW   LQ++GNL+EL+DP+LG+ F K++A+R+IKVALLCTNPSPALRP+
Sbjct  874  YRPNEDCFCLLDWAFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPT  933

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   I EY  +      EF F+A+R  YDQM +  S      N SS
Sbjct  934  MSAVVSMLKGQTVIQEYPLNPSIYGDEFGFEALRGQYDQMQLQSSSDIEPLNHSS  988



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  809  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  867

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+C CLLDW   LQ++GNL+EL+DP+LG+ F K++A+R+IKVALLCTNPSPALRP+
Sbjct  868  YRPNEDCFCLLDWAFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPT  927

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   I EY  +      EF F+A+R  YDQM +  S      N SS
Sbjct  928  MSAVVSMLKGQTVIQEYPLNPSIYGDEFGFEALRGQYDQMQLQSSSDIEPLNHSS  982



>emb|CAN61169.1| hypothetical protein VITISV_010446 [Vitis vinifera]
Length=661

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  473  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  531

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+  CLLDW   LQ++GNL+EL+DP+LG+ F K++A+R+IKVALLCTNPSPALRP+
Sbjct  532  YRPNEDYFCLLDWAFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPT  591

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   I EY  +      EF F+A+R  YDQM +  S      N SS
Sbjct  592  MSAVVSMLKGQTVIQEYPLNPSIYGDEFGFEALRGQYDQMQLQSSSDIEPLNHSS  646



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 6/175 (3%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
              GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  1713  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  1771

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             YR +E+C CLLDW   LQ++GNL+EL+DP+LG+ F K++A+R+IKVALLCTNPSPALRP+
Sbjct  1772  YRPNEDCFCLLDWAFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPT  1831

Query  392   MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
             MS V++ML+G   I EY  +      EF F+A+R  YDQM +  S      N SS
Sbjct  1832  MSAVVSMLKGQTVIQEYPLNPSIYGDEFGFEALRGQYDQMQLQSSSDIEPLNHSS  1886



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  821  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  879

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++GNL++L+DPRLGSNF KE+A+R++KVALLCTNP+PALRPS
Sbjct  880  YRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPS  939

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG    HE I++      E    A+R+ +DQ+    S        SS+A
Sbjct  940  MSSVVSMLEGKTAVHELIMDPSIYGDEMRLTALRNQFDQIAQESSTGTQSLTRSSNA  996



>emb|CAN65055.1| hypothetical protein VITISV_012378 [Vitis vinifera]
Length=575

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 129/173 (75%), Gaps = 2/173 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  382  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  440

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+   LLDW   LQ++GNL+EL+DP+L S+F+KE+ LR+IK++LLCTNPSPALRP+
Sbjct  441  YRPNEDYFSLLDWAFFLQQKGNLMELVDPKLESDFNKEEVLRMIKISLLCTNPSPALRPT  500

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG   + E+  +   F  +A+R  Y QM  H S        SSD+
Sbjct  501  MSAVVNMLEGRAPVQEFPLNPIIFGDEALRSQYSQMHFHRSSETETIKHSSDS  553



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 134/177 (76%), Gaps = 7/177 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  D++KTH+ +TRVAGT GYMAPEY LWGYLT KVD+YSFGVV LE+VAGKN ++
Sbjct  692  FGLAKLHDEEKTHV-TTRVAGTIGYMAPEYALWGYLTHKVDLYSFGVVVLELVAGKNNMK  750

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  DEN +CLLDW L LQK+   +EL+DPRLGSN+DK++ALR+IKVAL CTNPSPALRP+
Sbjct  751  YHPDENYVCLLDWALVLQKKAKFLELVDPRLGSNYDKKEALRMIKVALRCTNPSPALRPN  810

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG  ++ E + D      E NF  +RD YD+M V  S++     FS+D 
Sbjct  811  MSAVVNMLEGRLNVDESNFDSSGYGDELNFLGLRDKYDEMQVTSSEN-QSVFFSTDT  866



>emb|CBI30743.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  338  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  396

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+  CLLDW   LQ++GNL+EL+DP LG+ F KE+A+R+IKVALLCTN SPALRP+
Sbjct  397  YRPNEDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPT  456

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   + EY  +      EF F+A+R  +DQ  +  S      N SS
Sbjct  457  MSAVVSMLKGQTVVQEYPLNPSIYGDEFGFEALRGQHDQTQLQSSSEIEPLNHSS  511



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score =   200 bits (509),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 133/177 (75%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  821  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  879

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++GNL++L+DPRLGSNF KE+A+R++KVALLCTNP+PALRP+
Sbjct  880  YRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPT  939

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG    HE I++      E    A+R+ +D +    S        SSDA
Sbjct  940  MSSVVSMLEGKTTVHELIMDPSIYGDEMRLTALRNQFDHIAQESSTGTQSLIRSSDA  996



>ref|XP_007025271.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27893.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=346

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  153  FGLAKFDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTK  211

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+ +CL DW L LQ++GNL+EL+DPRLGS F++E+A+R+IKVALLCTN SPALRP 
Sbjct  212  YRPEEDFVCLQDWALVLQQKGNLMELVDPRLGSEFNEEEAIRMIKVALLCTNSSPALRPI  271

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG   + E   D   F     F A+RD  ++M             SSD+
Sbjct  272  MSEVLNMLEGRALVPELIMDPSIFGDESRFGALRDQLNRMQSGKGSETSTFRHSSDS  328



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  821  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  879

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++GNL++L+DPRLGSNF +E+A+R++KVALLCTNP+PALRP+
Sbjct  880  YRPNENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSEEEAIRMVKVALLCTNPAPALRPT  939

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG    HE I++      E    A+R+ +DQ+    S        SS+A
Sbjct  940  MSSVVSMLEGKTTVHELIMDPSIYGDEMRLTALRNQFDQIAQESSTGTQSLIRSSNA  996



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 129/173 (75%), Gaps = 2/173 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  813  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  871

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+   LLDW   LQ++GNL+EL+DP+L S+F+KE+ LR+IK++LLCTNPSPALRP+
Sbjct  872  YRPNEDYFSLLDWAFFLQQKGNLMELVDPKLESDFNKEEVLRMIKISLLCTNPSPALRPT  931

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG   + E+  +   F  +A+R  Y QM  H S        SSD+
Sbjct  932  MSAVVNMLEGRAPVQEFPLNPIIFGDEALRSQYSQMHFHRSSETETIKHSSDS  984



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 129/173 (75%), Gaps = 2/173 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  824  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  882

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+   LLDW   LQ++GNL+EL+DP+L S+F+KE+ LR+IK++LLCTNPSPALRP+
Sbjct  883  YRPNEDYFSLLDWAFFLQQKGNLMELVDPKLESDFNKEEVLRMIKISLLCTNPSPALRPT  942

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG   + E+  +   F  +A+R  Y QM  H S        SSD+
Sbjct  943  MSAVVNMLEGRAPVQEFPLNPIIFGDEALRSQYSQMHFHRSSETETIKHSSDS  995



>ref|XP_008349229.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=284

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  85   FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  143

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++GNLIEL+DPRLGS+ + E+AL ++KVALLC NP+PALRP+
Sbjct  144  YRPNENFVCLVDWALVLQQRGNLIELVDPRLGSDIEVEEALTMVKVALLCINPAPALRPT  203

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD  291
            MS V++MLEG     E ++  +    E     +R+ +D
Sbjct  204  MSAVVSMLEGRTLVRESVMNPNIYGDELKLSTLRNPFD  241



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 7/177 (4%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
              GLAK  +++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGK N+ 
Sbjct  833   FGLAKLVEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKSNMS  891

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             YR  E+ +CLLDW L LQ++G+L+EL+DPRLGSN ++ +A+R+IKVALLCTNPSPALRP+
Sbjct  892   YRPSEDYVCLLDWALVLQQRGSLVELVDPRLGSNINEGEAIRMIKVALLCTNPSPALRPT  951

Query  392   MSLVINMLEGHEDIIEYDTDLHEF----NFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
             MS  + MLEG     E+ +D   +    N Q +RD YD++    S  P   + SSD 
Sbjct  952   MSAALGMLEGRISTQEFSSDPSVYNDGLNLQGLRDKYDELQFS-SIEPQSFSTSSDT  1007



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 133/177 (75%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  821  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  879

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++ NL++L+DPRLGSNF KE+A+R++KVALLCTNP+PALRP+
Sbjct  880  YRPNENFVCLVDWALVLQQKWNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPT  939

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG    HE I++      E    A+R+ +DQ+    S        SS+A
Sbjct  940  MSSVLSMLEGKTAVHELIMDPSIYGDEMRLTALRNQFDQIAQESSTGTQSLIRSSNA  996



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++ THII+T +AGT+GY+APEYVLWG+LT K DVYSFGVV LEIVAGK N++
Sbjct  623  FGLAKLVEEENTHIITT-IAGTKGYIAPEYVLWGHLTHKADVYSFGVVALEIVAGKSNMK  681

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +   EN  CLLDW L LQK+G+L+EL+DPRLGSNF+K +A ++I+VALLCT+P+P LRP+
Sbjct  682  FSPSENFFCLLDWALVLQKKGSLMELVDPRLGSNFNKNEAEKIIRVALLCTSPAPTLRPA  741

Query  392  MSLVINMLEGHEDIIEYDTD--LH--EFNFQAMRDHYDQMPVHLSDS  264
            MS V++MLEGH +I E++ D  +H  E   QA+R+ YD++   LS +
Sbjct  742  MSEVVSMLEGHVNIQEFNMDSRIHDSELKLQALREKYDELYDDLSKT  788



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 125/163 (77%), Gaps = 9/163 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK DD+DKTHI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  839  FGLAKLDDEDKTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  897

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQK G L+EL+D  L S+F K++ALR+I VALLCTNPSPALRP+
Sbjct  898  YRPNEKFVCLLDWALVLQKHGKLMELVDETLSSDFKKDEALRMINVALLCTNPSPALRPT  957

Query  392  MSLVINMLEGHEDIIEY-------DTDLHEFNFQAMRDHYDQM  285
            MS V+++LE H D+ E+       D D  E  FQ +RD YD+M
Sbjct  958  MSAVVSILEDHLDLPEFNLESRSHDDDDDELKFQGLRDKYDEM  1000



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  784  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  842

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+  CLLDW   LQ++GNL+EL+DP LG+ F KE+A+R+IKVALLCTN SPALRP+
Sbjct  843  YRPNEDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPT  902

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   + EY  +      EF F+A+R  +DQ  +  S      N SS
Sbjct  903  MSAVVSMLKGQTVVQEYPLNPSIYGDEFGFEALRGQHDQTQLQSSSEIEPLNHSS  957



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  784  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  842

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+  CLLDW   LQ++GNL+EL+DP LG+ F KE+A+R+IKVALLCTN SPALRP+
Sbjct  843  YRPNEDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPT  902

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   + EY  +      EF F+A+R  +DQ  +  S      N SS
Sbjct  903  MSAVVSMLKGQTVVQEYPLNPSIYGDEFGFEALRGQHDQTQLQSSSEIEPLNHSS  957



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LE+VAGKN ++
Sbjct  806  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMK  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+  CLLDW   LQ++GNL+EL+DP LG+ F KE+A+R+IKVALLCTN SPALRP+
Sbjct  865  YRPNEDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPT  924

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V++ML+G   + EY  +      EF F+A+R  +DQ  +  S      N SS
Sbjct  925  MSAVVSMLKGQTVVQEYPLNPSIYGDEFGFEALRGQHDQTQLQSSSEIEPLNHSS  979



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score =   194 bits (493),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 125/160 (78%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK DD+DKTHI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  812  FGLAKLDDEDKTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  870

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQK G L+EL+D  L S+F K++ALR+I VALLCTNPSPALRP+
Sbjct  871  YRPNEKFVCLLDWALVLQKHGKLMELVDETLNSDFKKDEALRMINVALLCTNPSPALRPT  930

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V+++LE H D+ E++ +      E  FQ +RD YD+M
Sbjct  931  MSAVVSILEDHLDLPEFNLESRSHDDELKFQGLRDKYDEM  970



>ref|XP_011460364.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420 [Fragaria vesca subsp. vesca]
Length=1000

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 5/166 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLAK D+++KTHI STR+AGT GYMAPEY LWGYLT KVDVYSFGVV LE+V+GKN+++
Sbjct  803  FGLAKLDEEEKTHI-STRIAGTIGYMAPEYALWGYLTDKVDVYSFGVVALELVSGKNIKF  861

Query  569  RRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSM  390
            R +EN +CLLDW L LQ++ NL+EL+DP+LGS F+KEQA+R+IKVALLCTNPSPALRP+M
Sbjct  862  RSNENYVCLLDWALILQQKENLMELVDPKLGSKFNKEQAMRMIKVALLCTNPSPALRPTM  921

Query  389  SLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDS  264
            S  ++MLEG   I E   +L     E    A RD  + + +  S S
Sbjct  922  SAALSMLEGRAVIHESSRNLSMYGDELGSMASRDDSNDLNIQHSPS  967



>ref|XP_011461827.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Fragaria vesca subsp. vesca]
Length=1007

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 135/179 (75%), Gaps = 8/179 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV GKN ++
Sbjct  812  FGLAKLDEEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVVGKNNMK  870

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R DEN +C++DW L LQ++G L+EL+DPRLGS+F++E+A+R++KVALLCTNP+PALRP+
Sbjct  871  FRADENFVCVVDWALVLQQKGKLMELVDPRLGSDFNQEEAIRMVKVALLCTNPAPALRPT  930

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANF--SSDA  234
            MS V++MLEG    HE I++      E    A+RD +++     S S    +F  +SDA
Sbjct  931  MSAVVSMLEGRSVVHELIMDPSIYGDETRLTALRDRFERFVTEDSSSSGAQSFLRASDA  989



>ref|XP_004296585.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440, partial [Fragaria vesca subsp. vesca]
Length=249

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 129/176 (73%), Gaps = 7/176 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI S+RVAGT GYMAPEY LWGYLT KVDVYSFGVV LE+V+G+N V+
Sbjct  60   FGLAKLDEEEKTHI-SSRVAGTIGYMAPEYALWGYLTDKVDVYSFGVVALELVSGENNVK  118

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R +EN +CLLD+ L LQ++  L+EL+DP+L S F+KE+A+R+IKVALLCT+PSPALRP+
Sbjct  119  FRPNENYVCLLDYALVLQQKEKLMELVDPKLESKFNKEEAMRMIKVALLCTHPSPALRPT  178

Query  392  MSLVINMLEGHEDIIEYDTDL-----HEFNFQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS  ++MLEG   I E +T       HE  F++ RD Y  + +     P     SS
Sbjct  179  MSAALSMLEGRAVIHELNTSSSMYSDHELAFESFRDEYHDVSIQQRLPPQGPEASS  234



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIVAGKN  +
Sbjct  586  FGLAKLDEEENTHI-STRVAGTVGYMAPEYALWGYLTDKADVYSFGVVALEIVAGKNNXK  644

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR ++N +CL+DW L LQ++GNL++L+DPRLGS F KE+A+R++KVALLCTNP+PAL P+
Sbjct  645  YRPNQNFVCLVDWALVLQQKGNLMDLVDPRLGSQFSKEEAIRMVKVALLCTNPAPALXPT  704

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ MLEG    HE I++      E    A+R+ +DQ+    S        SSD+
Sbjct  705  MSAVVRMLEGETAVHELIMDPSIYGDEMXLTAVRNQFDQIAQESSSGTQSRLRSSDS  761



>ref|XP_006388189.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
 gb|ERP47103.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
Length=325

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 131/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  129  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  187

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  188  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  247

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRD---HYDQMPVHLSDSP  261
            MS V++MLEG  D+ E             Y T LH    Q+  +      Q  V  S+ P
Sbjct  248  MSTVVSMLEGKTDVEELVMVPSTLGDPSGYATALHNKFAQSSANGSLSETQSLVKSSEGP  307

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  308  WTASSSSSA  316



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 131/167 (78%), Gaps = 7/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLA+ D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  803  FGLARLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  861

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R +EN +CLLDW L LQ++GNL+EL+D +LGS F+KE+A+R+I+VALLCTNPSPALRP+
Sbjct  862  FRPNENYVCLLDWALVLQQKGNLMELLDTKLGSKFNKEEAMRIIRVALLCTNPSPALRPT  921

Query  392  MSLVINMLEGHEDI--IEYDTDLH--EFNFQAMRDHYDQMPVHLSDS  264
            MS  ++MLEGH  +  I  +   H  +  F++  D YDQ+ +  S++
Sbjct  922  MSTAVSMLEGHTAVHEISGEPSFHGDDMRFKSFPD-YDQVVLQSSET  967



>ref|XP_006495027.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Citrus sinensis]
Length=380

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GKN + 
Sbjct  143  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMS  201

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D NC C LDW   L + G L+EL+DPRLGS FDK +A R+IKVALLCTN SP+LRP+
Sbjct  202  YVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFDKVEAERMIKVALLCTNASPSLRPT  261

Query  392  MSLVINMLEGHEDI---IEYDTDLHE-FNFQAMRDHYDQM  285
            MS V++MLEG  +I   I     L E   F+ +RDH  +M
Sbjct  262  MSEVVSMLEGSSNIPYVIPEAGGLSEDLRFKTLRDHPREM  301



>ref|XP_009758721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Nicotiana sylvestris]
Length=422

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 125/174 (72%), Gaps = 14/174 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNV-E  573
             GLAK DD+D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI AGK++  
Sbjct  235  FGLAKLDDEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMT  293

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW + LQ+QG L++L+D  LGS+  +++ALR+I VALLCTNPSPALRP+
Sbjct  294  YRPNEKFVCLLDWAVVLQRQGKLMDLVDETLGSDLKQDEALRMINVALLCTNPSPALRPT  353

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQMPVHLSDSPYQ  255
            MS VI +LE H D+ E+        D D H  NFQ +RD Y  M   LS S  Q
Sbjct  354  MSAVIRILEDHLDLPEFNVESRFYDDCDDH-LNFQGLRDKYGPM---LSSSQSQ  403



>ref|XP_007025270.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27892.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=941

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 125/177 (71%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK  +++ THI STR AGT GYMAPEYVLWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  748  FGLAKFVEEENTHI-STRAAGTMGYMAPEYVLWGYLTYKADVYSFGIVALEIVAGKNNTK  806

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+ +CL DW L LQ +GNL+EL+DPRLGS F++E+A+R+IKVALLCTN SPALRP 
Sbjct  807  YRPEEDFVCLQDWALVLQHKGNLMELVDPRLGSEFNEEEAIRMIKVALLCTNSSPALRPI  866

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+NMLEG   + E   D      E    A+RD  ++M     D       SSD+
Sbjct  867  MSEVVNMLEGRTLVPELIMDSSIFGDELRIGALRDQCNRMQTGKDDETSTFRHSSDS  923



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 135/186 (73%), Gaps = 16/186 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++++K+HI STRVAGT GYMAPEY LWG+LT KVDVY FGVV LE+V+GKN ++
Sbjct  461  FGLAKLNEEEKSHI-STRVAGTIGYMAPEYALWGHLTDKVDVYGFGVVALELVSGKNNIK  519

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +EN +CLLDW   LQ++GNL+EL+DP+LGS F+KE+A+R+IKVALLCTNPSPALRP+
Sbjct  520  YQPNENYVCLLDWAFVLQQKGNLMELVDPKLGSEFNKEEAMRMIKVALLCTNPSPALRPT  579

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD----------QMPVHLSDSPYQ  255
            MS V++MLEG    HE  I       E  F+++RD  +          Q  ++LSD+   
Sbjct  580  MSAVVSMLEGRAIVHELNINPSIYCDEMRFKSLRDESNLSVQQSWCETQSLIYLSDARGT  639

Query  254  ANFSSD  237
             + SS 
Sbjct  640  TSSSSS  645



>gb|KJB57354.1| hypothetical protein B456_009G159400 [Gossypium raimondii]
Length=967

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  777  FGLAKFDEEENTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTK  835

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL DW L LQ++GNL+EL+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+
Sbjct  836  YRPEENYVCLQDWALVLQQKGNLMELVDPRLGTEFNEEEAIRMAKVALLCTNSSPALRPT  895

Query  392  MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDS  264
            MS V+NMLEG     E I++      E  F A++D +++M    S +
Sbjct  896  MSEVVNMLEGRTLVPELILDPSIFADESRFGAVKDQFNRMQSRSSKT  942



>gb|KJB57353.1| hypothetical protein B456_009G159400 [Gossypium raimondii]
Length=1015

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  825  FGLAKFDEEENTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTK  883

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL DW L LQ++GNL+EL+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+
Sbjct  884  YRPEENYVCLQDWALVLQQKGNLMELVDPRLGTEFNEEEAIRMAKVALLCTNSSPALRPT  943

Query  392  MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDS  264
            MS V+NMLEG     E I++      E  F A++D +++M    S +
Sbjct  944  MSEVVNMLEGRTLVPELILDPSIFADESRFGAVKDQFNRMQSRSSKT  990



>ref|XP_008225259.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=883

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 133/181 (73%), Gaps = 13/181 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVVTLEIVAGK N++
Sbjct  683  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVTLEIVAGKSNMK  741

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ++G L+EL+DPRLGS+  +E+A+R+IKVALLC N +PALRP+
Sbjct  742  YRPNENFVCLLDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPA  801

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANF----SSD  237
            MS V++MLEG    HE + +  T   E    A+ + +D    + S +P Q +     SSD
Sbjct  802  MSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDH---NSSQNPSQTHLIVPSSSD  858

Query  236  A  234
            A
Sbjct  859  A  859



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score =   189 bits (480),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 128/180 (71%), Gaps = 12/180 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+D+ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GKN ++
Sbjct  765  FGLAKLDEDENTHI-STRVAGTIGYMAPEYALWGYLTQKADVYSFGVVALEIVSGKNNMK  823

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR DE+ +CLLDW   LQ++GNL++L+DPRLGS F KE+ +R+ KVALLCTN SPALRP+
Sbjct  824  YRPDEDFVCLLDWAFVLQQKGNLMDLVDPRLGSKFKKEEVIRMAKVALLCTNTSPALRPT  883

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ MLEG   + E       Y  +L     + + + YDQ+ +H S  P     SS+A
Sbjct  884  MSEVVGMLEGRTPVRELVMGSGFYGDELRS---KVLSNQYDQISLHSSSDPRSFIHSSEA  940



>emb|CBI30752.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLAK ++++ THI STR+AGTRGYMAPEY LWG+LT K D+YSFGVV LEIV+GKN   
Sbjct  300  FGLAKLNEEENTHI-STRIAGTRGYMAPEYALWGHLTDKADIYSFGVVALEIVSGKNNSS  358

Query  569  RRDEN-CLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            R+ EN C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVA+LCTN SP LRP 
Sbjct  359  RKPENECVCLLDRAFALQQKGSLMEIVDPKLGSEFNRDEAERMIKVAILCTNASPTLRPI  418

Query  392  MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG     E I +   D    NF+++ D++ +M   +      + FSSD 
Sbjct  419  MSAVVSMLEGQTIVPEVISDASMDEDYLNFKSLGDYHKRMQKQILSGSEASKFSSDG  475



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 15/185 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LE+++GKN ++
Sbjct  805  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELLSGKNNIK  863

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ++GNL+EL+DP+LGS F+KE+A+R+IKVALLC NPSPALRP+
Sbjct  864  YRPNENFVCLLDWALVLQQKGNLMELVDPKLGSQFNKEEAMRMIKVALLCANPSPALRPT  923

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD---------QMPVHLSDSPYQA  252
            MS V++MLEG    HE  I       E  F+A  +  D         Q  ++ S+  + A
Sbjct  924  MSAVVSMLEGQTIVHEVKINPSIYGDELGFKAFTEDSDIDHSSYDETQSLIYSSNEKWTA  983

Query  251  NFSSD  237
            + SS 
Sbjct  984  STSSS  988



>ref|XP_011460366.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Fragaria vesca subsp. vesca]
Length=868

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LE+V+GKN ++
Sbjct  674  FGLAKLDEEEHTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELVSGKNNIK  732

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ++GNL+EL+DP+LGS F+KE+ALR+IKVALLC N SPALRP+
Sbjct  733  YRPNENFVCLLDWALVLQQKGNLMELVDPKLGSGFNKEEALRMIKVALLCANSSPALRPT  792

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYD  291
            MS V++MLEG  D+ E   +      E  F+A  +  D
Sbjct  793  MSQVVSMLEGRTDVHEVTINPSIYDDEMRFKAFTEDSD  830



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 15/185 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LE+++GKN ++
Sbjct  808  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELLSGKNNIK  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ++GNL+EL+DP+LGS F+KE+A+R+IKVALLC NPSPALRP+
Sbjct  867  YRPNENFVCLLDWALVLQQKGNLMELVDPKLGSQFNKEEAMRMIKVALLCANPSPALRPT  926

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD---------QMPVHLSDSPYQA  252
            MS V++MLEG    HE  I       E  F+A  +  D         Q  ++ S+  + A
Sbjct  927  MSAVVSMLEGQTIVHEVKINPSIYGDELGFKAFTEDSDIDHSSYDETQSLIYSSNEKWTA  986

Query  251  NFSSD  237
            + SS 
Sbjct  987  STSSS  991



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 125/160 (78%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             GLAK D+++ THI STR+AGT GYMAPEY LWGYLT+K DV+SF VV LEI+AG  N++
Sbjct  728  FGLAKLDEEENTHI-STRIAGTIGYMAPEYALWGYLTYKADVFSFAVVALEILAGTSNMK  786

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ+QGNL+EL+DP LGS+F+KE+A+R+IK+A+LCTN SPALRP 
Sbjct  787  YRPNENYVCLVDWALVLQQQGNLMELVDPNLGSDFNKEEAVRMIKIAILCTNQSPALRPI  846

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG    H+ I++      E  F A+R  +DQM
Sbjct  847  MSAVVSMLEGRTAVHDLIMDPSIYGDELRFTALRKQFDQM  886



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 6/158 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LE+++GKN ++
Sbjct  771  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELLSGKNNIK  829

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ++GNL+EL+DP+LGS F+KE+A+R+IKVALLC NPSPALRP+
Sbjct  830  YRPNENFVCLLDWALVLQQKGNLMELVDPKLGSQFNKEEAMRMIKVALLCANPSPALRPT  889

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD  291
            MS V++MLEG    HE  I       E  F+A  +  D
Sbjct  890  MSAVVSMLEGQTIVHEVKINPSIYGDELGFKAFTEDSD  927



>gb|KJB57366.1| hypothetical protein B456_009G159500 [Gossypium raimondii]
Length=949

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  759  FGLAKFDEEENTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTK  817

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E+ +CL DW L LQ++GNL+EL+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+
Sbjct  818  YRPEEDYVCLQDWALVLQQKGNLMELVDPRLGTEFNEEEAIRMTKVALLCTNSSPALRPT  877

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q  225
            MS V+NMLEG   + E   D   F+    F A++D +++M    S +      SSD+   
Sbjct  878  MSEVVNMLEGRTLVPELILDPSIFSDESRFGAVKDQFNRMQSRSSKTTTITQ-SSDSTST  936

Query  224  *KIASFTNIVQ  192
              I S + +V+
Sbjct  937  VWIGSSSTLVE  947



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGV+ LEIVAGKN + 
Sbjct  734  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVLALEIVAGKNNMR  792

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW + LQ++GNL++L+DP+ GS F+KE+A R+IKVALLCTNPS ALRP 
Sbjct  793  YRPNENFVCLLDWAIFLQQKGNLMDLVDPKSGSEFNKEEANRMIKVALLCTNPSQALRPG  852

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD  291
            MS V++MLEG    HE I++   +     F A+RD +D
Sbjct  853  MSEVVSMLEGRTAVHELIMDPSNNHDPLRFNALRDQFD  890



>ref|XP_006388928.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
 gb|ERP47842.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
Length=415

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 132/189 (70%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  219  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  277

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD  L LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  278  FRRDENFVCLLDRALYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  337

Query  392  MSLVINMLEGHEDIIE-------------YDTDLH-EFNFQAMRDHYDQMP--VHLSDSP  261
            MS V++MLEG  D+ E             Y T LH +F   ++     + P  V  S+ P
Sbjct  338  MSTVVSMLEGKTDVEELVMVPSTLGDPSGYATALHNKFAQSSVNGSISETPSLVKSSEGP  397

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  398  WTASSSSSA  406



>gb|KJB57365.1| hypothetical protein B456_009G159500 [Gossypium raimondii]
Length=1015

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
              GLAK D+++ THI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  825   FGLAKFDEEENTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTK  883

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             YR +E+ +CL DW L LQ++GNL+EL+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+
Sbjct  884   YRPEEDYVCLQDWALVLQQKGNLMELVDPRLGTEFNEEEAIRMTKVALLCTNSSPALRPT  943

Query  392   MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q  225
             MS V+NMLEG   + E   D   F+    F A++D +++M    S +      SSD+   
Sbjct  944   MSEVVNMLEGRTLVPELILDPSIFSDESRFGAVKDQFNRMQSRSSKTTTITQ-SSDSTST  1002

Query  224   *KIASFTNIVQ  192
               I S + +V+
Sbjct  1003  VWIGSSSTLVE  1013



>ref|XP_011460365.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Fragaria vesca subsp. vesca]
Length=1001

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LE+V+GKN ++
Sbjct  807  FGLAKLDEEEHTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELVSGKNNIK  865

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ++GNL+EL+DP+LGS F+KE+ALR+IKVALLC N SPALRP+
Sbjct  866  YRPNENFVCLLDWALVLQQKGNLMELVDPKLGSGFNKEEALRMIKVALLCANSSPALRPT  925

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYD  291
            MS V++MLEG  D+ E   +      E  F+A  +  D
Sbjct  926  MSQVVSMLEGRTDVHEVTINPSIYDDEMRFKAFTEDSD  963



>ref|XP_008345983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=674

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  474  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  532

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++GNLIEL+DPRLGS+F+ E+ + ++KVALLC NP+PALRP+
Sbjct  533  YRPNENFVCLVDWALVLQQKGNLIELVDPRLGSDFEVEEVITMVKVALLCINPAPALRPT  592

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG     E ++  +    E     +R+ +D      +        SSDA
Sbjct  593  MSAVVSMLEGRTLVRESVMNPNIYGDELKLATLRNPFDPTAQGGTSGTQSLVGSSDA  649



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 7/161 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++  THI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  667  FGLAKLDEEGNTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  725

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +E+ +CLLDW   LQ++GNL+EL+DP+LG++ +KE+A  +IKVALLCTNPSPALRP+
Sbjct  726  YKPNEDYVCLLDWAFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPT  785

Query  392  MSLVINMLEGHEDIIEY-----DTDLHEFNFQAMRDHYDQM  285
            MS V++ML+G   + E       +      F A+R  YDQM
Sbjct  786  MSAVVSMLKGQTVVPEVLIMDPSSYSDHLKFNALRGQYDQM  826



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 123/177 (69%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFG+V LE VAGK N  
Sbjct  821  FGLAKFDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGIVALETVAGKKNTR  879

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  +E+ +CL DW L LQ++GNL+EL+DP LG  F+KE+A+R+IKVALLCTNPSPALRP+
Sbjct  880  YGPEEDFVCLQDWALVLQQKGNLMELVDPSLGGEFNKEEAVRMIKVALLCTNPSPALRPN  939

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ ML+G   + E   D      E    A+RD ++QM             SSD+
Sbjct  940  MSEVVKMLKGRTHVPELIMDPSIFGDELRLGALRDQFNQMQPRKGGESSTFTHSSDS  996



>ref|XP_011461996.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Fragaria vesca subsp. vesca]
Length=529

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 6/147 (4%)
 Frame = -1

Query  716  THIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VEYRRDENCLCLL  540
            THI STRVAGT GYMA EY LWGYLT K DVYSFGVV LE+V+GKN ++YR +EN +CLL
Sbjct  350  THI-STRVAGTIGYMASEYALWGYLTDKADVYSFGVVALELVSGKNNIKYRPNENFVCLL  408

Query  539  DWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH  360
            DW L LQ++GNL+EL+DP+LGS F+KE+ALR+IKVALLC N SPALRP+MS V++MLEG 
Sbjct  409  DWALVLQQKGNLMELVDPKLGSGFNKEEALRMIKVALLCANSSPALRPTMSQVVSMLEGR  468

Query  359  EDIIEYDTDLH----EFNFQAMRDHYD  291
             D+ E   +      E  F+A  +  D
Sbjct  469  TDVHEVTINPSIYGDEMRFKAFTEDSD  495



>ref|XP_009600352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X6 [Nicotiana tomentosiformis]
Length=812

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 11/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNV-E  573
             GLAK DD+D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI AGK++  
Sbjct  625  FGLAKLDDEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMT  683

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQ+QG L+EL+D  LGS+  +++ALR+I VALLCTNPSPALRP+
Sbjct  684  YRPNEKFVCLLDWALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPT  743

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQ  288
            MS V+++LE   D+ E+        D D H  NFQ +RD Y +
Sbjct  744  MSAVVSILENQLDLPEFNMESRFYDDYDDH-LNFQGLRDKYGE  785



>ref|XP_009600351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Nicotiana tomentosiformis]
Length=856

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 11/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNV-E  573
             GLAK DD+D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI AGK++  
Sbjct  669  FGLAKLDDEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMT  727

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQ+QG L+EL+D  LGS+  +++ALR+I VALLCTNPSPALRP+
Sbjct  728  YRPNEKFVCLLDWALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPT  787

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQ  288
            MS V+++LE   D+ E+        D D H  NFQ +RD Y +
Sbjct  788  MSAVVSILENQLDLPEFNMESRFYDDYDDH-LNFQGLRDKYGE  829



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 7/161 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++  THI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  789  FGLAKLDEEGNTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  847

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +E+ +CLLDW   LQ++GNL+EL+DP+LG++ +KE+A  +IKVALLCTNPSPALRP+
Sbjct  848  YKPNEDYVCLLDWAFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPT  907

Query  392  MSLVINMLEGHEDIIEY-----DTDLHEFNFQAMRDHYDQM  285
            MS V++ML+G   + E       +      F A+R  YDQM
Sbjct  908  MSAVVSMLKGQTVVPEVLIMDPSSYSDHLKFNALRGQYDQM  948



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (76%), Gaps = 7/161 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++  THI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  671  FGLAKLDEEGNTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  729

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +E+ +CLLDW    Q++GNL+EL+DP+LG++ +KE+A  +IKVALLCTNPSPALRP+
Sbjct  730  YKPNEDYVCLLDWAFVXQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPT  789

Query  392  MSLVINMLEGHED-----IIEYDTDLHEFNFQAMRDHYDQM  285
            MS V++ML+G        I++  +      F A+R  YDQM
Sbjct  790  MSAVVSMLKGQTVVPEVLIMDPSSYSDHLKFNALRGQYDQM  830



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 123/161 (76%), Gaps = 7/161 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++  THI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  788  FGLAKLDEEGNTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  846

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +E+ +CLLDW   LQ++GNL+EL+DP+LG++ +KE+A  +IKVALLCTNPSPALRP+
Sbjct  847  YKPNEDYVCLLDWAFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPT  906

Query  392  MSLVINMLEGHED-----IIEYDTDLHEFNFQAMRDHYDQM  285
            MS V++ML+G        I++  +      F A+R  YDQM
Sbjct  907  MSAVVSMLKGQTVVPEVLIMDPSSYSDHLKFNALRGQYDQM  947



>emb|CBI30754.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++ + THI STR+AGT GYMAPEY LWGYLT K DVYSFGVVTLEIV+GKN   
Sbjct  356  FGLAKLNEGENTHI-STRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSN  414

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D  C CLLDW   L+++G+L+EL+DP LG+ F+K++A  +IKVALLCTN S  LRP+
Sbjct  415  YTPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPT  474

Query  392  MSLVINMLEGHEDIIEYDTD----LHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ MLEG + I E  +D      +     +RDHY  M +  S      NFS D 
Sbjct  475  MSAVLRMLEGQDIIPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPNFSLDG  531



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLAK D++  THI STR+AGT GYMAPEY LWG+LT+K DVYSFGVV LEIV+GKN   
Sbjct  790  FGLAKLDEEANTHI-STRIAGTIGYMAPEYALWGHLTYKADVYSFGVVALEIVSGKNNMK  848

Query  569  RR-DENCLCLLDWVLDLQKQGNLIELIDPR--LGSNFDKEQALRVIKVALLCTNPSPALR  399
            RR D++ +CLLDW L L + GNL+EL+DPR  L S F+KE  LRVI+VALLCTNPSPA+R
Sbjct  849  RRPDDDFVCLLDWALVLHQDGNLMELVDPRLDLKSKFEKE-VLRVIEVALLCTNPSPAVR  907

Query  398  PSMSLVINMLEGHEDI--IEYDTDLH--EFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            P+MS V++MLEG  +I  +  D  L+  EF F+AMR  YDQ+ V  S        SSD 
Sbjct  908  PAMSTVVSMLEGRGEIHNLAIDPSLYGDEFRFKAMRKQYDQILVEGSRETQSLVNSSDT  966



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 123/161 (76%), Gaps = 7/161 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++  THI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  811  FGLAKLDEEGNTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  869

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +E+ +CLLDW   LQ++GNL+EL+DP+LG++ +KE+A  +IKVALLCTNPSPALRP+
Sbjct  870  YKPNEDYVCLLDWAFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPT  929

Query  392  MSLVINMLEGHED-----IIEYDTDLHEFNFQAMRDHYDQM  285
            MS V++ML+G        I++  +      F A+R  YDQM
Sbjct  930  MSAVVSMLKGQTVVPEVLIMDPSSYSDHLKFNALRGQYDQM  970



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 131/181 (72%), Gaps = 13/181 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVVTLEIVAGK N++
Sbjct  783  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVAGKSNMK  841

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQK+G L+EL+DPRLGS+  +E+A+R+IKVALLC N +PALRP+
Sbjct  842  YRPNENFVCLVDWALVLQKKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPA  901

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQAN----FSSD  237
            MS V++MLEG    HE + +  T   E    A+ + +D    + S +P Q       SSD
Sbjct  902  MSAVVSMLEGRTAVHELVTDPSTYGDELRLTALPNQFDH---NSSQNPSQTQSLVPSSSD  958

Query  236  A  234
            A
Sbjct  959  A  959



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  811  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  869

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++GNLIEL+DPRLGS+F+ E+ + ++KVALLC NP+PALRP+
Sbjct  870  YRPNENFVCLVDWALVLQQKGNLIELVDPRLGSDFEVEEVITMVKVALLCINPAPALRPT  929

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYD  291
            MS V++MLEG     E ++  +    E     +R+ +D
Sbjct  930  MSAVVSMLEGRTLVRESVMNPNIYGDELKLATLRNPFD  967



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 130/181 (72%), Gaps = 13/181 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  736  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  794

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++G L+EL+DPRLGS+  +E+A+R+IKVALLC N +PALRP+
Sbjct  795  YRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPT  854

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQAN----FSSD  237
            MS V++MLEG    HE + +  T   E    A+ + +D      S +P Q       SSD
Sbjct  855  MSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDHSS---SQNPSQTQSLVPSSSD  911

Query  236  A  234
            A
Sbjct  912  A  912



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYL+ K DVYSFGVVTLE+V+GKN ++
Sbjct  806  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLSDKADVYSFGVVTLELVSGKNNIK  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L LQ+ GNL+EL+D +LGS F+KE+A+R+IKVALLC NPSPALRPS
Sbjct  865  YRPNENFVCLLDWALVLQQNGNLMELVDRKLGSGFNKEEAMRMIKVALLCANPSPALRPS  924

Query  392  MSLVINMLEGHEDIIE  345
            MS V++MLEG   + E
Sbjct  925  MSAVVSMLEGQTLVQE  940



>ref|XP_009600350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Nicotiana tomentosiformis]
Length=911

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 11/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNV-E  573
             GLAK DD+D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI AGK++  
Sbjct  724  FGLAKLDDEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMT  782

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQ+QG L+EL+D  LGS+  +++ALR+I VALLCTNPSPALRP+
Sbjct  783  YRPNEKFVCLLDWALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPT  842

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQ  288
            MS V+++LE   D+ E+        D D H  NFQ +RD Y +
Sbjct  843  MSAVVSILENQLDLPEFNMESRFYDDYDDH-LNFQGLRDKYGE  884



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 132/189 (70%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  403  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  461

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  462  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  521

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             Y T LH+   Q+  +      Q  V  S+ P
Sbjct  522  MSTVVSMLEGKTDVEELVMVPSTLGDPSGYATALHKKFAQSSVNGSLGESQSLVKSSEGP  581

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  582  WTASSSSSA  590



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 121/158 (77%), Gaps = 4/158 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV GK N++
Sbjct  789  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTHKADVYSFGVVALEIVVGKSNMK  847

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R DEN +CLLDW L L ++G+L++L+D RL S F K++A+R+IKVALLCTNPSP+LRP+
Sbjct  848  FRPDENFVCLLDWALVLHQKGDLLKLVDERLESKFSKKEAVRMIKVALLCTNPSPSLRPT  907

Query  392  MSLVINMLEGHEDIIEY--DTDLHEFNFQAMRDHYDQM  285
            MS  + MLEG   + E+     ++   F A+R+ YDQ+
Sbjct  908  MSEAVRMLEGRAAVPEFVMGQSVYADGFGALRNQYDQI  945



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 122/159 (77%), Gaps = 6/159 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYMAPEY LWGYLT+K DVYSFGVV LEIVAGKN ++
Sbjct  747  FGLAKLDEEENTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  805

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW L LQ++G L+EL+DPRLGS+  +E+A+R+IKVALLC N +PALRP+
Sbjct  806  YRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPT  865

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQ  288
            MS V++MLEG    HE + +  T   E    A+ + +D 
Sbjct  866  MSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDH  904



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 133/189 (70%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+DKTHI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  796  FGMAKLDDEDKTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  854

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLDWVL LQK G+++E++DPRLGS F+K++ +R+I +ALLCTN SPALRP+
Sbjct  855  FRRDENFVCLLDWVLYLQKSGDIMEMVDPRLGSEFNKKEVVRMINIALLCTNQSPALRPT  914

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRD---HYDQMPVHLSDSP  261
            MS V++MLEG  D+ E             Y T LH+   Q+  +      Q  V  S+ P
Sbjct  915  MSTVVSMLEGKTDVEELVMVPSTLVDPSGYATALHKKFAQSSVNGSLSESQSLVKSSEGP  974

Query  260  YQANFSSDA  234
              A+ SS A
Sbjct  975  GTASSSSSA  983



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 11/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNV-E  573
             GLAK DD+D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI AGK++  
Sbjct  806  FGLAKLDDEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMT  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQ+QG L+EL+D  LGS+  +++ALR+I VALLCTNPSPALRP+
Sbjct  865  YRPNEKFVCLLDWALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPT  924

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQ  288
            MS V+++LE   D+ E+        D D H  NFQ +RD Y +
Sbjct  925  MSAVVSILENQLDLPEFNMESRFYDDYDDH-LNFQGLRDKYGE  966



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 11/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNV-E  573
             GLAK DD+D THI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI AGK++  
Sbjct  806  FGLAKLDDEDNTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMT  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +E  +CLLDW L LQ+QG L+EL+D  LGS+  +++ALR+I VALLCTNPSPALRP+
Sbjct  865  YRPNEKFVCLLDWALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPT  924

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQ  288
            MS V+++LE   D+ E+        D D H  NFQ +RD Y +
Sbjct  925  MSAVVSILENQLDLPEFNMESRFYDDYDDH-LNFQGLRDKYGE  966



>ref|XP_006377514.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
 gb|ERP55311.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
Length=308

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 118/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  101  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  159

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  160  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  219

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  220  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KHLKGHYQQV  259



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 121/160 (76%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             GLAK D+++ THI +TRVAGT GYMAPEY LWGYLTFK DVYSFG+V LE+VAG  N +
Sbjct  435  FGLAKLDEEENTHI-TTRVAGTIGYMAPEYALWGYLTFKADVYSFGIVALELVAGISNTK  493

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +  DE+ +CLLDW L  Q++G L+ L+DPRLGS+F+ E+A R+IKVAL CTNPSPALRP+
Sbjct  494  FGPDEDYVCLLDWALVSQQKGKLMRLVDPRLGSDFNTEEAARMIKVALQCTNPSPALRPT  553

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG    HE +++      +  FQA+ ++ D +
Sbjct  554  MSAVVSMLEGRTLVHELVMDPSVYADQLRFQALTEYIDHL  593



>ref|XP_006377482.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
 gb|ERP55279.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
Length=617

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 119/163 (73%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  410  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  468

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK ALLCTN SP+LRP+
Sbjct  469  YRPENENVCLLDWAHVLQKKGNLMEIMDPKLQSEFNKEEAERMIKAALLCTNASPSLRPA  528

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V+NMLEG  +I E       YD DL     + ++ HY Q+
Sbjct  529  MSEVLNMLEGQTNIPEVTSDPSIYDNDLQS---KRVKGHYQQV  568



>ref|XP_006467585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Citrus sinensis]
Length=1045

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GKN + 
Sbjct  808  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMS  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D NC C LDW   L + G L+EL+DPRLGS FDK +A R+IKVALLCTN SP+LRP+
Sbjct  867  YVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFDKVEAERMIKVALLCTNASPSLRPT  926

Query  392  MSLVINMLEGHEDI---IEYDTDLHE-FNFQAMRDHYDQM  285
            MS V++MLEG  +I   I     L E   F+ +RDH  +M
Sbjct  927  MSEVVSMLEGSSNIPYVIPEAGGLSEDLRFKTLRDHPREM  966



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++++K+HI STRVAGT GYMAPEY LWG+LT KVDVYSFGVV LE+V+GKN ++
Sbjct  735  FGLAKLNEEEKSHI-STRVAGTIGYMAPEYALWGHLTDKVDVYSFGVVALELVSGKNNIK  793

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW   LQ++GNL+EL+D +LGS F+KE+A+R+IKVALLCTNPSPALRP+
Sbjct  794  YRPNENYVCLLDWAFVLQQKGNLMELVDLKLGSEFNKEEAMRMIKVALLCTNPSPALRPT  853

Query  392  MSLVINMLEGHEDIIEYDTD  333
            MS V++MLEG   + E + +
Sbjct  854  MSAVVSMLEGQAIVHELNIN  873



>ref|XP_010655590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=865

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++ + THI STR+AGT GYMAPEY LWGYLT K DVYSFGVVTLEIV+GKN   
Sbjct  681  FGLAKLNEGENTHI-STRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSN  739

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D  C CLLDW   L+++G+L+EL+DP LG+ F+K++A  +IKVALLCTN S  LRP+
Sbjct  740  YTPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPT  799

Query  392  MSLVINMLEGHEDIIEYDTD----LHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ MLEG + I E  +D      +     +RDHY  M +  S      NFS D 
Sbjct  800  MSAVLRMLEGQDIIPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPNFSLDG  856



>ref|XP_006377521.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
 gb|ERP55318.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
Length=331

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
            +GLAK  +++ TH  STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  123  IGLAKLKEEENTHF-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  181

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   +QK+GNL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  182  YRTTNEFVCLLDWAHVVQKKGNLMEMVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  241

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  242  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KLLKGHYQQV  281



>ref|XP_010655582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=1001

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLAK ++++ THI STR+AGTRGYMAPEY LWG+LT K D+YSFGVV LEIV+GKN   
Sbjct  790  FGLAKLNEEENTHI-STRIAGTRGYMAPEYALWGHLTDKADIYSFGVVALEIVSGKNNSS  848

Query  569  RRDEN-CLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            R+ EN C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVA+LCTN SP LRP 
Sbjct  849  RKPENECVCLLDRAFALQQKGSLMEIVDPKLGSEFNRDEAERMIKVAILCTNASPTLRPI  908

Query  392  MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG     E I +   D    NF+++ D++ +M   +      + FSSD 
Sbjct  909  MSAVVSMLEGQTIVPEVISDASMDEDYLNFKSLGDYHKRMQKQILSGSEASKFSSDG  965



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 129/187 (69%), Gaps = 16/187 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK D++D THI +TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIVAG  N+ 
Sbjct  812  FGMAKLDEEDNTHI-TTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVAGMNNMR  870

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R DE+ +CLLDW L+LQ+ G+++EL+DP+LGS FDK++A+R+I+VALLCTN SPALRP 
Sbjct  871  FRHDEDFVCLLDWALNLQQNGDIMELVDPKLGSGFDKKEAVRMIQVALLCTNQSPALRPK  930

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMP----------VHLSDSPYQ  255
            MS V+ MLEG  D+ E   D   F     F+  +   DQ            V  SD P+ 
Sbjct  931  MSAVVKMLEGKGDVQELVMDPSTFGDPSRFKGYKHKPDQSSFRNISESQSLVRSSDGPWI  990

Query  254  ANFSSDA  234
             + S+ A
Sbjct  991  DSSSTSA  997



>ref|XP_006377459.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
 gb|ERP55256.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
Length=585

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 118/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  356  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  414

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK ALLCTN SP+LRP+
Sbjct  415  YRPENENVCLLDWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPA  474

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V+NMLEG   I E       YD DL     + ++ HY Q+
Sbjct  475  MSEVLNMLEGQTSIPEVTSDPSIYDNDLQS---KRVKGHYQQV  514



>ref|XP_010655580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1038

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
              GLAK ++++ THI STR+AGTRGYMAPEY LWG+LT K D+YSFGVV LEIV+GKN   
Sbjct  827   FGLAKLNEEENTHI-STRIAGTRGYMAPEYALWGHLTDKADIYSFGVVALEIVSGKNNSS  885

Query  569   RRDEN-CLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             R+ EN C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVA+LCTN SP LRP 
Sbjct  886   RKPENECVCLLDRAFALQQKGSLMEIVDPKLGSEFNRDEAERMIKVAILCTNASPTLRPI  945

Query  392   MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
             MS V++MLEG     E I +   D    NF+++ D++ +M   +      + FSSD 
Sbjct  946   MSAVVSMLEGQTIVPEVISDASMDEDYLNFKSLGDYHKRMQKQILSGSEASKFSSDG  1002



>ref|XP_011470947.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=924

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYM PEY LWG LT+K DVYSFGVV LEIV GKN ++
Sbjct  733  FGLAKLDEEENTHI-STRIAGTIGYMTPEYTLWGCLTYKADVYSFGVVALEIVTGKNNMK  791

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN  CL+DW L LQ++GNL+EL+DPRLGS+F+K++ALR IKVALLCTNP+ ALRP 
Sbjct  792  YRPNENIQCLMDWALVLQQKGNLLELVDPRLGSDFNKKEALRTIKVALLCTNPTAALRPI  851

Query  392  MSLVINMLEGHEDIIEYDTDLHEF-----NFQAMRDHYDQ  288
            MS V++MLEG   + +   D   +       +A+RD +D 
Sbjct  852  MSAVVSMLEGRTAVDDVVMDPSVYGDEMTKLRALRDQFDH  891



>ref|XP_010655581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=1009

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 127/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLAK ++++ THI STR+AGTRGYMAPEY LWG+LT K D+YSFGVV LEIV+GKN   
Sbjct  798  FGLAKLNEEENTHI-STRIAGTRGYMAPEYALWGHLTDKADIYSFGVVALEIVSGKNNSS  856

Query  569  RRDEN-CLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            R+ EN C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVA+LCTN SP LRP 
Sbjct  857  RKPENECVCLLDRAFALQQKGSLMEIVDPKLGSEFNRDEAERMIKVAILCTNASPTLRPI  916

Query  392  MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG     E I +   D    NF+++ D++ +M   +      + FSSD 
Sbjct  917  MSAVVSMLEGQTIVPEVISDASMDEDYLNFKSLGDYHKRMQKQILSGSEASKFSSDG  973



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 6/159 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWG+LT KVDVYSFGVV LE+ +GKN ++
Sbjct  788  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGHLTDKVDVYSFGVVALELXSGKNNIK  846

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R  EN +CLLDW   LQ+ GNL+EL DP LGS+F+KEQA+R+IKVA+LCTNP+PALRP+
Sbjct  847  FRPYENYVCLLDWAFVLQQTGNLMELXDPXLGSDFNKEQAMRMIKVAILCTNPAPALRPT  906

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQ  288
            MS V++MLEG    HE  I       E  F+++RD  + 
Sbjct  907  MSAVVSMLEGRAIVHELNINPSIYGDEMRFESLRDESNS  945



>gb|KHG06920.1| hypothetical protein F383_33692 [Gossypium arboreum]
Length=164

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 106/142 (75%), Gaps = 5/142 (4%)
 Frame = -1

Query  674  MAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VEYRRDENCLCLLDWVLDLQKQGNLIE  498
            MAPEY LWGYLTFK DVYSFG+V LEIV GKN  +YR +E+ +CL DW L LQ++GNL+E
Sbjct  1    MAPEYALWGYLTFKADVYSFGIVALEIVTGKNNTKYRPEEDYVCLQDWALVLQQKGNLME  60

Query  497  LIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDL  330
            L+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+MS V+NMLEG     E I++     
Sbjct  61   LVDPRLGTEFNEEEAIRMTKVALLCTNSSPALRPTMSEVVNMLEGRTLVPELILDPSIFA  120

Query  329  HEFNFQAMRDHYDQMPVHLSDS  264
             E  F A++D +++M    S +
Sbjct  121  DESRFGAVKDQFNRMQSQSSKT  142



>ref|XP_006370936.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
 gb|ERP48733.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
Length=580

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK D++D THI STRVAGT GYMAPEY L+G LT+K DVYSFG+V LEIVAG  N+ 
Sbjct  388  FGMAKLDEEDNTHI-STRVAGTMGYMAPEYALYGRLTYKADVYSFGIVALEIVAGMSNMS  446

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            ++ +E+  CLLDW L LQ+ G+++EL+DPRLGS+F K++A R+IKVALLCTN SPALRP+
Sbjct  447  FQHNESFACLLDWALSLQQNGDMMELVDPRLGSDFKKKEAARMIKVALLCTNQSPALRPT  506

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSSD  237
            MS V+ MLEG  D+ E   D   F     F++ + + DQ  V   D       SSD
Sbjct  507  MSAVVRMLEGKGDVQELVVDPSTFGDSLRFKSFQGYSDQSSVLSIDETQSLVRSSD  562



>ref|XP_011470946.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=968

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYM PEY LWG LT+K DVYSFGVV LEIV GKN ++
Sbjct  777  FGLAKLDEEENTHI-STRIAGTIGYMTPEYTLWGCLTYKADVYSFGVVALEIVTGKNNMK  835

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN  CL+DW L LQ++GNL+EL+DPRLGS+F+K++ALR IKVALLCTNP+ ALRP 
Sbjct  836  YRPNENIQCLMDWALVLQQKGNLLELVDPRLGSDFNKKEALRTIKVALLCTNPTAALRPI  895

Query  392  MSLVINMLEGHEDIIEYDTDLHEF-----NFQAMRDHYDQ  288
            MS V++MLEG   + +   D   +       +A+RD +D 
Sbjct  896  MSAVVSMLEGRTAVDDVVMDPSVYGDEMTKLRALRDQFDH  935



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 135/189 (71%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  809  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  867

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLDWVL LQK G++++++DPR+G+ F+K++ +R+I VALLCTN SPALRP+
Sbjct  868  FRRDENVVCLLDWVLYLQKNGDIMDMVDPRMGAEFNKKEVVRMINVALLCTNQSPALRPT  927

Query  392  MSLVINMLEGHEDIIE-------------YDTDL-HEFNFQAMRDHYDQMP--VHLSDSP  261
            MS V++MLEG  D+ E             Y T L ++F   ++ +   + P  V  S+ P
Sbjct  928  MSTVVSMLEGKTDVEELVMVPSTLVDPSRYATSLQNKFAQSSVNESSSETPSLVKSSEGP  987

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  988  WTASSSSWA  996



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 135/189 (71%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  807  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  865

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLDWVL LQK G++++++DPR+G+ F+K++ +R+I VALLCTN SPALRP+
Sbjct  866  FRRDENVVCLLDWVLYLQKNGDIMDMVDPRMGAEFNKKEVVRMINVALLCTNQSPALRPT  925

Query  392  MSLVINMLEGHEDIIE-------------YDTDL-HEFNFQAMRDHYDQMP--VHLSDSP  261
            MS V++MLEG  D+ E             Y T L ++F   ++ +   + P  V  S+ P
Sbjct  926  MSTVVSMLEGKTDVEELVMVPSTLVDPSRYATSLQNKFAQSSVNESSSETPSLVKSSEGP  985

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  986  WTASSSSWA  994



>ref|XP_006377507.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
 gb|ERP55304.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
Length=387

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  211  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  269

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R     +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  270  HRTTNEFVCLLDWARVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  329

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  330  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KHLKGHYQQV  369



>ref|XP_006449566.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
 gb|ESR62806.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
Length=1024

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 117/160 (73%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++ KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GKN + 
Sbjct  787  FGLAKLDEEVKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMS  845

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D NC C LDW   L + G L+EL+DPRLGS F+K +A R+IK+ALLCTN SP+LRP+
Sbjct  846  YVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPT  905

Query  392  MSLVINMLEGHE---DIIEYDTDLHE-FNFQAMRDHYDQM  285
            MS V++MLEG     D+I     L E   F+ +RDH  +M
Sbjct  906  MSEVVSMLEGSSNIPDVIPEAGGLSEDLRFKTLRDHPREM  945



>gb|KJB57367.1| hypothetical protein B456_009G159600 [Gossypium raimondii]
Length=717

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 121/160 (76%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+ + THI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +
Sbjct  525  FGLAKFDEGENTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTK  583

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR + + +CL D  L LQ++GNL+EL+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+
Sbjct  584  YRPEGDYVCLQDRALVLQQKGNLMELVDPRLGTEFNEEEAIRMAKVALLCTNSSPALRPT  643

Query  392  MSLVINMLEGHEDIIEYDTD----LHEFNFQAMRDHYDQM  285
            MS V+NMLEG   + +   D      E  F A++D ++QM
Sbjct  644  MSEVVNMLEGRALVPKLIMDPSIFADESRFGALKDQFNQM  683



>ref|XP_011470945.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYM PEY LWG LT+K DVYSFGVV LEIV GKN ++
Sbjct  831  FGLAKLDEEENTHI-STRIAGTIGYMTPEYTLWGCLTYKADVYSFGVVALEIVTGKNNMK  889

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN  CL+DW L LQ++GNL+EL+DPRLGS+F+K++ALR IKVALLCTNP+ ALRP 
Sbjct  890  YRPNENIQCLMDWALVLQQKGNLLELVDPRLGSDFNKKEALRTIKVALLCTNPTAALRPI  949

Query  392  MSLVINMLEGHEDIIEYDTDLHEF-----NFQAMRDHYDQ  288
            MS V++MLEG   + +   D   +       +A+RD +D 
Sbjct  950  MSAVVSMLEGRTAVDDVVMDPSVYGDEMTKLRALRDQFDH  989



>ref|XP_006377483.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP55280.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=642

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 118/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  435  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  493

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK ALLCTN SP+LRP+
Sbjct  494  YRPENENVCLLDWAHALQKKGNLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPA  553

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  554  MSEVVSMLEGQTSIQEVTSDPSIYGDDLHS---KRLKGHYQQV  593



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 130/181 (72%), Gaps = 13/181 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVVTLEIVAGK N++
Sbjct  805  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVAGKSNMK  863

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CL+DW + LQ++G L+EL+DPRLGS+  +E+ +R+IKVALLC N +PALRP+
Sbjct  864  YRPNENFVCLVDWAIVLQQKGELLELVDPRLGSDVSEEEVIRMIKVALLCINAAPALRPT  923

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQAN----FSSD  237
            MS V++MLEG    HE + +  T   E    A+ + +D    + S +P Q       SSD
Sbjct  924  MSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDH---NSSQNPSQTQSLIPSSSD  980

Query  236  A  234
            A
Sbjct  981  A  981



>ref|XP_010655588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=1006

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++ + THI STR+AGT GYMAPEY LWGYLT K DVYSFGVVTLEIV+GKN   
Sbjct  822  FGLAKLNEGENTHI-STRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSN  880

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D  C CLLDW   L+++G+L+EL+DP LG+ F+K++A  +IKVALLCTN S  LRP+
Sbjct  881  YTPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPT  940

Query  392  MSLVINMLEGHEDIIEYDTDL----HEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ MLEG + I E  +D      +     +RDHY  M +  S      NFS D 
Sbjct  941  MSAVLRMLEGQDIIPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPNFSLDG  997



>ref|XP_010655589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=999

 Score =   181 bits (459),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK ++ + THI STR+AGT GYMAPEY LWGYLT K DVYSFGVVTLEIV+GKN   
Sbjct  822  FGLAKLNEGENTHI-STRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSN  880

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D  C CLLDW   L+++G+L+EL+DP LG+ F+K++A  +IKVALLCTN S  LRP+
Sbjct  881  YTPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPT  940

Query  392  MSLVINMLEGHEDIIEYDTDL----HEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V+ MLEG + I E  +D      +     +RDHY  M +  S      NFS D 
Sbjct  941  MSAVLRMLEGQDIIPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPNFSLDG  997



>ref|XP_006371025.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
 gb|ERP48822.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
Length=177

 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 115/166 (69%), Gaps = 17/166 (10%)
 Frame = -1

Query  680  GYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVEYRRDENCLCLLDWVLDLQKQGNL  504
            GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV++RRDEN +CLLD VL LQK G++
Sbjct  1    GYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDI  60

Query  503  IELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------  345
            +E++DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E       
Sbjct  61   MEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPST  120

Query  344  ------YDTDLHEFNFQAMRD---HYDQMPVHLSDSPYQANFSSDA  234
                  Y T LH+   Q+  +      Q  V  S+ P+ A+ SS A
Sbjct  121  LGDPSGYATALHKKFAQSSVNGSLRESQSLVKSSEGPWTASSSSSA  166



>ref|XP_008384519.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=913

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 124/174 (71%), Gaps = 9/174 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK +D++ THI STR+AGT GYMAPEY LWGYLT K DVYSFGVV LEIVAGK N++
Sbjct  709  FGLAKLNDEEXTHI-STRIAGTIGYMAPEYALWGYLTNKADVYSFGVVALEIVAGKSNMK  767

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  +EN +CL+DW L LQ++GNLIEL+DP LGS+F+ E+A+ ++KVALLC NP+ ALRP+
Sbjct  768  YIPNENLVCLVDWALVLQQKGNLIELVDPSLGSHFEVEEAITMVKVALLCINPASALRPT  827

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN  231
            MS V++MLEG        T +HE    A+R+ +D      +        SSDA 
Sbjct  828  MSAVVSMLEGR-------TLVHELKLSALRNPFDPTAQGSTSGTQNLVGSSDAT  874



>ref|XP_008384518.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=915

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 124/174 (71%), Gaps = 9/174 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK +D++ THI STR+AGT GYMAPEY LWGYLT K DVYSFGVV LEIVAGK N++
Sbjct  711  FGLAKLNDEEXTHI-STRIAGTIGYMAPEYALWGYLTNKADVYSFGVVALEIVAGKSNMK  769

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  +EN +CL+DW L LQ++GNLIEL+DP LGS+F+ E+A+ ++KVALLC NP+ ALRP+
Sbjct  770  YIPNENLVCLVDWALVLQQKGNLIELVDPSLGSHFEVEEAITMVKVALLCINPASALRPT  829

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN  231
            MS V++MLEG        T +HE    A+R+ +D      +        SSDA 
Sbjct  830  MSAVVSMLEGR-------TLVHELKLSALRNPFDPTAQGSTSGTQNLVGSSDAT  876



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  776  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  834

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLDWVL LQK G+++ ++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  835  FRRDENFVCLLDWVLYLQKNGDIMAMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  894

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQ---AMRDHYDQMPVHLSDSP  261
            MS V++MLEG  D+ +             Y T LH    Q   +      Q  V  S+ P
Sbjct  895  MSTVVSMLEGKTDVEDLVMVPSTLVDPSGYATALHNKFAQSSVSGSLSESQSLVKSSEGP  954

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  955  WTASSSSSA  963



>ref|XP_011046363.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Populus euphratica]
Length=833

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  637  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  695

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  696  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  755

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  756  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGP  815

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  816  WTASSSSSA  824



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score =   180 bits (457),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 122/167 (73%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYL+ K DVYSFGVV LE+++GKN V+
Sbjct  806  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALELISGKNNVK  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN +CLLDW L L + GNL+EL+D +LGS F+KE+ALR+IKVA+LC N SPALRP+
Sbjct  865  YRPNENFVCLLDWALVLHQDGNLMELVDRKLGSEFNKEEALRMIKVAVLCVNSSPALRPT  924

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDS  264
            MS V++MLEG   + E   +      E  F+A  +  D   V  + S
Sbjct  925  MSAVVSMLEGQTPVCEVKINPSIYGDELRFRAFTEDSDTASVQSTQS  971



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK D++D THI +TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIVAG  N+ 
Sbjct  638  FGMAKLDEEDNTHI-TTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVAGMNNMR  696

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R DE+ +CLLDW L+LQ+ G+++EL+DP LGS F+K++A+ +IKVALLCTN SPALRP 
Sbjct  697  FRHDEDFVCLLDWALNLQQNGDIMELVDPNLGSRFNKKEAVGMIKVALLCTNQSPALRPK  756

Query  392  MSLVINMLEGHEDIIEYDTDLHEF----NFQAMRDHYDQMP----------VHLSDSPYQ  255
            MS V+ MLEG  D+ E   D   F    +F+  +   DQ            V  SD P+ 
Sbjct  757  MSAVVKMLEGKGDVQELVMDPSTFGDPSSFKGYKHKSDQSSFGNISENQSLVRSSDGPWI  816

Query  254  ANFSSDA  234
             + S+ A
Sbjct  817  DSSSTSA  823



>ref|XP_006371027.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
 gb|ERP48824.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
Length=781

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 130/187 (70%), Gaps = 18/187 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  585  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGTNNVK  643

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  644  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  703

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRD---HYDQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q+  +      Q  V  S+ P
Sbjct  704  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTALHNKFAQSSVNGSLSETQSLVKSSEGP  763

Query  260  YQANFSS  240
            + A+ SS
Sbjct  764  WTASSSS  770



>ref|XP_006370931.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
 gb|ERP48728.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
Length=414

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 121/176 (69%), Gaps = 6/176 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK D++D THI STRVAGT GYMAPEY L+G LT+K DVYSFG+V LEIVAG  N+ 
Sbjct  222  FGMAKLDEEDDTHI-STRVAGTMGYMAPEYALYGRLTYKADVYSFGIVALEIVAGMSNMR  280

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R +E+  CLLDW L L + G+++EL+DPRLGS+F K++A R+IKVALLCTN SPA RP 
Sbjct  281  FRHNESFACLLDWALSLHQNGDVMELVDPRLGSDFKKKEAARMIKVALLCTNQSPAHRPI  340

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSSD  237
            MS V+ MLEG  D+ E   D   F     F++ + + DQ  V   D       +SD
Sbjct  341  MSAVVRMLEGKGDVQELVVDPSTFGDSLRFKSFQGNSDQSSVLSIDETQSLGRASD  396



>gb|AAL73330.1| putative receptor-like protein kinase RLPK1 [Glycine max]
Length=225

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 11/177 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  17   FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNAN  75

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGS +  E+A+R++++ALLCTNPSP LRPS
Sbjct  76   YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSKYSSEEAMRMLQLALLCTNPSPTLRPS  135

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG       II+    + +  F+A          H+S +     FS D+
Sbjct  136  MSSVVSMLEGKTPIQAPIIKRSDSVEDVRFKAFEMLSQDSQTHVSSA-----FSQDS  187



>ref|XP_011462236.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Fragaria vesca subsp. vesca]
Length=873

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 130/178 (73%), Gaps = 6/178 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWGYLTFK DV+SFGVVTLEIVAGKN ++
Sbjct  674  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGYLTFKADVFSFGVVTLEIVAGKNNMK  732

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R +EN + L+DW L LQ++ +L+EL+DP+LGS+F +E+A+R++KVALLC NP+ ALRP+
Sbjct  733  FRPNENFVGLVDWALVLQQKESLVELVDPKLGSDFSEEEAVRMVKVALLCINPTAALRPN  792

Query  392  MSLVINMLEGH----EDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN  231
            MS V++MLEG     E I++      E    A+R+ ++Q     +        SSDA+
Sbjct  793  MSAVVSMLEGRIPVDELIMDPSIYSEEMRLTALRNPFEQTVEESAGGTKSLIHSSDAS  850



>gb|KHF98741.1| hypothetical protein F383_14220 [Gossypium arboreum]
Length=167

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 105/142 (74%), Gaps = 5/142 (4%)
 Frame = -1

Query  674  MAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VEYRRDENCLCLLDWVLDLQKQGNLIE  498
            MAPEY LWGYLT+K DVYSFG+V LEIVAGKN  +YR +EN +CL DW   LQ++GNL+E
Sbjct  1    MAPEYALWGYLTYKADVYSFGIVALEIVAGKNNTKYRPEENYVCLQDWAFVLQQRGNLME  60

Query  497  LIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH----EDIIEYDTDL  330
            L+DPRLG+ F++E+A+R+ KVALLCTN SPALRP+MS V+NMLEG     E I++     
Sbjct  61   LVDPRLGTEFNEEEAIRMTKVALLCTNSSPALRPTMSEVVNMLEGRTLVPELILDPSIFA  120

Query  329  HEFNFQAMRDHYDQMPVHLSDS  264
             E  F A++D  ++M    S +
Sbjct  121  DESRFGAVKDQLNRMQSRSSKT  142



>ref|XP_006377493.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
 gb|ERP55290.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
Length=276

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 116/164 (71%), Gaps = 13/164 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY  WGYLT K DVYSFGVV LEIV+GK N  
Sbjct  70   FGLAKLNEEENTHI-STRVAGTIGYMAPEYAQWGYLTDKADVYSFGVVALEIVSGKSNSS  128

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  129  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  188

Query  392  MSLVINMLEGHEDIIEY--------DTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E         D DLH    + ++ HY Q+
Sbjct  189  MSEVVSMLEGQTCIPEVTSDPSIYDDDDLHS---KRVKGHYQQV  229



>ref|XP_006377525.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
 gb|ERP55322.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
Length=607

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 118/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  399  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  457

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  458  YRTTNEFVCLLDWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  517

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  518  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KHLKGHYQQV  557



>ref|XP_006358135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=779

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 12/151 (8%)
 Frame = -1

Query  716  THIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVEYRRDENCLCLL  540
            THI +TRVAGT GYMAPEY LWGYLT+K DVYSFGV+ LEI AGK N+ YR +E  +CLL
Sbjct  604  THI-TTRVAGTIGYMAPEYALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLL  662

Query  539  DWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH  360
            DW L LQ+QG L E++D  LGS+ ++++ALR++ VALLCT+PSPALRP+MS V+ +LE H
Sbjct  663  DWALVLQRQGKLKEVVDATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENH  722

Query  359  EDIIEY--------DTDLHEFNFQAMRDHYD  291
             D+ E+        D DL   NFQ +RD Y+
Sbjct  723  LDLPEFTMESRFYDDYDL--LNFQGLRDKYE  751



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  808  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  867  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  926

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  927  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGP  986

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  987  WTASSSSSA  995



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 12/151 (8%)
 Frame = -1

Query  716  THIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVEYRRDENCLCLL  540
            THI +TRVAGT GYMAPEY LWGYLT+K DVYSFGV+ LEI AGK N+ YR +E  +CLL
Sbjct  818  THI-TTRVAGTIGYMAPEYALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLL  876

Query  539  DWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGH  360
            DW L LQ+QG L E++D  LGS+ ++++ALR++ VALLCT+PSPALRP+MS V+ +LE H
Sbjct  877  DWALVLQRQGKLKEVVDATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENH  936

Query  359  EDIIEY--------DTDLHEFNFQAMRDHYD  291
             D+ E+        D DL  FNFQ +RD Y+
Sbjct  937  LDLPEFTMESRFYDDYDL--FNFQGLRDKYE  965



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  808  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  867  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  926

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  927  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGP  986

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  987  WTASSSSSA  995



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 135/197 (69%), Gaps = 9/197 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++KTHI ST+VAGT GYMAPEY LWG+LTFK DVYSFGVV LEIV+G+ N  
Sbjct  758  FGLAKLDEEEKTHI-STQVAGTIGYMAPEYALWGHLTFKADVYSFGVVALEIVSGRTNST  816

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR   +C CLLDW   LQK+ +L+EL+DPRLGS+F++++  R+IKVALLC   SP LRPS
Sbjct  817  YRPKSDCTCLLDWAFLLQKRESLLELVDPRLGSDFNRQEVERMIKVALLCITASPTLRPS  876

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q  225
            MS V++MLEG     ++I +      +  F  +R+++ QM +  S      N SS+    
Sbjct  877  MSQVVSMLEGSMAIQDEISDPSISGEDSRFSGIREYFQQMILQDSSGAQTQNLSSEGT--  934

Query  224  *KIASFTNIVQEIRLVS  174
              I+S +  VQ++ L++
Sbjct  935  -WISSSSLSVQDVYLIN  950



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  806  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  865  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  924

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  925  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGP  984

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  985  WTASSSSSA  993



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  806  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  865  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  924

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  925  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGP  984

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  985  WTASSSSSA  993



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  808  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  867  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  926

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  927  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFSTSLHNKFAQPSVNGSLTETQSLVKSSEGP  986

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  987  WTASSSSSA  995



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 135/197 (69%), Gaps = 9/197 (5%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
              GLAK D+++KTHI ST+VAGT GYMAPEY LWG+LTFK DVYSFGVV LEIV+G+ N  
Sbjct  812   FGLAKLDEEEKTHI-STQVAGTIGYMAPEYALWGHLTFKADVYSFGVVALEIVSGRTNST  870

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             YR   +C CLLDW   LQK+ +L+EL+DPRLGS+F++++  R+IKVALLC   SP LRPS
Sbjct  871   YRPKSDCTCLLDWAFLLQKRESLLELVDPRLGSDFNRQEVERMIKVALLCITASPTLRPS  930

Query  392   MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q  225
             MS V++MLEG     ++I +      +  F  +R+++ QM +  S      N SS+    
Sbjct  931   MSQVVSMLEGSMAIQDEISDPSISGEDSRFSGIREYFQQMILQDSSGAQTQNLSSEGT--  988

Query  224   *KIASFTNIVQEIRLVS  174
               I+S +  VQ++ L++
Sbjct  989   -WISSSSLSVQDVYLIN  1004



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK D++D THI +TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIVAG  N+ 
Sbjct  815  FGMAKLDEEDNTHI-TTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVAGMNNMR  873

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R DE+ +CLLDW L+LQ+ G+++EL+DP LGS F+K++A+ +IKVALLCTN SPALRP 
Sbjct  874  FRHDEDFVCLLDWALNLQQNGDIMELVDPNLGSRFNKKEAVGMIKVALLCTNQSPALRPK  933

Query  392  MSLVINMLEGHEDIIEYDTDLHEF----NFQAMRDHYDQMP----------VHLSDSPYQ  255
            MS V+ MLEG  D+ E   D   F    +F+  +   DQ            V  SD P+ 
Sbjct  934  MSAVVKMLEGKGDVQELVMDPSTFGDPSSFKGYKHKSDQSSFGNISENQSLVRSSDGPWI  993

Query  254  ANFSSDA  234
             + S+ A
Sbjct  994  DSSSTSA  1000



>ref|XP_006377456.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
 gb|ERP55253.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
Length=555

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 118/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  348  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  406

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R     +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  407  HRTTNEFVCLLDWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  466

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  467  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KRLKGHYQQV  506



>ref|XP_011461995.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Fragaria vesca subsp. vesca]
Length=1021

 Score =   178 bits (451),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 124/160 (78%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STR+AGT GYMAPEY LWG LT+K DVYSFGVV LEIVAGKN ++
Sbjct  820  FGLAKLDEEENTHI-STRIAGTIGYMAPEYALWGCLTYKADVYSFGVVALEIVAGKNNMK  878

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R +++ +CL+DW L LQ++GNL EL+D RLGS+++KEQA+R+ KVALLCTN +P+LRP+
Sbjct  879  FRPNDDFVCLVDWALVLQQKGNLKELVDQRLGSDYNKEQAIRMAKVALLCTNSAPSLRPT  938

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS+V++MLEG   + E   D      +    A+R+ +DQ+
Sbjct  939  MSVVVSMLEGKTAVPELIMDPSIYGDKMRMTALRNQFDQI  978



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  784  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  842

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  843  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  902

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  903  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFYTSLHNKFAQPSVNGSLTETQSLVKSSEGP  962

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  963  WTASSSSSA  971



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score =   177 bits (450),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  806  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  865  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  924

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  925  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFYTSLHNKFAQPSVNGSLTETQSLVKSSEGP  984

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  985  WTASSSSSA  993



>ref|XP_010665668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=862

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLA+ D+  +THI STRVAGT GYMAPEY LWGYLT+K DVYSFGV  LEIVAG+ N  
Sbjct  670  FGLARLDEGGRTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAGRSNTN  728

Query  572  YRRDENCLCLLDWVLDLQKQ-GNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRP  396
            ++ D+N  CLLDW   LQ+Q GN++EL+DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP
Sbjct  729  FKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPSPAVRP  788

Query  395  SMSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQA  252
             MS V++MLEG     E  +      +++ +QA R ++D MP   SDS  Q+
Sbjct  789  VMSEVLSMLEGSMVVQELTLAPGIHSNDWIYQASRRYHD-MP---SDSETQS  836



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score =   177 bits (450),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  808  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  867  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  926

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  927  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFYTSLHNKFAQPSVNGSLTETQSLVKSSEGP  986

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  987  WTASSSSSA  995



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   177 bits (450),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 130/189 (69%), Gaps = 18/189 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             G+AK DD+D THI  TRVAGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+G  NV+
Sbjct  808  FGMAKLDDEDNTHI-DTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVK  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +RRDEN +CLLD VL LQK G+++E++DPRLGS F+K++ +R+I VALLCTN SPALRP+
Sbjct  867  FRRDENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPT  926

Query  392  MSLVINMLEGHEDIIE-------------YDTDLHEFNFQAMRDHY---DQMPVHLSDSP  261
            MS V++MLEG  D+ E             + T LH    Q   +      Q  V  S+ P
Sbjct  927  MSTVVSMLEGKTDVEELVMVPSTLGDPSGFYTSLHNKFAQPSVNGSLTETQSLVKSSEGP  986

Query  260  YQANFSSDA  234
            + A+ SS A
Sbjct  987  WTASSSSSA  995



>ref|XP_002317383.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
 gb|EEE97995.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
Length=591

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 117/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  384  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  442

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP+LRP+
Sbjct  443  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPA  502

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  503  MSEVVSMLEGQTSIPEVTSDPSIYGDDLHS---KRVKGHYQQV  542



>ref|XP_010112410.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC33468.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=851

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 11/182 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  620  FGLAKLHEEENTHI-STRVAGTIGYMAPEYALWGYLTEKADVYSFGVVALEIVSGKCNTS  678

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR   NC+CLLD+   LQK+G+L++++D +LGS F++E+A R+IK+ALLCTN SPALRP+
Sbjct  679  YRPQNNCVCLLDYAFVLQKKGDLLQIMDEKLGSEFNEEEAKRIIKIALLCTNASPALRPT  738

Query  392  MSLVINMLEGHEDIIEYDTDL--------HEFNFQAMRDHYDQMPVHLSDSPYQA-NFSS  240
            MS V++MLEG+  + E  +D         ++  F+ ++ ++ Q+    +++  Q  N +S
Sbjct  739  MSEVVSMLEGNTVVKELISDPGIYGDEYGNDLRFKPLKAYHQQVQKKNNEAEKQGKNSNS  798

Query  239  DA  234
            DA
Sbjct  799  DA  800



>ref|XP_010665669.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Beta vulgaris subsp. vulgaris]
Length=858

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLA+ D+  +THI STRVAGT GYMAPEY LWGYLT+K DVYSFGV  LEIVAG+ N  
Sbjct  666  FGLARLDEGGRTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAGRSNTN  724

Query  572  YRRDENCLCLLDWVLDLQKQ-GNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRP  396
            ++ D+N  CLLDW   LQ+Q GN++EL+DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP
Sbjct  725  FKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPSPAVRP  784

Query  395  SMSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQA  252
             MS V++MLEG     E  +      +++ +QA R ++D MP   SDS  Q+
Sbjct  785  VMSEVLSMLEGSMVVQELTLAPGIHSNDWIYQASRRYHD-MP---SDSETQS  832



>ref|XP_006377501.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
 gb|ERP55298.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
Length=573

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 116/163 (71%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  366  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  424

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP+LRP+
Sbjct  425  YRPQNENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPA  484

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  485  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KHLKGHYQQV  524



>ref|XP_010665665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLA+ D+  +THI STRVAGT GYMAPEY LWGYLT+K DVYSFGV  LEIVAG+ N  
Sbjct  808  FGLARLDEGGRTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAGRSNTN  866

Query  572  YRRDENCLCLLDWVLDLQKQ-GNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRP  396
            ++ D+N  CLLDW   LQ+Q GN++EL+DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP
Sbjct  867  FKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPSPAVRP  926

Query  395  SMSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQA  252
             MS V++MLEG     E  +      +++ +QA R ++D MP   SDS  Q+
Sbjct  927  VMSEVLSMLEGSMVVQELTLAPGIHSNDWIYQASRRYHD-MP---SDSETQS  974



>ref|XP_010665667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLA+ D+  +THI STRVAGT GYMAPEY LWGYLT+K DVYSFGV  LEIVAG+ N  
Sbjct  784  FGLARLDEGGRTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAGRSNTN  842

Query  572  YRRDENCLCLLDWVLDLQKQ-GNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRP  396
            ++ D+N  CLLDW   LQ+Q GN++EL+DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP
Sbjct  843  FKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPSPAVRP  902

Query  395  SMSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQA  252
             MS V++MLEG     E  +      +++ +QA R ++D MP   SDS  Q+
Sbjct  903  VMSEVLSMLEGSMVVQELTLAPGIHSNDWIYQASRRYHD-MP---SDSETQS  950



>ref|XP_010665666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=999

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLA+ D+  +THI STRVAGT GYMAPEY LWGYLT+K DVYSFGV  LEIVAG+ N  
Sbjct  807  FGLARLDEGGRTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAGRSNTN  865

Query  572  YRRDENCLCLLDWVLDLQKQ-GNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRP  396
            ++ D+N  CLLDW   LQ+Q GN++EL+DP+LG+++ KE+ LR+IK+ALLCTNPSPA+RP
Sbjct  866  FKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPSPAVRP  925

Query  395  SMSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQA  252
             MS V++MLEG     E  +      +++ +QA R ++D MP   SDS  Q+
Sbjct  926  VMSEVLSMLEGSMVVQELTLAPGIHSNDWIYQASRRYHD-MP---SDSETQS  973



>gb|KCW67550.1| hypothetical protein EUGRSUZ_F013052, partial [Eucalyptus grandis]
Length=337

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVVTLEIV+GK N  
Sbjct  129  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTN  187

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGN +EL+DPRLGSN+ +E+A+R++ +ALLCTNPSP LRP+
Sbjct  188  YRPKEEFVYLLDWAYVLQEQGNFLELVDPRLGSNYSEEEAMRMLNLALLCTNPSPTLRPA  247

Query  392  MSLVINMLEGHEDI  351
            MS V++MLEG   I
Sbjct  248  MSSVVSMLEGKGAI  261



>ref|XP_006370934.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
 gb|ERP48731.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
Length=173

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 113/164 (69%), Gaps = 17/164 (10%)
 Frame = -1

Query  674  MAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVEYRRDENCLCLLDWVLDLQKQGNLIE  498
            MAPEY L+GYLT+K DVYSFGVV LEIV+G  NV++RRDEN +CLLDWVL L+  G+++E
Sbjct  1    MAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDWVLYLKTNGDIME  60

Query  497  LIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHEDIIE---------  345
            ++DPRLGS F+K++ +R+I VALLCTN SPALRP+MS V++MLEG  D+ E         
Sbjct  61   MVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEELVMVPSTLG  120

Query  344  ----YDTDLH-EFNFQAMRDHYDQMP--VHLSDSPYQANFSSDA  234
                Y   LH +F   ++     + P  V  S+ P+ A+ SS A
Sbjct  121  DPSGYAMALHNKFAQSSVNGSLRETPSLVKSSEGPWTASSSSSA  164



>emb|CAE54078.1| receptor-like protein kinase [Fagus sylvatica]
Length=217

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++++THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LEIV+GK N  
Sbjct  20   FGLAKLDEEEQTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTN  78

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DPRLGS++  E+A+R++ +ALLCTNPSP LRP 
Sbjct  79   YRPKEEFVYLLDWAYVLQEQGNLLELVDPRLGSSYSSEEAMRMLNLALLCTNPSPTLRPQ  138

Query  392  MSLVINMLEG  363
            MS V++M+EG
Sbjct  139  MSSVVSMIEG  148



>emb|CBI30750.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLA+ + ++ THI STRVAGT GYMAPEY LWGYLT K D+YSFGVV LEIV+GKN   
Sbjct  346  FGLARLNGEESTHI-STRVAGTIGYMAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTS  404

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +  C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVALLCTN SP LRP+
Sbjct  405  YKPENECVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPT  464

Query  392  MSLVINMLEGH---EDIIE----YDTDLHEFNFQAMRD  300
            MS V++MLEG    +D+I     Y+ DL    F+ +RD
Sbjct  465  MSAVVSMLEGQTVVQDVISDPGIYNDDLR---FRPLRD  499



>emb|CBI30739.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 6/157 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GK N+ 
Sbjct  529  FGLAKLHEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNMS  587

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+   +C CLLDW   LQ+ G+++EL+D +LGS F+K++A R+IKVALLCTN SP+LRP+
Sbjct  588  YQPKNDCACLLDWACSLQQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPN  647

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHY  294
            MS  ++MLEG     + I E  +   +  F+A+R+++
Sbjct  648  MSEAVSMLEGITTIPDAIPEAGSYSEDLRFKAIREYH  684



>ref|XP_006377518.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
 gb|ERP55315.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
Length=662

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 116/162 (72%), Gaps = 12/162 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  505  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  563

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   +QK+GNL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  564  YRTTNEFVCLLDWAHVVQKKGNLMEMVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  623

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQ  288
            MS V++MLEG   I E       Y  DLH    + +  HY Q
Sbjct  624  MSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KHLIGHYQQ  662



>emb|CAN73789.1| hypothetical protein VITISV_025000 [Vitis vinifera]
Length=667

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 117/157 (75%), Gaps = 6/157 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GK N  
Sbjct  419  FGLAKLHEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNXS  477

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y    +C CLLDW   LQ+ G+++EL+D +LGS F+K++A R+IKVALLCTN SP+LRP+
Sbjct  478  YXPKNDCACLLDWACXLQQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPN  537

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHY  294
            MS  ++MLEG     + I E  +   +  F+A+R+++
Sbjct  538  MSEAVSMLEGITTIPDAIPEAGSYSEDLRFKAIREYH  574



>ref|XP_006377527.1| hypothetical protein POPTR_0011s067102g, partial [Populus trichocarpa]
 gb|ERP55324.1| hypothetical protein POPTR_0011s067102g, partial [Populus trichocarpa]
Length=225

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 111/156 (71%), Gaps = 7/156 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLA+ D+++K+HI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEI++GKN   
Sbjct  28   FGLARLDEEEKSHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIISGKNNNN  86

Query  569  RRDEN--CLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRP  396
                N  C+CLLDW   LQ+ G+ IEL+D  LGS  + E+A  ++KVALLCTN SP LRP
Sbjct  87   YMPSNSSCVCLLDWACHLQQSGSFIELVDETLGSEVNIEEAETMVKVALLCTNASPTLRP  146

Query  395  SMSLVINMLEGHEDIIEYDTDLHEFN----FQAMRD  300
            +MS V++MLEG   + +   +L  +N    F+AMRD
Sbjct  147  TMSEVVSMLEGRMAVPDTRPELSSYNEDLRFKAMRD  182



>ref|XP_006377461.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
 gb|ERP55258.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
Length=313

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 117/166 (70%), Gaps = 15/166 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  102  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  160

Query  572  YRRDENCLCLLDWVLDLQKQGNL---IELIDPRLGSNFDKEQALRVIKVALLCTNPSPAL  402
            YR     +CLLDW   +QK+GNL   +E++DP+L S F+KE+A R+IK+ALLCTN SP+L
Sbjct  161  YRTTNEFVCLLDWAHVVQKKGNLMESMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSL  220

Query  401  RPSMSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            RP+MS V++MLEG   I E       Y  DLH    + ++ H  Q+
Sbjct  221  RPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS---KLLKGHCQQV  263



>gb|KCW67576.1| hypothetical protein EUGRSUZ_F013322, partial [Eucalyptus grandis]
Length=379

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI ST++AGT GYMAPEY + GYLT K D+YSFGVV LE+V+G+ N+ 
Sbjct  168  FGLAKLDEEDNTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVSGQCNIS  226

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y++ + C  LLDW  +L+++GNLI+L+D RLGS+FDKEQ L +IKVALLCTN +P LRP 
Sbjct  227  YQKKDECFHLLDWARELKERGNLIDLVDARLGSHFDKEQVLAMIKVALLCTNATPTLRPV  286

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D++     E   +AMR H+
Sbjct  287  MSSVVSMLEGKVAVPVLDSEGAIKAEEKIEAMRKHF  322



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
              G+AK D++D THI STRVAGT GYMAPEY L+G LT K DVYSFG+V LEIVAG  N+ 
Sbjct  830   FGMAKLDEEDNTHI-STRVAGTMGYMAPEYALYGRLTSKADVYSFGIVALEIVAGMSNMS  888

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ +E+ +CLLDW L LQ+ G+++EL+DPRLGS+F K++A R+IKV LLCTN SPALRP+
Sbjct  889   FQHNESFVCLLDWALSLQQNGDIMELVDPRLGSDFKKKEAARMIKVTLLCTNQSPALRPT  948

Query  392   MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSSD  237
             MS V+ MLEG  D+ E   D   F     F++ + + DQ  V   D       SSD
Sbjct  949   MSAVVRMLEGKGDVQELVVDPSTFGDSLRFKSFQGNSDQSSVLSIDETQSLVRSSD  1004



>ref|XP_010655556.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Vitis vinifera]
Length=1067

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 6/157 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GK N+ 
Sbjct  819  FGLAKLHEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNMS  877

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+   +C CLLDW   LQ+ G+++EL+D +LGS F+K++A R+IKVALLCTN SP+LRP+
Sbjct  878  YQPKNDCACLLDWACSLQQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPN  937

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHY  294
            MS  ++MLEG     + I E  +   +  F+A+R+++
Sbjct  938  MSEAVSMLEGITTIPDAIPEAGSYSEDLRFKAIREYH  974



>ref|XP_010655557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Vitis vinifera]
Length=1060

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 6/157 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GK N+ 
Sbjct  812  FGLAKLHEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNMS  870

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+   +C CLLDW   LQ+ G+++EL+D +LGS F+K++A R+IKVALLCTN SP+LRP+
Sbjct  871  YQPKNDCACLLDWACSLQQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPN  930

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHY  294
            MS  ++MLEG     + I E  +   +  F+A+R+++
Sbjct  931  MSEAVSMLEGITTIPDAIPEAGSYSEDLRFKAIREYH  967



>ref|XP_006377463.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
 gb|ERP55260.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
Length=363

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 115/163 (71%), Gaps = 13/163 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGV  LEIV+G+ N  
Sbjct  156  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVA-LEIVSGRSNSS  213

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW    QK+GNL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  214  YRTTNEFVCLLDWAHVPQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  273

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V +MLEG   I E       Y  DLH    + ++ HY Q+
Sbjct  274  MSEVASMLEGQTSIQEMISDPSIYGDDLHS---KLLKGHYQQV  313



>ref|XP_006449568.1| hypothetical protein CICLE_v10015563mg [Citrus clementina]
 gb|ESR62808.1| hypothetical protein CICLE_v10015563mg [Citrus clementina]
Length=386

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 15/157 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEIV+GK N+ 
Sbjct  168  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKYNMS  226

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  D NC CLLDW            L+DPRLGS F+K +A ++IKVALLCTN SP+LRP+
Sbjct  227  YVPDSNCSCLLDW------------LVDPRLGSEFNKVEAEKMIKVALLCTNVSPSLRPT  274

Query  392  MSLVINMLEGHEDIIEYDTDLHEF-NFQAMRDHYDQM  285
            MS V++MLEG  +I +   +   +  F+AMRD +  M
Sbjct  275  MSEVVSMLEGSSNIPDVIPEAEAYLKFKAMRDSHIHM  311



>gb|KCW67582.1| hypothetical protein EUGRSUZ_F01341 [Eucalyptus grandis]
Length=301

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 126/186 (68%), Gaps = 15/186 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI ST++AGT GYMAPEY + GYLT K DVYSFGVV LE+V+G+ N  
Sbjct  99   FGLAKLDEEDNTHI-STKIAGTYGYMAPEYAMHGYLTEKADVYSFGVVALEVVSGRSNTS  157

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y++ E C  LLDW   L+++GNL++L+D RLGS+FD+++ L +IKVALLCTN +PALRP 
Sbjct  158  YQKKEKCFYLLDWARVLKERGNLMDLVDQRLGSHFDEKEVLAMIKVALLCTNVTPALRPP  217

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY----DQ------MPVHLSDSPYQA  252
            MS V++MLEG   +   D++   + E   +AMR H+    DQ          L+D P+  
Sbjct  218  MSSVVSMLEGKAAVPVLDSEGAIITEETIEAMRKHFKGDEDQAVDENITKSTLTDGPWTG  277

Query  251  NFSSDA  234
              SS +
Sbjct  278  TASSTS  283



>ref|XP_011461991.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840, partial 
[Fragaria vesca subsp. vesca]
Length=984

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 123/182 (68%), Gaps = 19/182 (10%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLA+ D+++KTHI ST+VAGT GYMAPEY LWG LT+K DVYSFGVV LE V+GKN ++
Sbjct  786  FGLARLDEEEKTHI-STKVAGTIGYMAPEYALWGCLTYKADVYSFGVVALETVSGKNNMK  844

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  EN  CL+DW   L K+GNL+EL+DPRLGS+F+K++ALR IKVALLC NP+ ALRP 
Sbjct  845  YRPHENIQCLMDWAHVLHKKGNLLELVDPRLGSDFNKKEALRTIKVALLCANPTAALRPI  904

Query  392  MSLVINMLEGHEDIIEYDTD----------------LHEFNFQAMRDHYDQMP-VHLSDS  264
            MS V++MLEG   + E   D                L E N Q +    +    VH S++
Sbjct  905  MSAVVSMLEGRTPVDEVALDPSIHGDEMTRLRAFENLSEQNAQGISSTSESHSLVHSSNA  964

Query  263  PY  258
            P+
Sbjct  965  PW  966



>ref|XP_002305710.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
 gb|EEE86221.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
Length=468

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 119/177 (67%), Gaps = 8/177 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  + + THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  271  FGLAKLSEAENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  329

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y      +CLLDW   LQK+GNL+ L+DP+L S F+KE+A +++KVALLC N SP+LRPS
Sbjct  330  YNPTNESVCLLDWAFVLQKRGNLMALVDPKLRSEFNKEEAEKMMKVALLCANASPSLRPS  389

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMR-DHYDQMPVHLSDSPYQANFSSD  237
            M  V++MLEG   I E  +D   +     F+ ++ DH+ Q+    S S     FSSD
Sbjct  390  MPAVVSMLEGQTSIQEVISDPSIYGDGSQFKHLKYDHFQQVSDQ-SCSTQDHVFSSD  445



>ref|XP_011002042.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=1002

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  794  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  852

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  853  YRTTNEFVCLLDWAHGLQKKRNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  912

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + +  HY Q+
Sbjct  913  MSEVVSMLEGQTTIQEMISDPSIYGDDLHS---KRLEGHYQQV  952



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 119/157 (76%), Gaps = 4/157 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+G+ N  
Sbjct  781  FGLAKLDEEDNTHI-STRIAGTFGYMAPEYAMKGYLTDKADVYSFGVVALEIVSGRSNTS  839

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R  E C+ LLDW L L+++GNL++L+DPRLGS+FDK + +R+I VALLCTN SPALRP+
Sbjct  840  FRLKEECVDLLDWALILKERGNLMDLVDPRLGSDFDKGEVMRMINVALLCTNSSPALRPA  899

Query  392  MSLVINMLEGHEDIIEY--DTDLHEFNFQAMRDHYDQ  288
            MS V++MLEG   I E+       E  ++A+++H+ Q
Sbjct  900  MSAVVSMLEGGAIIQEFVSQPSYDESRYKAIQNHFQQ  936



>ref|XP_011002041.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=1009

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  818  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  876

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  877  YRTTNEFVCLLDWAHGLQKKRNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  936

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + +  HY Q+
Sbjct  937  MSEVVSMLEGQTTIQEMISDPSIYGDDLHS---KRLEGHYQQV  976



>ref|XP_010655585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=861

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLA+ + ++ THI STRVAGT GYMAPEY LWGYLT K D+YSFGVV LEIV+GKN   
Sbjct  685  FGLARLNGEESTHI-STRVAGTIGYMAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTS  743

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +  C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVALLCTN SP LRP+
Sbjct  744  YKPENECVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPT  803

Query  392  MSLVINMLEGH---EDIIE----YDTDLHEFNFQAMRD  300
            MS V++MLEG    +D+I     Y+ DL    F+ +RD
Sbjct  804  MSAVVSMLEGQTVVQDVISDPGIYNDDLR---FRPLRD  838



>ref|XP_011002039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1026

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  818  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  876

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  877  YRTTNEFVCLLDWAHGLQKKRNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  936

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + +  HY Q+
Sbjct  937  MSEVVSMLEGQTTIQEMISDPSIYGDDLHS---KRLEGHYQQV  976



>ref|XP_011002040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=1024

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 12/163 (7%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+G+ N  
Sbjct  816  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSS  874

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR     +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK+ALLCTN SP+LRP+
Sbjct  875  YRTTNEFVCLLDWAHGLQKKRNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPA  934

Query  392  MSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHYDQM  285
            MS V++MLEG   I E       Y  DLH    + +  HY Q+
Sbjct  935  MSEVVSMLEGQTTIQEMISDPSIYGDDLHS---KRLEGHYQQV  974



>ref|XP_011002049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X6 [Populus euphratica]
Length=959

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  771  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  829

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  830  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  889

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  890  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  929



>ref|XP_011009666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=515

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 120/177 (68%), Gaps = 8/177 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  + + THI STRVAGT GYMAPEY LWGYL+ K DVYSFGVV LEIV+G+ N  
Sbjct  307  FGLAKLSEAENTHI-STRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSS  365

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y      +CLLDW   LQK+GNL+ L+DP+L S F+KE+A ++IKVALLCTN SP+LRP+
Sbjct  366  YNPTNESVCLLDWAFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCTNASPSLRPT  425

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMR-DHYDQMPVHLSDSPYQANFSSD  237
            M  V++MLEG   I E  +D   +     F+ ++ DH+ Q+    S S     FSSD
Sbjct  426  MPAVVSMLEGQTSIQEVISDPTIYGGGSQFKHVKYDHFQQV-ADQSCSTQDHVFSSD  481



>gb|KHN38783.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=296

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N +
Sbjct  94   FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTK  152

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGS +  E+A+R++ +ALLCTNPSP LRP+
Sbjct  153  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSKYSPEEAMRMLSLALLCTNPSPTLRPT  212

Query  392  MSLVINMLEG  363
            MS V++MLEG
Sbjct  213  MSSVVSMLEG  222



>ref|XP_011002047.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=983

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  795  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  853

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  854  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  913

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  914  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  953



>ref|XP_011002048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X5 [Populus euphratica]
Length=963

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  775  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  833

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  834  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  893

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  894  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  933



>ref|XP_011009667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=515

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 120/177 (68%), Gaps = 8/177 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  + + THI STRVAGT GYMAPEY LWGYL+ K DVYSFGVV LEIV+G+ N  
Sbjct  307  FGLAKLSEAENTHI-STRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSS  365

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y      +CLLDW   LQK+GNL+ L+DP+L S F+KE+A ++IKVALLCTN SP+LRP+
Sbjct  366  YNPTNESVCLLDWAFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCTNASPSLRPT  425

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMR-DHYDQMPVHLSDSPYQANFSSD  237
            M  V++MLEG   I E  +D   +     F+ ++ DH+ Q+    S S     FSSD
Sbjct  426  MPAVVSMLEGQTSIQEVISDPTIYGGGSQFKHVKYDHFQQV-ADQSCSTQDHVFSSD  481



>ref|XP_011002045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=985

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  797  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  855

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  856  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  915

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  916  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  955



>ref|XP_011002044.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1007

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  819  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  877

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  878  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  937

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  938  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  977



>ref|XP_011470950.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Fragaria vesca subsp. vesca]
Length=927

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWG LT+K DVYSFGVV LE V+G N ++
Sbjct  738  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGCLTYKADVYSFGVVALETVSGNNNMK  796

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN  CL+DW   L ++GNL+EL+DPRLGS+F+K++ALR IKVALLC NP+ ALRP 
Sbjct  797  YRPNENIQCLMDWAHVLHQKGNLLELVDPRLGSDFNKKEALRTIKVALLCANPTAALRPI  856

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMR  303
            MS V++MLEG   + E   D      + MR
Sbjct  857  MSAVVSMLEGRTPVDEMALDPSIHGDEMMR  886



>gb|KJB57371.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=477

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  284  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  342

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  343  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  402

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQMPVH-LSDSPYQANFSSDA  234
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M     + +P  + F S +
Sbjct  403  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYMSSQGHTSTPAGSLFESSS  460



>ref|XP_011002046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=983

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  795  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  853

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  854  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  913

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  914  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  953



>ref|XP_011002050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X7 [Populus euphratica]
Length=1002

 Score =   172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGTRGY+APEY LWG+LT K DVYSFGVV LEIV+GK N  
Sbjct  814  FGLAKLNEEENTHI-STRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSI  872

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  873  YRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPA  932

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQM  285
            MS V++MLEG   I E  +D      E + + ++ HY Q+
Sbjct  933  MSEVVSMLEGQTSIPEVTSDPSIYGDELHSKRVKGHYQQV  972



>ref|XP_006384080.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61877.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=462

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 118/177 (67%), Gaps = 8/177 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++ + THI STRVAGT GYMAPEY LWGYL+ K DVYSFGVV LEIV+G+ N  
Sbjct  269  FGLAKLNEAENTHI-STRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSS  327

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y      +CLLDW   LQK+GNL+ L+DP+L S F+KE+A ++IKVALLC N SP+LRPS
Sbjct  328  YNPTNESVCLLDWAFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCANASPSLRPS  387

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNF-----QAMRDHYDQMPVHLSDSPYQANFSSD  237
            M  V++MLEG   I E  +D   +       Q   DH+ Q+ +  S S     FSSD
Sbjct  388  MPAVVSMLEGQTSIQEVISDPTIYGGGSQFKQVNYDHFQQV-LDQSCSTQDHVFSSD  443



>ref|XP_011470949.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Fragaria vesca subsp. vesca]
Length=1029

 Score =   172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D+++ THI STRVAGT GYMAPEY LWG LT+K DVYSFGVV LE V+G N ++
Sbjct  840  FGLAKLDEEENTHI-STRVAGTIGYMAPEYALWGCLTYKADVYSFGVVALETVSGNNNMK  898

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +EN  CL+DW   L ++GNL+EL+DPRLGS+F+K++ALR IKVALLC NP+ ALRP 
Sbjct  899  YRPNENIQCLMDWAHVLHQKGNLLELVDPRLGSDFNKKEALRTIKVALLCANPTAALRPI  958

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMR  303
            MS V++MLEG   + E   D      + MR
Sbjct  959  MSAVVSMLEGRTPVDEMALDPSIHGDEMMR  988



>ref|XP_006384081.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61878.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=464

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 118/177 (67%), Gaps = 8/177 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++ + THI STRVAGT GYMAPEY LWGYL+ K DVYSFGVV LEIV+G+ N  
Sbjct  271  FGLAKLNEAENTHI-STRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSS  329

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y      +CLLDW   LQK+GNL+ L+DP+L S F+KE+A ++IKVALLC N SP+LRPS
Sbjct  330  YNPTNESVCLLDWAFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCANASPSLRPS  389

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNF-----QAMRDHYDQMPVHLSDSPYQANFSSD  237
            M  V++MLEG   I E  +D   +       Q   DH+ Q+ +  S S     FSSD
Sbjct  390  MPAVVSMLEGQTSIQEVISDPTIYGGGSQFKQVNYDHFQQV-LDQSCSTQDHVFSSD  445



>ref|NP_001235287.1| receptor-like protein kinase [Glycine max]
 gb|ACM89557.1| receptor-like protein kinase [Glycine max]
Length=272

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 119/170 (70%), Gaps = 6/170 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI STRVAGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  70   FGLAKLDEEDNTHI-STRVAGTYGYMAPEYAMHGYLTDKADVYSFGVVALEIVSGKSNTI  128

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R  +  L LLDW   L+++GNL+EL+D RLGS+F++ + + +IKVALLCTN +  LRP+
Sbjct  129  HRSKQEALHLLDWAHLLKEKGNLMELVDRRLGSDFNENEVMMMIKVALLCTNTTSNLRPT  188

Query  392  MSLVINMLEGHEDIIEYDTD----LHEFNFQAMRDHYDQMPVHLSDSPYQ  255
            MS V++MLEG   I E+ +D    + E   +AMR HY Q     S++  Q
Sbjct  189  MSSVLSMLEGKTMIPEFVSDPSEIMDEMKLEAMRQHYFQKENERSETQEQ  238



>ref|XP_008443633.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X4 [Cucumis melo]
Length=931

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK DD++KTHI +TRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI++G+ N +
Sbjct  732  FGLAKLDDEEKTHI-TTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIISGRSNND  790

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   E C+CLLDW   LQ+ GNL+EL+D +L S  D ++A  V+K+ALLCTN SP++RP+
Sbjct  791  YVPSETCVCLLDWACHLQQSGNLMELVDEKLRSEIDTKEAENVVKIALLCTNASPSIRPA  850

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V+NMLEG   I +   +   +N    F+AMRD   Q     S S  Q   S+
Sbjct  851  MSEVVNMLEGRMKIPDLIPEPSSYNEDLRFKAMRDMRRQQQHSQSLSESQTQNST  905



>ref|XP_010655584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=975

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLA+ + ++ THI STRVAGT GYMAPEY LWGYLT K D+YSFGVV LEIV+GKN   
Sbjct  799  FGLARLNGEESTHI-STRVAGTIGYMAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTS  857

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +  C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVALLCTN SP LRP+
Sbjct  858  YKPENECVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPT  917

Query  392  MSLVINMLEGH---EDIIE----YDTDLHEFNFQAMRD  300
            MS V++MLEG    +D+I     Y+ DL    F+ +RD
Sbjct  918  MSAVVSMLEGQTVVQDVISDPGIYNDDLR---FRPLRD  952



>ref|XP_010655583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=988

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLA+ + ++ THI STRVAGT GYMAPEY LWGYLT K D+YSFGVV LEIV+GKN   
Sbjct  812  FGLARLNGEESTHI-STRVAGTIGYMAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTS  870

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y+ +  C+CLLD    LQ++G+L+E++DP+LGS F++++A R+IKVALLCTN SP LRP+
Sbjct  871  YKPENECVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPT  930

Query  392  MSLVINMLEGH---EDIIE----YDTDLHEFNFQAMRD  300
            MS V++MLEG    +D+I     Y+ DL    F+ +RD
Sbjct  931  MSAVVSMLEGQTVVQDVISDPGIYNDDLR---FRPLRD  965



>ref|XP_008443628.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X3 [Cucumis melo]
Length=962

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK DD++KTHI +TRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI++G+ N +
Sbjct  763  FGLAKLDDEEKTHI-TTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIISGRSNND  821

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   E C+CLLDW   LQ+ GNL+EL+D +L S  D ++A  V+K+ALLCTN SP++RP+
Sbjct  822  YVPSETCVCLLDWACHLQQSGNLMELVDEKLRSEIDTKEAENVVKIALLCTNASPSIRPA  881

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V+NMLEG   I +   +   +N    F+AMRD   Q     S S  Q   S+
Sbjct  882  MSEVVNMLEGRMKIPDLIPEPSSYNEDLRFKAMRDMRRQQQHSQSLSESQTQNST  936



>ref|XP_010064492.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=326

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI ST++AGT GYMAPEY + GYLT K D+YSFG++ LE+V+G+ N+ 
Sbjct  125  FGLAKLDEEDNTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIIALEVVSGQSNIG  183

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             +++E C  +LDW   L+++GNLI+L+D RLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  184  SQKNEECFYILDWACFLKERGNLIDLVDRRLGSHFDKEEALALIKVALMCTNATPALRPL  243

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   I   D++   + E    AMR H+
Sbjct  244  MSSVVSMLEGKVAIPVLDSEGAIMTEEKIDAMRKHF  279



>ref|XP_008443627.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Cucumis melo]
Length=966

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 8/172 (5%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK DD++KTHI +TRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI++G+ N +
Sbjct  767  FGLAKLDDEEKTHI-TTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIISGRSNND  825

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   E C+CLLDW   LQ+ GNL+EL+D +L S  D ++A  V+K+ALLCTN SP++RP+
Sbjct  826  YVPSETCVCLLDWACHLQQSGNLMELVDEKLRSEIDTKEAENVVKIALLCTNASPSIRPA  885

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRD--HYDQMPVHLSDSPYQ  255
            MS V+NMLEG   I +   +   +N    F+AMRD     Q    LS+S  Q
Sbjct  886  MSEVVNMLEGRMKIPDLIPEPSSYNEDLRFKAMRDMRRQQQHSQSLSESQTQ  937



>ref|XP_008345927.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 [Malus domestica]
Length=159

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 110/159 (69%), Gaps = 12/159 (8%)
 Frame = -1

Query  674  MAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VEYRRDENCLCLLDWVLDLQKQGNLIE  498
            MAPEY LWGYL+ K DVYSFGVV LE+++GKN ++YR +EN +CLLDW L LQ+ GNL+ 
Sbjct  1    MAPEYALWGYLSDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWALVLQQXGNLMX  60

Query  497  LIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEG----HEDIIEYDTDL  330
            L+D +LGS F+KE+A+R+IKVALLC NPSPALRP+MS V++MLEG    HE  I      
Sbjct  61   LVDRKLGSEFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTLVHEVKINPSIYG  120

Query  329  HEFNFQAMRDHYD-------QMPVHLSDSPYQANFSSDA  234
             E  F+   +  D       Q  ++ SD+ + A+ SS A
Sbjct  121  DEMRFRDFTEDPDTTTEESTQSLLYSSDTKWTASTSSSA  159



>ref|XP_008443626.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Cucumis melo]
Length=1020

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK DD++KTHI +TRVAGT GYMAPEY LWGYLT+K DVYSFGVV LEI++G+ N +
Sbjct  821  FGLAKLDDEEKTHI-TTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIISGRSNND  879

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   E C+CLLDW   LQ+ GNL+EL+D +L S  D ++A  V+K+ALLCTN SP++RP+
Sbjct  880  YVPSETCVCLLDWACHLQQSGNLMELVDEKLRSEIDTKEAENVVKIALLCTNASPSIRPA  939

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQMPVHLSDSPYQANFSS  240
            MS V+NMLEG   I +   +   +N    F+AMRD   Q     S S  Q   S+
Sbjct  940  MSEVVNMLEGRMKIPDLIPEPSSYNEDLRFKAMRDMRRQQQHSQSLSESQTQNST  994



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 129/206 (63%), Gaps = 35/206 (17%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK----  582
             G+AK DD+D THI  TR+AGT GYMAPEY L+GYLT+K DVYSFGVV LEIV+ K    
Sbjct  407  FGMAKLDDEDNTHI-DTRIAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSYKADVY  465

Query  581  --------------NVEYRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRV  444
                          NV++RRDEN +CLLD  L LQK G+++E++DPRLGS F+K++ +R+
Sbjct  466  SFGVVALEIVSGMNNVKFRRDENFVCLLDRALYLQKNGDIMEMVDPRLGSEFNKKEVVRM  525

Query  443  IKVALLCTNPSPALRPSMSLVINMLEGHEDIIE-------------YDTDLHEFNFQ---  312
            I VALLCTN SPALRP+MS V++MLEG  D+ +             Y T LH    Q   
Sbjct  526  INVALLCTNQSPALRPTMSTVVSMLEGKTDVEDLVMVPSTLVDPSGYATALHNKFAQSSV  585

Query  311  AMRDHYDQMPVHLSDSPYQANFSSDA  234
            +      Q  V  S+ P+ A+ SS A
Sbjct  586  SGSLSESQSLVKSSEGPWTASSSSSA  611



>gb|KJB57372.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=598

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  405  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  463

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  464  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  523

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQMPVH-LSDSPYQANFSSDA  234
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M     + +P  + F S +
Sbjct  524  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYMSSQGHTSTPAGSLFESSS  581



>ref|XP_010313922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Solanum lycopersicum]
Length=919

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 6/152 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  708  FGLAKLDEEENTHI-STRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTN  766

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DPRLG+N+ K++A+R+I V+LLCTNPSP LRPS
Sbjct  767  YRPKEEFVYLLDWAYVLQEQGNLLELVDPRLGTNYSKKEAMRMINVSLLCTNPSPTLRPS  826

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQA  309
            MS V++MLEG       II+  T   E  F++
Sbjct  827  MSSVVSMLEGKLPVQAPIIKRTTSDDEMRFKS  858



>gb|KDO35800.1| hypothetical protein CISIN_1g028061mg [Citrus sinensis]
Length=214

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 96/135 (71%), Gaps = 5/135 (4%)
 Frame = -1

Query  674  MAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VEYRRDENCLCLLDWVLDLQKQGNLIE  498
            MAPEY LWGYLT+K DVYSFGVV LEIV+GKN + Y  D NC C LDW   L + G L+E
Sbjct  1    MAPEYALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHQSGTLME  60

Query  497  LIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSMSLVINMLEGHE---DIIEYDTDLH  327
             +DPRLGS F+K +A R+IK+ALLCTN SP+LRP+MS V++MLEG     D+I     L 
Sbjct  61   FVDPRLGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLS  120

Query  326  E-FNFQAMRDHYDQM  285
            E   F+ +RDH  +M
Sbjct  121  EDLRFKTLRDHPREM  135



>gb|KCW48256.1| hypothetical protein EUGRSUZ_K01985 [Eucalyptus grandis]
Length=684

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  482  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  540

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  541  SQKPEECFILLDWAHFLKEKGNLIELVDPRLGSHFDKEEALALIKVALMCTNVTPALRPP  600

Query  392  MSLVINMLEGHEDIIEYD---TDLHEFNFQAMRDHY  294
            MS V++MLEG   +   D   T + E   +AMR H+
Sbjct  601  MSSVVSMLEGKVAVPVLDSAGTIMTEEKIEAMRKHF  636



>ref|XP_006449567.1| hypothetical protein CICLE_v10014126mg [Citrus clementina]
 gb|ESR62807.1| hypothetical protein CICLE_v10014126mg [Citrus clementina]
Length=1023

 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 117/161 (73%), Gaps = 14/161 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++DKTHI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIV+GKN + 
Sbjct  796  FGLAKLDEEDKTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVSGKNNMS  854

Query  572  YRR--DENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALR  399
            Y    + +C CLLDW   LQ  G L+EL+D RLGS ++KE+A R+IKV+LLCTN SP+LR
Sbjct  855  YASALEFDCTCLLDWACHLQLDGKLVELVDERLGSKYNKEEAERMIKVSLLCTNASPSLR  914

Query  398  PSMSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDH  297
            P+MS V+NMLEG   I +       Y  DL    F+A+RD 
Sbjct  915  PTMSEVVNMLEGKTAIPDMIPEAGSYSQDLR---FKALRDQ  952



>ref|XP_002317319.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
 gb|EEE97931.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
Length=668

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY  WGYLT K DVYSFGVV LEIV+GK N  
Sbjct  463  FGLAKLNEEENTHI-STRVAGTIGYMAPEYAQWGYLTDKADVYSFGVVALEIVSGKSNSS  521

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW    QK+ NL+E++DP+L S F+KE+A R+IK ALLCTN SP++RP+
Sbjct  522  YRPENENVCLLDWAHVFQKKENLMEIVDPKLHSEFNKEEAERMIKAALLCTNASPSIRPA  581

Query  392  MSLVINMLEGHEDIIEYDTDLHEF----NFQAMRDHYDQM  285
            MS V++MLEG   I E  +D   F    + + +  HY Q+
Sbjct  582  MSEVVSMLEGQTSIPEVTSDPSIFYDDLHSKRVNGHYQQV  621



>ref|XP_010036442.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Eucalyptus grandis]
Length=659

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  462  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  520

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  521  SQKTEECFILLDWAHFLKERGNLIELVDPRLGSHFDKEEALALIKVALVCTNVTPALRPP  580

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  581  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  616



>ref|XP_010038874.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=669

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  467  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  525

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ + C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  526  SQKTKECFILLDWAHFLKERGNLIELVDPRLGSHFDKEEALALIKVALMCTNATPALRPQ  585

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  586  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  621



>gb|KCW48003.1| hypothetical protein EUGRSUZ_K01737 [Eucalyptus grandis]
Length=658

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  456  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  514

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ + C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  515  SQKTKECFILLDWAHFLKERGNLIELVDPRLGSHFDKEEALALIKVALMCTNATPALRPQ  574

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  575  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  610



>ref|XP_010036440.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
Length=714

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  517  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  575

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  576  SQKTEECFILLDWAHFLKERGNLIELVDPRLGSHFDKEEALALIKVALVCTNVTPALRPP  635

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  636  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  671



>ref|XP_006847775.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
 gb|ERN09356.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
Length=559

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LEIV+GK N  
Sbjct  345  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTN  403

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E C+ LLDW   LQ++G+L+EL+DP LGSN+ K++AL+++ V LLCTNPSP LRPS
Sbjct  404  YRPKEECVYLLDWAYVLQEKGSLLELVDPELGSNYSKDEALKMLNVGLLCTNPSPTLRPS  463

Query  392  MSLVINMLEGHEDI  351
            MS V++MLEG+ ++
Sbjct  464  MSAVVSMLEGNANV  477



>gb|KHG23496.1| putative LRR receptor-like serine/threonine-protein kinase RFK1 
[Gossypium arboreum]
Length=746

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  553  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  611

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGSN++K +A R+IKVALLCTN SP+LRP+
Sbjct  612  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSNYNKSEAERMIKVALLCTNASPSLRPT  671

Query  392  MSLVINMLEGH---EDII----EYDTDLHEFNFQAMRDH--YDQMPVHLSDSPYQANFSS  240
            MS V+ MLEG     D+I     Y+ DL    F+A+RDH  Y +   H S +P  + F S
Sbjct  672  MSDVVGMLEGTITIPDVIPNACSYNEDLR---FKAIRDHRSYIRSQGHTS-TPAGSLFES  727

Query  239  DA  234
             +
Sbjct  728  SS  729



>ref|XP_004251900.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
 ref|XP_010313921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
Length=1018

 Score =   169 bits (429),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 6/152 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  807  FGLAKLDEEENTHI-STRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTN  865

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DPRLG+N+ K++A+R+I V+LLCTNPSP LRPS
Sbjct  866  YRPKEEFVYLLDWAYVLQEQGNLLELVDPRLGTNYSKKEAMRMINVSLLCTNPSPTLRPS  925

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQA  309
            MS V++MLEG       II+  T   E  F++
Sbjct  926  MSSVVSMLEGKLPVQAPIIKRTTSDDEMRFKS  957



>gb|KCW71078.1| hypothetical protein EUGRSUZ_F04177 [Eucalyptus grandis]
Length=771

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY + GYLT K DVYSFGVVTLEIV+GK N  
Sbjct  563  FGLAKLDEEENTHI-STRVAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTN  621

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGN++EL+DPRLGS++ KE+A+R++ +ALLCTNPSP LRP 
Sbjct  622  YRPKEEFVYLLDWAYVLQEQGNVLELVDPRLGSDYSKEEAMRMLNLALLCTNPSPTLRPP  681

Query  392  MSLVINMLEGHEDI  351
            MS V+++LEG+  I
Sbjct  682  MSTVVSILEGNSPI  695



>ref|XP_010046856.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=268

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  66   FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGRSNTS  124

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LL+W   L+++  LIEL+DPRLGS+FD+E+AL +IKVAL+CTN +PALRP 
Sbjct  125  SQKTEECFILLNWAHFLKERETLIELVDPRLGSHFDREEALALIKVALMCTNVTPALRPP  184

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  185  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  220



>ref|XP_006477836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Citrus sinensis]
 ref|XP_006477837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Citrus sinensis]
 ref|XP_006477838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X3 [Citrus sinensis]
Length=1016

 Score =   169 bits (428),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 121/181 (67%), Gaps = 10/181 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+D+ THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LEIV+GK N  
Sbjct  806  FGLAKLDEDENTHI-STRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTN  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGSNF K++A+ ++ +ALLCTNPSP LRP+
Sbjct  865  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPT  924

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLS----DSPYQANFSSD  237
            MS V++MLEG       II  ++D  +  F+A          H+S    +S  Q   S D
Sbjct  925  MSSVVSMLEGKTAVQAPIIRRNSDSQDARFRAFEILSQDSQTHVSTLSQESEMQRTMSID  984

Query  236  A  234
            A
Sbjct  985  A  985



>ref|XP_006467584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Citrus sinensis]
Length=1032

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 126/192 (66%), Gaps = 24/192 (13%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKN-VE  573
             GLAK D++DKTHI STR+AGT GYMAPEY LWGYLT+K DVYSFG+V LEIV+GKN + 
Sbjct  805  FGLAKLDEEDKTHI-STRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVSGKNNMS  863

Query  572  YRR--DENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALR  399
            Y    + +C CLLDW   LQ  G L+EL+D RLGS ++KE+  R+IKV+LLCTN SP+LR
Sbjct  864  YASALEFDCTCLLDWACHLQLDGKLVELVDERLGSKYNKEEVERMIKVSLLCTNASPSLR  923

Query  398  PSMSLVINMLEGHEDIIE-------YDTDLHEFNFQAMRDHY----------DQMPVHLS  270
            P+MS V+NMLEG   I +       Y  DL    F+A+RD             Q    +S
Sbjct  924  PTMSEVVNMLEGKTAIPDMIPEAGSYSQDLR---FKALRDQKGLRRSQNSTATQSQHSIS  980

Query  269  DSPYQANFSSDA  234
               YQA+ S+ A
Sbjct  981  AEFYQASSSTSA  992



>ref|XP_006442369.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
 gb|ESR55609.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
Length=966

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 121/181 (67%), Gaps = 10/181 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+D+ THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LEIV+GK N  
Sbjct  756  FGLAKLDEDENTHI-STRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTN  814

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGSNF K++A+ ++ +ALLCTNPSP LRP+
Sbjct  815  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPT  874

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAM----RDHYDQMPVHLSDSPYQANFSSD  237
            MS  ++MLEG       II  ++D  +  F+A     +D   Q+     +S  Q   S D
Sbjct  875  MSSAVSMLEGKTAVQAPIIRRNSDSQDARFRAFEILSQDSQTQVSTLSQESEMQRTMSID  934

Query  236  A  234
            A
Sbjct  935  A  935



>ref|XP_008225244.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Prunus mume]
Length=1000

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 6/159 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
             GLAK D+++KTHI STRVAGT GYMAPEY LWG LT+K DVYSFGVV LEIV+GK   Y
Sbjct  812  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEIVSGKKNSY  870

Query  569  RRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPSM  390
              ++ C+CLLDW   LQ+ GNL EL+D +LG   + ++A  ++KV LLCTN SP+LRP+M
Sbjct  871  APNDRCVCLLDWACHLQQTGNLKELVDEKLGYEVNGQEAEVMVKVGLLCTNASPSLRPTM  930

Query  389  SLVINMLEGHE---DII--EYDTDLHEFNFQAMRDHYDQ  288
            S V++MLEG     D++  E  T   +  F+AMRD +DQ
Sbjct  931  SEVVSMLEGRTPVPDVVVPEASTHTQDLMFKAMRDVHDQ  969



>ref|XP_006377472.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
 gb|ERP55269.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
Length=582

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++++ THI STRVAGT GYMAPEY LWGYLT K DVYSFGVV LEIV+GK N  
Sbjct  420  FGLAKLNEEENTHI-STRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSS  478

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR +   +CLLDW   LQK+GNL+E++DP+L S F+KE+A R+IK ALLCTN SP+LRP+
Sbjct  479  YRPENENVCLLDWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPA  538

Query  392  MSLVINMLE  366
            MS V++ML+
Sbjct  539  MSEVVSMLK  547



>gb|KCW48028.1| hypothetical protein EUGRSUZ_K01762 [Eucalyptus grandis]
Length=817

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  620  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  678

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  679  SQKTEECFILLDWAHFLKERGNLIELVDPRLGSHFDKEEALALIKVALVCTNVTPALRPP  738

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  739  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  774



>ref|XP_010038955.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=873

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  671  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  729

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  730  SQKPEECFILLDWAHFLKEKGNLIELVDPRLGSHFDKEEALALIKVALMCTNVTPALRPP  789

Query  392  MSLVINMLEGHEDIIEYD---TDLHEFNFQAMRDHY  294
            MS V++MLEG   +   D   T + E   +AMR H+
Sbjct  790  MSSVVSMLEGKVAVPVLDSAGTIMTEEKIEAMRKHF  825



>gb|KCW48051.1| hypothetical protein EUGRSUZ_K01793 [Eucalyptus grandis]
Length=642

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++KTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  440  FGLAKLDEEEKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGRSNTS  498

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++G LIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  499  SQKTEECFILLDWAHFLKERGTLIELVDPRLGSHFDKEEALALIKVALMCTNVTPALRPP  558

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  559  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  594



>ref|XP_010036439.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
 ref|XP_010036441.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Eucalyptus grandis]
Length=815

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  618  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTS  676

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             ++ E C  LLDW   L+++GNLIEL+DPRLGS+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  677  SQKTEECFILLDWAHFLKERGNLIELVDPRLGSHFDKEEALALIKVALVCTNVTPALRPP  736

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  737  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  772



>gb|KCW48268.1| hypothetical protein EUGRSUZ_K020001, partial [Eucalyptus grandis]
Length=365

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFGVV LE+V G+ N  
Sbjct  168  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVNGRSNTS  226

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             +R E C  LLDW   L++  NLIEL+DPRLGS+F+KE+AL +IKVAL+CTN +PALRP 
Sbjct  227  SQRTEECFNLLDWAHFLKEGENLIELVDPRLGSHFNKEEALALIKVALMCTNVTPALRPP  286

Query  392  MSLVINMLEGHEDIIEYD---TDLHEFNFQAMRDHY  294
            MS V++MLEG   +   D   T + +   +AMR H+
Sbjct  287  MSSVVSMLEGKVAVPVLDSAGTIMTQERIEAMRKHF  322



>gb|KJB57377.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=856

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  663  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  721

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  722  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  781

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQMPVH-LSDSPYQANFSSDA  234
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M     + +P  + F S +
Sbjct  782  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYMSSQGHTSTPAGSLFESSS  839



>gb|KJB57376.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=857

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  664  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  722

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  723  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  782

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQMPVH-LSDSPYQANFSSDA  234
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M     + +P  + F S +
Sbjct  783  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYMSSQGHTSTPAGSLFESSS  840



>ref|XP_010060733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1010

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVVTLEIV+GK N  
Sbjct  802  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTN  860

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGN +EL+DPRLGSN+ +E+A+R++ +ALLCTNPSP LRP+
Sbjct  861  YRPKEEFVYLLDWAYVLQEQGNFLELVDPRLGSNYSEEEAMRMLNLALLCTNPSPTLRPA  920

Query  392  MSLVINMLEGHEDI  351
            MS V++MLEG   I
Sbjct  921  MSSVVSMLEGKGAI  934



>ref|XP_006370088.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
 gb|ERP66657.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
Length=728

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  516  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTN  574

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGSN+ K +ALR++ +ALLCTNPSP LRPS
Sbjct  575  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPS  634

Query  392  MSLVINMLEGH  360
            MS  + MLEG 
Sbjct  635  MSSAVKMLEGQ  645



>ref|XP_010041838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=607

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVVTLEIV+GK N  
Sbjct  399  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTN  457

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ++GN++EL+DPRLGSN+ +E+A+R++ +ALLCTNPSP LRP 
Sbjct  458  YRPKEEFVYLLDWAYVLQERGNVLELVDPRLGSNYSEEEAMRMLNLALLCTNPSPTLRPP  517

Query  392  MSLVINMLEGHEDI  351
            MS V++MLEG   I
Sbjct  518  MSSVVSMLEGKGAI  531



>ref|XP_004146083.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
 ref|XP_004167552.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
Length=1012

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 111/153 (73%), Gaps = 6/153 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLA+ D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  807  FGLARLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTN  865

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP L SN+ KE+ +R+I +ALLCTNPSP LRPS
Sbjct  866  YRPKEEFVYLLDWAYVLQEQGNLLELVDPNLDSNYPKEEVMRMINIALLCTNPSPTLRPS  925

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAM  306
            MS V++MLEG       II+ DT   E  F+A 
Sbjct  926  MSSVVSMLEGKIAVQAPIIKRDTVDQEARFKAF  958



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 6/171 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++ THI STRVAGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  808  FGLAKLYEEENTHI-STRVAGTFGYMAPEYAMKGYLTNKADVYSFGVVALEIVSGKRNTS  866

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            ++  E  + LLDW L L+ QG+L++L+DPRLG  F+K++A+++I VALLCTN    LRP+
Sbjct  867  FKPQEEFIDLLDWALILKDQGSLLDLVDPRLGLEFNKDEAMKMINVALLCTNTCAPLRPT  926

Query  392  MSLVINMLEGHEDIIEYDTDLH----EFNFQAMRDHYDQMPVHLSDSPYQA  252
            MS V+ MLEG   + E+ +D      E+ F+ M +HY Q+  H S S  Q 
Sbjct  927  MSAVVGMLEGQASVTEFVSDTSISSVEWRFKTMMNHYSQVQDHPSISVSQT  977



>gb|KDO42388.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
 gb|KDO42389.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=1016

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 120/181 (66%), Gaps = 10/181 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+D+ THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LEIV+GK N  
Sbjct  806  FGLAKLDEDENTHI-STRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTN  864

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGSNF K++A+ ++ +ALLCTNPSP LRP+
Sbjct  865  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPT  924

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLS----DSPYQANFSSD  237
            MS  ++MLEG       II  ++D  +  F+A          H+S    +S  Q   S D
Sbjct  925  MSSAVSMLEGKTAVQAPIIRRNSDSQDARFRAFEILSQDSQTHVSTLSQESEMQRTMSID  984

Query  236  A  234
            A
Sbjct  985  A  985



>gb|KJB57375.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=984

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  791  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  849

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  850  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  909

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQMPVH-LSDSPYQANFSSDA  234
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M     + +P  + F S +
Sbjct  910  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYMSSQGHTSTPAGSLFESSS  967



>gb|KJB57374.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=960

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 117/160 (73%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  767  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  825

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  826  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  885

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQM  285
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M
Sbjct  886  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYM  925



>gb|KJB57373.1| hypothetical protein B456_009G159800 [Gossypium raimondii]
Length=983

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 7/178 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  D+DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LE+V+GK N+ 
Sbjct  790  FGLAKLSDEDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMN  848

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   +   CLLDW   LQ+ G L+EL+D +LGS+++K +A R+IKVALLCTN SP+LRP+
Sbjct  849  YGPVDEYTCLLDWACHLQQSGKLLELVDDKLGSDYNKSEAERMIKVALLCTNASPSLRPT  908

Query  392  MSLVINMLEGH---EDIIEYDTDLHE-FNFQAMRDHYDQMPVH-LSDSPYQANFSSDA  234
            MS V+ MLEG     D+I   +  +E   F+A+RDH   M     + +P  + F S +
Sbjct  909  MSDVVGMLEGTITIPDVIPNASSYNEDLRFKAIRDHRSYMSSQGHTSTPAGSLFESSS  966



>ref|XP_010064505.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=607

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 126/186 (68%), Gaps = 15/186 (8%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI ST++AGT GYMAPEY + GYLT K DVYSFGVV LE+V+G+ N  
Sbjct  405  FGLAKLDEEDNTHI-STKIAGTYGYMAPEYAMHGYLTEKADVYSFGVVALEVVSGRSNTS  463

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y++ E C  LLDW   L+++GNL++L+D RLGS+FD+++ L +IKVALLCTN +PALRP 
Sbjct  464  YQKKEKCFYLLDWARVLKERGNLMDLVDQRLGSHFDEKEVLAMIKVALLCTNVTPALRPP  523

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY----DQ------MPVHLSDSPYQA  252
            MS V++MLEG   +   D++   + E   +AMR H+    DQ          L+D P+  
Sbjct  524  MSSVVSMLEGKAAVPVLDSEGAIITEETIEAMRKHFKGDEDQAVDENITKSTLTDGPWTG  583

Query  251  NFSSDA  234
              SS +
Sbjct  584  TASSTS  589



>gb|AET04342.2| LRR receptor-like Serine/Threonine-kinase RFK1, putative [Medicago 
truncatula]
Length=1008

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
              GLA+ D+++KTHI +TRVAGT GYMAPEY LWGYL++KVDVYSFGVV LE V+GK N  
Sbjct  814   FGLARLDEEEKTHI-TTRVAGTIGYMAPEYALWGYLSYKVDVYSFGVVVLETVSGKSNNN  872

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             Y   +NC+CLLD  L L +  N ++L+D RLGS  +  +   V++VALLCTNPSP+LRP+
Sbjct  873   YMPSDNCVCLLDKALYLDRTENFMQLVDERLGSEVNPTETKNVVRVALLCTNPSPSLRPT  932

Query  392   MSLVINMLEGH---EDII-EYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q  225
             MS V+NMLEG     D+I E +T   +  F++MRD +     H S S  Q + S+     
Sbjct  933   MSEVVNMLEGRMSIPDVIPEGNTFCEDLRFKSMRDIHQNKEGH-SVSTSQTDGSTGVRTY  991

Query  224   *KIASFTNIVQEI  186
                ++F N + EI
Sbjct  992   STPSTFGNDIHEI  1004



>ref|XP_009351793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Pyrus x bretschneideri]
Length=1011

 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 6/172 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVE-  573
             GLAK D+++KTHI STRVAGT GYMAPEY LWG+LT+K DVYSFGVV LEI++GKN   
Sbjct  814  FGLAKLDEEEKTHI-STRVAGTIGYMAPEYALWGHLTYKADVYSFGVVALEIISGKNNNN  872

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   ++ +CLLDW   LQ+ GNL+ELID +LGS FD+++A  ++KVALLCTN S +LRPS
Sbjct  873  YIPSDDWVCLLDWACHLQQTGNLLELIDEKLGSEFDQKEAEIMVKVALLCTNASASLRPS  932

Query  392  MSLVINMLEGH---EDII-EYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQAN  249
            MS  ++MLEG     D++ E  T   +  F+AMRD + Q   H S   +  N
Sbjct  933  MSEAVSMLEGQIPVPDVVPEPRTYKEDLRFKAMRDLHRQRGDHSSSISHTQN  984



>gb|KCW48008.1| hypothetical protein EUGRSUZ_K017432, partial [Eucalyptus grandis]
Length=365

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFGVV LE+V G+ N  
Sbjct  168  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVNGRSNTS  226

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             +R E C  LLDW   L++  NLIEL+DPRLGS+F+KE+AL +IKVAL+CTN +PALRP 
Sbjct  227  SQRTEECFNLLDWAHFLKEGENLIELVDPRLGSHFNKEEALALIKVALMCTNVTPALRPP  286

Query  392  MSLVINMLEGHEDIIEYD---TDLHEFNFQAMRDHY  294
            MS V++MLEG   +   D   T + +   +AMR H+
Sbjct  287  MSSVVSMLEGKVVVPVLDSAGTIMTQERIEAMRKHF  322



>ref|XP_010063817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1009

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STRVAGT GYMAPEY + GYLT K DVYSFGVVTLEIV+GK N  
Sbjct  801  FGLAKLDEEENTHI-STRVAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTN  859

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGN++EL+DPRLGS++ KE+A+R++ +ALLCTNPSP LRP 
Sbjct  860  YRPKEEFVYLLDWAYVLQEQGNVLELVDPRLGSDYSKEEAMRMLNLALLCTNPSPTLRPP  919

Query  392  MSLVINMLEGHEDI  351
            MS V+++LEG+  I
Sbjct  920  MSTVVSILEGNSPI  933



>ref|XP_002522276.1| kinase, putative [Ricinus communis]
 gb|EEF40134.1| kinase, putative [Ricinus communis]
Length=2046

 Score =   168 bits (425),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 117/160 (73%), Gaps = 6/160 (4%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVEY  570
              GLAK D+ DKTHI STR+AGT GY+APEY LWGYLT+K DVYSFG+V LEIV+G+N   
Sbjct  1857  FGLAKLDEKDKTHI-STRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALEIVSGRNNMN  1915

Query  569   RRDENCL-CLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             R  E+   CLLDW   LQK GNL+EL+D +LGS F+K +A R+IKVALLCTN +P++RP+
Sbjct  1916  RGPESKFTCLLDWACQLQKCGNLMELVDEKLGSEFNKAEAERMIKVALLCTNDTPSVRPT  1975

Query  392   MSLVINMLEGHE---DIIEYDTDLHE-FNFQAMRDHYDQM  285
             MS V+ MLEG     D+I  +++  E   F+ +RDH   M
Sbjct  1976  MSEVVGMLEGTRFVPDVIANESNNTEDLRFKIIRDHLKSM  2015


 Score =   165 bits (417),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D ++KTHI STRVAGT GYMAPEY LWGYLT+K D+YSFG+V LEIV+GK N+ 
Sbjct  799  FGLAKLDSEEKTHI-STRVAGTIGYMAPEYALWGYLTYKADIYSFGIVALEIVSGKHNMS  857

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
               + N  CLLDW   LQ+ G L+EL+D +LGS F K +A R+IKVALLCTN S +LRP 
Sbjct  858  RGPESNFGCLLDWACHLQQGGKLMELVDEKLGSEFKKVEAERMIKVALLCTNGSASLRPI  917

Query  392  MSLVINMLEGHE---DIIEYDTDLHE-FNFQAMRDHYDQM  285
            MS V++MLEG +   D+I  ++  +E   F+A+R+H+ ++
Sbjct  918  MSEVVSMLEGTKTIPDVIPEESSYNEDLRFKAIREHHKEI  957



>ref|XP_006358931.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Solanum tuberosum]
Length=1020

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 113/153 (74%), Gaps = 6/153 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  809  FGLAKLDEEENTHI-STRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTN  867

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DPRLG+++ K++A+R+I ++LLCTNPSP LRPS
Sbjct  868  YRPKEEFVYLLDWAYVLQEQGNLLELVDPRLGTHYSKKEAMRMINISLLCTNPSPTLRPS  927

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAM  306
            MS V++MLEG       II+  T   E  F++ 
Sbjct  928  MSSVVSMLEGKLPVQAPIIKRTTSDDEMRFKSF  960



>gb|KHN36920.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1023

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 11/177 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  815  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTN  873

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGS +  E+A+R++++ALLCTNPSP LRPS
Sbjct  874  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSKYSSEEAMRMLQLALLCTNPSPTLRPS  933

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDA  234
            MS V++MLEG       II+    + +  F+A          H+S +     FS D+
Sbjct  934  MSSVVSMLEGKTPIQAPIIKRSDSVEDVRFKAFEMLSQDSQTHVSSA-----FSQDS  985



>ref|XP_007149532.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
 gb|ESW21526.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
Length=690

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 126/189 (67%), Gaps = 17/189 (9%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK DD+D THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV GK N  
Sbjct  488  FGLAKLDDEDNTHI-STRIAGTYGYMAPEYAMHGYLTDKADVYSFGVVALEIVTGKTNTI  546

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R  +  L LLDW   ++++GNL+EL+D RLGSNF++++ + +IKV LLCTN +  LRPS
Sbjct  547  HRPKQEALLLLDWAHLVKEKGNLMELVDRRLGSNFNEKEVMMMIKVGLLCTNTTANLRPS  606

Query  392  MSLVINMLEGHEDIIEYDTD----LHEFNFQAMRDHYDQM---------PVHLS--DSPY  258
            MS V++MLEG   I E+ +D    + E   +AMR +Y QM           H S  D P+
Sbjct  607  MSSVLSMLEGKTVIPEFISDSSEVMDEMKLEAMRQYYSQMEENERSETHTTHSSSKDGPW  666

Query  257  QANFSSDAN  231
             A+ SS A+
Sbjct  667  TASSSSAAD  675



>ref|XP_006847776.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella 
trichopoda]
 gb|ERN09357.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella 
trichopoda]
Length=326

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 107/141 (76%), Gaps = 9/141 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++  HI STR+AGT GYMAPEY + GYLT K DVYSFG+V LEIV+GK N  
Sbjct  115  FGLAKLDEEENAHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTN  173

Query  572  YRRDENCLCLLDWV-------LDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNP  414
            YR  E+C+ LLDW+         LQ++G+L+EL+DP LGSN+ K++AL+++ V  LCTNP
Sbjct  174  YRPKEDCVYLLDWISICKLPAYVLQEKGSLLELVDPELGSNYSKDEALKMLNVGFLCTNP  233

Query  413  SPALRPSMSLVINMLEGHEDI  351
            SP LRPSMS V++MLEG+ ++
Sbjct  234  SPTLRPSMSAVVSMLEGNANV  254



>ref|XP_007021935.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY13460.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1016

 Score =   166 bits (421),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 117/160 (73%), Gaps = 6/160 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI STRVAGT GYMAPEY + GYLT K DVYSFG+V LEIV+G+ N+ 
Sbjct  810  FGLAKLDEEDNTHI-STRVAGTFGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGRSNIS  868

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E C  L+DWVL L++QG+L++L+DPR+GS+++KE+ + +I VALLCTN + A RP+
Sbjct  869  YRPKEECFHLIDWVLTLKEQGSLLDLVDPRMGSDYNKEEVMAMINVALLCTNATAAARPA  928

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHYDQM  285
            MS V++MLEG   + E  TD   F+     QAM+  Y  +
Sbjct  929  MSSVVSMLEGRAAVQELVTDSSNFSDESKSQAMKRLYQHL  968



>ref|XP_010675288.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Beta vulgaris subsp. vulgaris]
Length=1019

 Score =   166 bits (421),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 117/167 (70%), Gaps = 6/167 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAG-KNVE  573
             GLAK D+D+ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+G  N  
Sbjct  805  FGLAKLDEDENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGTSNTS  863

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGS++ KE+ALR++ +ALLCTNPSP+LRPS
Sbjct  864  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSSYSKEEALRLLNIALLCTNPSPSLRPS  923

Query  392  MSLVINMLEGHEDI---IEYDTDLH-EFNFQAMRDHYDQMPVHLSDS  264
            MS V++M+EG   +   I   T ++ E  F+A          H+S S
Sbjct  924  MSSVMSMIEGQSPVQAPIVKRTGMNDELRFRAFERLSQDSQTHVSGS  970



>gb|KCW45029.1| hypothetical protein EUGRSUZ_L013821, partial [Eucalyptus grandis]
Length=370

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V+G+ N  
Sbjct  168  FGLAKLDEEDNTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGRSNTS  226

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
              + E C  LLDW   L+++GNLI+L+D RL S+FDKE+AL +IKVAL+CTN +PALRP 
Sbjct  227  SPKKEECFYLLDWARFLKERGNLIDLVDRRLSSHFDKEEALALIKVALMCTNATPALRPP  286

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   I   D++   + +   +AMR H+
Sbjct  287  MSSVVSMLEGKVAIPVLDSEGAMMTDEQIEAMRKHF  322



>ref|XP_010246507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X2 [Nelumbo nucifera]
Length=984

 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 121/181 (67%), Gaps = 10/181 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LE+V+GK N  
Sbjct  788  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVLLELVSGKSNTS  846

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E+ + LLDW   LQ+QGNL+EL+DP L SN+ KE+ALR++ +AL CTNPSP LRPS
Sbjct  847  YRPKEDFVYLLDWAYVLQEQGNLLELVDPILESNYSKEEALRMLNLALFCTNPSPTLRPS  906

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAM----RDHYDQMPVHLSDSPYQANFSSD  237
            MS V++MLEG       II+  +D  E  F+A     +D      +   +S  Q + S D
Sbjct  907  MSSVVSMLEGKIAIQAPIIKKRSDDEEVRFKAFQKLSQDSQSYTSITSQESQMQKSISMD  966

Query  236  A  234
             
Sbjct  967  G  967



>ref|XP_008225247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Prunus mume]
Length=938

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVE-  573
             GLAK D+++KTH+ STRVAGT GYMAPEY LWG+LT+K DVYSFGVV LEI++GKN   
Sbjct  741  FGLAKLDEEEKTHM-STRVAGTIGYMAPEYALWGHLTYKADVYSFGVVALEIISGKNNNN  799

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   ++ +CLLDW   LQ+ GNL+EL+D +LGS FD+++A  ++KVAL+CTN S +LRPS
Sbjct  800  YIPSDDWVCLLDWACHLQQTGNLLELVDEKLGSEFDQKEAEIMVKVALICTNASASLRPS  859

Query  392  MSLVINMLEGHE---DII-EYDTDLHEFNFQAMRDHYDQMPVH  276
            MS V++MLEG     D+I E  T   +  F+AMRD + Q   H
Sbjct  860  MSEVVSMLEGQTLVPDVIPEPSTYREDLRFKAMRDLHRQRQDH  902



>gb|KJB66876.1| hypothetical protein B456_010G162700 [Gossypium raimondii]
Length=1009

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 113/157 (72%), Gaps = 6/157 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK  +++KTHI STRVAGT GY+APEY LWGYLT+K DVYSFG++ LEI +GK N+ 
Sbjct  801  FGLAKLHEEEKTHI-STRVAGTIGYIAPEYALWGYLTYKADVYSFGILALEIASGKHNMS  859

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y  +    CLLDW  +LQ++G L+EL+D  LG  ++K +A  +IK+ LLCTN SP+LRP+
Sbjct  860  YGPENKYTCLLDWASNLQQKGKLLELVDEELGGEYNKVEAEGMIKIGLLCTNGSPSLRPT  919

Query  392  MSLVINMLEGHEDIIEYDTDLHEFN----FQAMRDHY  294
            MS V++MLEG   I E   D   +N    F+A+RDH+
Sbjct  920  MSEVVSMLEGRSGIPEMVPDPGSYNQDLRFKAIRDHH  956



>ref|XP_006370087.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
 gb|ERP66656.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
Length=900

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  688  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTN  746

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGSN+ K +ALR++ +ALLCTNPSP LRPS
Sbjct  747  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPS  806

Query  392  MSLVINMLEGH  360
            MS  + MLEG 
Sbjct  807  MSSAVKMLEGQ  817



>ref|XP_008225246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Prunus mume]
Length=1010

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGKNVE-  573
             GLAK D+++KTH+ STRVAGT GYMAPEY LWG+LT+K DVYSFGVV LEI++GKN   
Sbjct  813  FGLAKLDEEEKTHM-STRVAGTIGYMAPEYALWGHLTYKADVYSFGVVALEIISGKNNNN  871

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y   ++ +CLLDW   LQ+ GNL+EL+D +LGS FD+++A  ++KVAL+CTN S +LRPS
Sbjct  872  YIPSDDWVCLLDWACHLQQTGNLLELVDEKLGSEFDQKEAEIMVKVALICTNASASLRPS  931

Query  392  MSLVINMLEGHE---DII-EYDTDLHEFNFQAMRDHYDQMPVH  276
            MS V++MLEG     D+I E  T   +  F+AMRD + Q   H
Sbjct  932  MSEVVSMLEGQTLVPDVIPEPSTYREDLRFKAMRDLHRQRQDH  974



>ref|XP_010246506.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 121/181 (67%), Gaps = 10/181 (6%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFG+V LE+V+GK N  
Sbjct  812  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVLLELVSGKSNTS  870

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E+ + LLDW   LQ+QGNL+EL+DP L SN+ KE+ALR++ +AL CTNPSP LRPS
Sbjct  871  YRPKEDFVYLLDWAYVLQEQGNLLELVDPILESNYSKEEALRMLNLALFCTNPSPTLRPS  930

Query  392  MSLVINMLEG----HEDIIEYDTDLHEFNFQAM----RDHYDQMPVHLSDSPYQANFSSD  237
            MS V++MLEG       II+  +D  E  F+A     +D      +   +S  Q + S D
Sbjct  931  MSSVVSMLEGKIAIQAPIIKKRSDDEEVRFKAFQKLSQDSQSYTSITSQESQMQKSISMD  990

Query  236  A  234
             
Sbjct  991  G  991



>gb|KHN36927.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=506

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 119/170 (70%), Gaps = 6/170 (4%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI STRVAGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  304  FGLAKLDEEDNTHI-STRVAGTYGYMAPEYAMHGYLTDKADVYSFGVVALEIVSGKSNTI  362

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            +R  +  L LLDW   L+++GNL+EL+D RLGS+F++ + + +IKVALLCTN +  LRP+
Sbjct  363  HRSKQEALHLLDWAHLLKEKGNLMELVDRRLGSDFNENEVMMMIKVALLCTNTTSNLRPT  422

Query  392  MSLVINMLEGHEDIIEYDTD----LHEFNFQAMRDHYDQMPVHLSDSPYQ  255
            MS V++MLEG   I E+ +D    + E   +AMR HY Q     S++  Q
Sbjct  423  MSSVLSMLEGKTMIPEFVSDPSEIMDEMKLEAMRQHYFQKENERSETQEQ  472



>gb|KCW48033.1| hypothetical protein EUGRSUZ_K01771 [Eucalyptus grandis]
Length=522

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++DKTHI ST++AGT GYMAPEY + GYLT K D+YSFG+V LE+V G+ N+ 
Sbjct  329  FGLAKLDEEDKTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVNGRSNIS  387

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             +R E C  LLDW   L++  NLIEL+DPRLGS+F+KE+AL +IKVAL+CTN +PALRP 
Sbjct  388  SQRTEECFNLLDWAHFLKEGENLIELVDPRLGSHFNKEEALALIKVALMCTNVTPALRPP  447

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D+    + E   +AMR H+
Sbjct  448  MSSVVSMLEGKVAVPVLDSAGAIMTEEKIEAMRKHF  483



>ref|XP_010094305.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB55701.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=363

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 115/167 (69%), Gaps = 5/167 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK ++DD THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  166  FGLAKLNEDDNTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTN  224

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E+ + LLDW   LQ++GNL+EL+DP LGS +  E+A+ ++ VALLCTN SP LRP+
Sbjct  225  YRPKEDFVYLLDWAYVLQERGNLLELVDPALGSEYLSEEAILMLNVALLCTNASPTLRPT  284

Query  392  MSLVINMLEGHEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQA  252
            MS V++MLEG  ++ +    L +  F +M   Y     H   +P ++
Sbjct  285  MSQVVSMLEGRTEVQDL---LSDPGFSSMNSRYRGSKNHFWQNPSRS  328



>ref|XP_010064502.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=1028

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D++D THI ST++AGT GYMAPEY + GYLT K D+YSFGVV LE+V+G+ N+ 
Sbjct  817  FGLAKLDEEDNTHI-STKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVSGQCNIS  875

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            Y++ + C  LLDW  +L+++GNLI+L+D RLGS+FDKEQ L +IKVALLCTN +P LRP 
Sbjct  876  YQKKDECFHLLDWARELKERGNLIDLVDARLGSHFDKEQVLAMIKVALLCTNATPTLRPV  935

Query  392  MSLVINMLEGHEDIIEYDTD---LHEFNFQAMRDHY  294
            MS V++MLEG   +   D++     E   +AMR H+
Sbjct  936  MSSVVSMLEGKVAVPVLDSEGAIKAEEKIEAMRKHF  971



>gb|KDP27082.1| hypothetical protein JCGZ_20306 [Jatropha curcas]
Length=1030

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 136/219 (62%), Gaps = 14/219 (6%)
 Frame = -1

Query  749   LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
              GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  818   FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTN  876

Query  572   YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
             YR  E  + LLDW   LQ+QGNL+EL+DP LGS++ KE+A RV+ +ALLCTNPSP LRPS
Sbjct  877   YRPKEEFVYLLDWAYVLQEQGNLLELMDPSLGSDYSKEEAKRVLNLALLCTNPSPTLRPS  936

Query  392   MSLVINMLEG----HEDIIEYDTDLHEFNFQAMRDHYDQMPVHLSDSPYQANFSSDAN*Q  225
             MS V++M+EG       II+  +   +  F+A          H+S      +FS D+  Q
Sbjct  937   MSSVVSMVEGKIPVQAPIIKRGSVDQDARFKAFEILSQDSQTHIS------SFSQDSQAQ  990

Query  224   *KIASFTNIV-QEIRLVSL-ILTDSSSCRLWKRTHDQTL  114
               I+     V   I L S  +  D SS RL K  +D  L
Sbjct  991   RSISMDGPWVDSSISLPSNDVSQDHSSSRLLKDLYDVKL  1029



>ref|XP_006370091.1| hypothetical protein POPTR_0001s39450g [Populus trichocarpa]
 gb|ERP66660.1| hypothetical protein POPTR_0001s39450g [Populus trichocarpa]
Length=994

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -1

Query  749  LGLAkxddddKTHIISTRVAGTRGYMAPEYVLWGYLTFKVDVYSFGVVTLEIVAGK-NVE  573
             GLAK D+++ THI STR+AGT GYMAPEY + GYLT K DVYSFGVV LEIV+GK N  
Sbjct  782  FGLAKLDEEENTHI-STRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTN  840

Query  572  YRRDENCLCLLDWVLDLQKQGNLIELIDPRLGSNFDKEQALRVIKVALLCTNPSPALRPS  393
            YR  E  + LLDW   LQ+QGNL+EL+DP LGSN+ K +ALR++ +ALLCTNPSP LRPS
Sbjct  841  YRPKEEFVYLLDWAYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPS  900

Query  392  MSLVINMLEGH  360
            MS  + MLEG 
Sbjct  901  MSSAVKMLEGQ  911



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050