BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024G24

Length=583
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610364.1|  PREDICTED: uncharacterized protein LOC104104077    265   3e-86   Nicotiana tomentosiformis
ref|XP_009795967.1|  PREDICTED: uncharacterized protein LOC104242589    262   4e-85   Nicotiana sylvestris
emb|CDP10783.1|  unnamed protein product                                242   3e-77   Coffea canephora [robusta coffee]
ref|XP_004251523.1|  PREDICTED: uncharacterized protein LOC101250189    236   5e-75   Solanum lycopersicum
ref|XP_006351969.1|  PREDICTED: B-cell receptor-associated protei...    236   9e-75   Solanum tuberosum [potatoes]
ref|XP_010549208.1|  PREDICTED: B-cell receptor-associated protei...    233   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_003605958.1|  hypothetical protein MTR_4g049540                  227   3e-71   Medicago truncatula
gb|AFK33681.1|  unknown                                                 226   6e-71   Medicago truncatula
ref|XP_010244479.1|  PREDICTED: B-cell receptor-associated protei...    226   9e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010252455.1|  PREDICTED: uncharacterized protein LOC104594039    226   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_002270301.1|  PREDICTED: B-cell receptor-associated protei...    224   2e-70   Vitis vinifera
gb|ACJ84514.1|  unknown                                                 224   3e-70   Medicago truncatula
gb|KHN41234.1|  hypothetical protein glysoja_017278                     223   7e-70   Glycine soja [wild soybean]
ref|XP_010689493.1|  PREDICTED: B-cell receptor-associated protei...    223   7e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001239654.1|  uncharacterized protein LOC100798727               223   9e-70   Glycine max [soybeans]
ref|XP_006403381.1|  hypothetical protein EUTSA_v10003268mg             222   3e-69   Eutrema salsugineum [saltwater cress]
emb|CBI23212.3|  unnamed protein product                                220   2e-68   Vitis vinifera
ref|XP_003539858.1|  PREDICTED: B-cell receptor-associated protei...    219   3e-68   
ref|XP_002262807.2|  PREDICTED: B-cell receptor-associated protei...    220   4e-68   
gb|KHN21219.1|  hypothetical protein glysoja_006698                     219   4e-68   Glycine soja [wild soybean]
ref|XP_004506274.1|  PREDICTED: B-cell receptor-associated protei...    219   5e-68   Cicer arietinum [garbanzo]
ref|XP_009123682.1|  PREDICTED: uncharacterized protein LOC103848551    218   6e-68   Brassica rapa
ref|NP_568607.1|  B-cell receptor-associated 31-like protein            218   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863762.1|  hypothetical protein ARALYDRAFT_494776             217   2e-67   Arabidopsis lyrata subsp. lyrata
gb|AAM62748.1|  unknown                                                 217   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447584.1|  hypothetical protein CICLE_v10016648mg             217   2e-67   Citrus clementina [clementine]
gb|KFK32917.1|  hypothetical protein AALP_AA6G305900                    217   3e-67   Arabis alpina [alpine rockcress]
dbj|BAB09328.1|  unnamed protein product                                218   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132530.1|  hypothetical protein PHAVU_011G102200g             216   5e-67   Phaseolus vulgaris [French bean]
ref|XP_006281077.1|  hypothetical protein CARUB_v10027105mg             216   7e-67   Capsella rubella
ref|XP_010494193.1|  PREDICTED: B-cell receptor-associated protei...    214   2e-66   Camelina sativa [gold-of-pleasure]
emb|CDY68895.1|  BnaCnng60970D                                          214   3e-66   Brassica napus [oilseed rape]
ref|XP_003540294.1|  PREDICTED: B-cell receptor-associated protei...    212   3e-65   Glycine max [soybeans]
ref|XP_010481979.1|  PREDICTED: B-cell receptor-associated protei...    211   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009587048.1|  PREDICTED: B-cell receptor-associated protei...    211   5e-65   Nicotiana tomentosiformis
ref|XP_010442176.1|  PREDICTED: B-cell receptor-associated protei...    210   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007149980.1|  hypothetical protein PHAVU_005G115800g             209   4e-64   Phaseolus vulgaris [French bean]
ref|XP_006449764.1|  hypothetical protein CICLE_v10016599mg             208   9e-64   
ref|XP_003543392.1|  PREDICTED: B-cell receptor-associated protei...    207   1e-63   Glycine max [soybeans]
ref|XP_007026129.1|  B-cell receptor-associated 31-like                 206   5e-63   
gb|KDO78297.1|  hypothetical protein CISIN_1g021727mg                   203   6e-62   Citrus sinensis [apfelsine]
ref|XP_011046959.1|  PREDICTED: B-cell receptor-associated protei...    202   9e-62   Populus euphratica
ref|XP_006467408.1|  PREDICTED: B-cell receptor-associated protei...    202   1e-61   
ref|XP_010046363.1|  PREDICTED: B-cell receptor-associated protei...    202   2e-61   Eucalyptus grandis [rose gum]
ref|XP_006467407.1|  PREDICTED: B-cell receptor-associated protei...    202   2e-61   Citrus sinensis [apfelsine]
ref|XP_002524828.1|  bcr-associated protein, bap, putative              201   2e-61   
ref|XP_006383887.1|  hypothetical protein POPTR_0004s00930g             201   2e-61   Populus trichocarpa [western balsam poplar]
gb|KDO78296.1|  hypothetical protein CISIN_1g021727mg                   204   5e-61   Citrus sinensis [apfelsine]
ref|XP_009629450.1|  PREDICTED: uncharacterized protein LOC104119606    201   5e-61   Nicotiana tomentosiformis
ref|XP_006389583.1|  hypothetical protein POPTR_0021s00340g             201   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009797812.1|  PREDICTED: uncharacterized protein LOC104244159    199   3e-60   Nicotiana sylvestris
ref|XP_011096040.1|  PREDICTED: B-cell receptor-associated protei...    199   3e-60   Sesamum indicum [beniseed]
ref|XP_011008025.1|  PREDICTED: uncharacterized protein LOC105113519    198   5e-60   Populus euphratica
gb|ACU19065.1|  unknown                                                 197   5e-60   Glycine max [soybeans]
gb|KJB68573.1|  hypothetical protein B456_010G251300                    198   6e-60   Gossypium raimondii
ref|XP_006348141.1|  PREDICTED: B-cell receptor-associated protei...    196   3e-59   Solanum tuberosum [potatoes]
gb|AFK47348.1|  unknown                                                 196   4e-59   Lotus japonicus
ref|XP_004233786.1|  PREDICTED: uncharacterized protein LOC101255462    196   5e-59   Solanum lycopersicum
ref|XP_004231615.1|  PREDICTED: B-cell receptor-associated protei...    196   5e-59   Solanum lycopersicum
ref|XP_007046390.1|  B-cell receptor-associated 31-like                 194   1e-58   Theobroma cacao [chocolate]
ref|XP_003534595.1|  PREDICTED: B-cell receptor-associated protei...    194   1e-58   Glycine max [soybeans]
gb|KHG10853.1|  B-cell receptor-associated 31                           194   2e-58   Gossypium arboreum [tree cotton]
gb|ACU14586.1|  unknown                                                 194   2e-58   Glycine max [soybeans]
gb|KHG15358.1|  B-cell receptor-associated 31                           194   3e-58   Gossypium arboreum [tree cotton]
gb|KDP20721.1|  hypothetical protein JCGZ_21192                         192   5e-58   Jatropha curcas
gb|KJB69262.1|  hypothetical protein B456_011G013000                    193   6e-58   Gossypium raimondii
ref|XP_010099186.1|  B-cell receptor-associated protein 31              192   6e-58   
ref|XP_008440020.1|  PREDICTED: B-cell receptor-associated protei...    191   3e-57   Cucumis melo [Oriental melon]
ref|XP_006350475.1|  PREDICTED: B-cell receptor-associated protei...    190   6e-57   Solanum tuberosum [potatoes]
gb|KEH36901.1|  B-cell receptor-associated-like protein                 190   1e-56   Medicago truncatula
ref|NP_001236308.1|  uncharacterized protein LOC100526943               190   1e-56   Glycine max [soybeans]
ref|XP_004151895.1|  PREDICTED: uncharacterized protein LOC101218101    189   1e-56   Cucumis sativus [cucumbers]
gb|AFK46642.1|  unknown                                                 189   2e-56   Medicago truncatula
gb|EYU27763.1|  hypothetical protein MIMGU_mgv1a012919mg                189   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_004158560.1|  PREDICTED: uncharacterized LOC101218101            188   3e-56   
ref|XP_008224696.1|  PREDICTED: B-cell receptor-associated protei...    188   4e-56   Prunus mume [ume]
ref|XP_004486174.1|  PREDICTED: B-cell receptor-associated protei...    188   4e-56   
ref|XP_002518447.1|  bcr-associated protein, bap, putative              187   7e-56   Ricinus communis
ref|XP_007212007.1|  hypothetical protein PRUPE_ppa011145mg             186   2e-55   Prunus persica
ref|XP_004134773.1|  PREDICTED: uncharacterized protein LOC101221743    186   3e-55   Cucumis sativus [cucumbers]
gb|KFK40615.1|  hypothetical protein AALP_AA2G019200                    185   8e-55   Arabis alpina [alpine rockcress]
ref|XP_008229967.1|  PREDICTED: B-cell receptor-associated protei...    184   2e-54   Prunus mume [ume]
ref|XP_007215939.1|  hypothetical protein PRUPE_ppa011161mg             184   3e-54   Prunus persica
emb|CDP04423.1|  unnamed protein product                                182   1e-53   Coffea canephora [robusta coffee]
ref|XP_008342021.1|  PREDICTED: B-cell receptor-associated protei...    181   2e-53   
ref|XP_009353295.1|  PREDICTED: B-cell receptor-associated protei...    181   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_010686812.1|  PREDICTED: B-cell receptor-associated protei...    181   4e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008348138.1|  PREDICTED: B-cell receptor-associated protei...    181   4e-53   
ref|XP_008784370.1|  PREDICTED: B-cell receptor-associated protei...    179   1e-52   Phoenix dactylifera
gb|KFK35240.1|  hypothetical protein AALP_AA5G258500                    179   1e-52   Arabis alpina [alpine rockcress]
ref|XP_004293309.1|  PREDICTED: B-cell receptor-associated protei...    179   2e-52   Fragaria vesca subsp. vesca
ref|XP_009347127.1|  PREDICTED: B-cell receptor-associated protei...    178   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_010493468.1|  PREDICTED: uncharacterized protein LOC104770706    177   5e-52   Camelina sativa [gold-of-pleasure]
gb|KHN44866.1|  hypothetical protein glysoja_040795                     177   6e-52   Glycine soja [wild soybean]
ref|XP_003596956.1|  hypothetical protein MTR_2g088060                  177   6e-52   Medicago truncatula
ref|XP_010458605.1|  PREDICTED: uncharacterized protein LOC104739838    177   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006417293.1|  hypothetical protein EUTSA_v10008726mg             177   1e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010476134.1|  PREDICTED: uncharacterized protein LOC104755448    176   2e-51   Camelina sativa [gold-of-pleasure]
ref|NP_849648.4|  B-cell receptor-associated protein 31-like protein    174   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889902.1|  hypothetical protein ARALYDRAFT_334480             174   9e-51   
emb|CDY34821.1|  BnaA09g47470D                                          174   1e-50   Brassica napus [oilseed rape]
ref|XP_009118164.1|  PREDICTED: uncharacterized protein LOC103843216    172   6e-50   Brassica rapa
ref|XP_002320470.1|  hypothetical protein POPTR_0014s15290g             171   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011047243.1|  PREDICTED: B-cell receptor-associated protei...    170   4e-49   Populus euphratica
ref|XP_009419329.1|  PREDICTED: B-cell receptor-associated protei...    169   5e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007147709.1|  hypothetical protein PHAVU_006G148100g             169   8e-49   Phaseolus vulgaris [French bean]
ref|XP_009403539.1|  PREDICTED: uncharacterized protein LOC103987073    169   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780367.1|  PREDICTED: uncharacterized protein LOC103700158    167   4e-48   Phoenix dactylifera
gb|KHN36526.1|  ATP-dependent helicase rhp16                            179   4e-48   Glycine soja [wild soybean]
ref|XP_010533802.1|  PREDICTED: uncharacterized protein LOC104809492    167   8e-48   Tarenaya hassleriana [spider flower]
ref|XP_010546686.1|  PREDICTED: uncharacterized protein LOC104818690    167   8e-48   Tarenaya hassleriana [spider flower]
ref|XP_009390004.1|  PREDICTED: B-cell receptor-associated protei...    166   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008649481.1|  PREDICTED: uncharacterized protein LOC103630179    164   1e-46   Zea mays [maize]
ref|XP_010916117.1|  PREDICTED: uncharacterized protein LOC105041025    162   5e-46   
ref|XP_004287957.1|  PREDICTED: B-cell receptor-associated protei...    162   7e-46   Fragaria vesca subsp. vesca
ref|XP_010926189.1|  PREDICTED: uncharacterized protein LOC105048548    162   8e-46   Elaeis guineensis
ref|XP_008384089.1|  PREDICTED: B-cell receptor-associated protei...    161   1e-45   
ref|XP_006303826.1|  hypothetical protein CARUB_v10012392mg             161   1e-45   Capsella rubella
ref|XP_011086195.1|  PREDICTED: B-cell receptor-associated protei...    161   1e-45   Sesamum indicum [beniseed]
ref|XP_010089483.1|  hypothetical protein L484_011937                   162   2e-45   
emb|CDY34616.1|  BnaC08g41750D                                          160   5e-45   Brassica napus [oilseed rape]
ref|NP_001055067.1|  Os05g0272900                                       159   7e-45   
gb|EMT11422.1|  hypothetical protein F775_31561                         159   7e-45   
dbj|BAK02060.1|  predicted protein                                      158   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006654198.1|  PREDICTED: B-cell receptor-associated protei...    157   3e-44   Oryza brachyantha
ref|XP_009357471.1|  PREDICTED: uncharacterized protein LOC103948199    157   3e-44   Pyrus x bretschneideri [bai li]
ref|NP_001046689.1|  Os02g0321800                                       157   4e-44   
ref|XP_006647215.1|  PREDICTED: B-cell receptor-associated protei...    156   2e-43   Oryza brachyantha
ref|XP_010234160.1|  PREDICTED: uncharacterized protein LOC100839925    155   2e-43   Brachypodium distachyon [annual false brome]
gb|EAY85610.1|  hypothetical protein OsI_06982                          155   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_009358864.1|  PREDICTED: B-cell receptor-associated protei...    155   5e-43   Pyrus x bretschneideri [bai li]
ref|XP_010057913.1|  PREDICTED: B-cell receptor-associated protei...    154   7e-43   Eucalyptus grandis [rose gum]
ref|NP_001170289.1|  LOC100384252                                       154   1e-42   Zea mays [maize]
ref|XP_003580219.1|  PREDICTED: B-cell receptor-associated protei...    152   4e-42   Brachypodium distachyon [annual false brome]
ref|XP_008371075.1|  PREDICTED: B-cell receptor-associated protei...    152   6e-42   
ref|NP_001057612.2|  Os06g0367500                                       150   2e-41   
ref|XP_004952370.1|  PREDICTED: B-cell receptor-associated protei...    150   3e-41   Setaria italica
gb|KHG00718.1|  separin                                                 146   2e-40   Gossypium arboreum [tree cotton]
ref|NP_001154328.1|  B-cell receptor-associated protein 31-like p...    147   3e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86435.1|  predicted protein                                      145   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847259.1|  hypothetical protein AMTR_s00015p00062110          144   3e-39   
ref|XP_003563854.1|  PREDICTED: B-cell receptor-associated protei...    138   1e-36   Brachypodium distachyon [annual false brome]
gb|ADE75913.1|  unknown                                                 135   1e-35   Picea sitchensis
ref|XP_002453641.1|  hypothetical protein SORBIDRAFT_04g009770          135   2e-35   Sorghum bicolor [broomcorn]
gb|AAC17626.1|  Contains similarity to BAP31 protein gb|X81816 fr...    135   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215894.1|  hypothetical protein PRUPE_ppa010667mg             135   2e-35   Prunus persica
ref|XP_008229970.1|  PREDICTED: B-cell receptor-associated protei...    134   8e-35   Prunus mume [ume]
dbj|BAJ87002.1|  predicted protein                                      130   1e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010247234.1|  PREDICTED: B-cell receptor-associated protei...    128   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006650891.1|  PREDICTED: B-cell receptor-associated protei...    127   1e-32   Oryza brachyantha
ref|XP_009802750.1|  PREDICTED: uncharacterized protein LOC104248228    125   1e-32   Nicotiana sylvestris
ref|NP_001051893.1|  Os03g0848400                                       127   2e-32   
gb|EMS49195.1|  hypothetical protein TRIUR3_29235                       125   2e-32   Triticum urartu
ref|XP_006479253.1|  PREDICTED: B-cell receptor-associated protei...    127   2e-32   Citrus sinensis [apfelsine]
gb|EMT32966.1|  hypothetical protein F775_31670                         125   3e-32   
ref|XP_009381320.1|  PREDICTED: B-cell receptor-associated protei...    126   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009599718.1|  PREDICTED: uncharacterized protein LOC104095323    124   3e-32   Nicotiana tomentosiformis
gb|ACN36491.1|  unknown                                                 124   4e-32   Zea mays [maize]
gb|EAY92582.1|  hypothetical protein OsI_14323                          125   7e-32   Oryza sativa Indica Group [Indian rice]
gb|KHG09837.1|  hypothetical protein F383_09194                         125   8e-32   Gossypium arboreum [tree cotton]
ref|XP_006365288.1|  PREDICTED: uncharacterized protein LOC102597522    123   1e-31   Solanum tuberosum [potatoes]
ref|XP_010927692.1|  PREDICTED: B-cell receptor-associated protei...    124   2e-31   Elaeis guineensis
ref|XP_009779153.1|  PREDICTED: B-cell receptor-associated protei...    122   2e-31   Nicotiana sylvestris
gb|EAZ03537.1|  hypothetical protein OsI_25672                          124   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_004248701.1|  PREDICTED: uncharacterized protein LOC101261860    122   3e-31   Solanum lycopersicum
ref|XP_006830526.1|  hypothetical protein AMTR_s00117p00045900          124   4e-31   Amborella trichopoda
ref|XP_002463520.1|  hypothetical protein SORBIDRAFT_01g001290          123   7e-31   Sorghum bicolor [broomcorn]
gb|ACG43219.1|  B-cell receptor-associated protein 31-like contai...    123   7e-31   Zea mays [maize]
ref|XP_009371858.1|  PREDICTED: B-cell receptor-associated protei...    123   7e-31   Pyrus x bretschneideri [bai li]
gb|KJB26033.1|  hypothetical protein B456_004G226500                    122   7e-31   Gossypium raimondii
gb|KJB10919.1|  hypothetical protein B456_001G232500                    122   9e-31   Gossypium raimondii
gb|KJB26032.1|  hypothetical protein B456_004G226500                    122   9e-31   Gossypium raimondii
ref|XP_008380294.1|  PREDICTED: uncharacterized protein LOC103443257    120   1e-30   
ref|XP_006452411.1|  hypothetical protein CICLE_v10009874mg             120   1e-30   Citrus clementina [clementine]
ref|XP_006657620.1|  PREDICTED: B-cell receptor-associated protei...    122   1e-30   Oryza brachyantha
ref|XP_010069636.1|  PREDICTED: B-cell receptor-associated protei...    122   1e-30   Eucalyptus grandis [rose gum]
ref|XP_011095414.1|  PREDICTED: uncharacterized protein LOC105174881    120   2e-30   Sesamum indicum [beniseed]
ref|XP_008809940.1|  PREDICTED: B-cell receptor-associated protei...    122   2e-30   Phoenix dactylifera
ref|NP_001141677.1|  uncharacterized protein LOC100273803 precursor     121   2e-30   
ref|XP_009370674.1|  PREDICTED: B-cell receptor-associated protei...    121   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_003532279.1|  PREDICTED: B-cell receptor-associated protei...    121   3e-30   Glycine max [soybeans]
ref|XP_007049723.1|  B-cell receptor-associated protein 31-like         121   4e-30   Theobroma cacao [chocolate]
ref|XP_008385961.1|  PREDICTED: uncharacterized protein LOC103448478    119   5e-30   
gb|KDO62065.1|  hypothetical protein CISIN_1g045614mg                   117   7e-30   Citrus sinensis [apfelsine]
ref|XP_008226862.1|  PREDICTED: uncharacterized protein LOC103326424    118   8e-30   Prunus mume [ume]
ref|XP_008372494.1|  PREDICTED: B-cell receptor-associated protei...    120   9e-30   Malus domestica [apple tree]
ref|XP_008382607.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-29   
ref|XP_009410623.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-29   
ref|XP_008794596.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-29   Phoenix dactylifera
gb|EYU27354.1|  hypothetical protein MIMGU_mgv1a015673mg                117   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_004981056.1|  PREDICTED: B-cell receptor-associated protei...    119   2e-29   Setaria italica
gb|KDP26363.1|  hypothetical protein JCGZ_17521                         119   2e-29   Jatropha curcas
ref|XP_009361097.1|  PREDICTED: uncharacterized protein LOC103951454    117   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_007140653.1|  hypothetical protein PHAVU_008G130500g             118   3e-29   Phaseolus vulgaris [French bean]
ref|XP_008802267.1|  PREDICTED: B-cell receptor-associated protei...    118   4e-29   Phoenix dactylifera
ref|XP_006452412.1|  hypothetical protein CICLE_v10009874mg             115   8e-29   
ref|XP_003552124.1|  PREDICTED: B-cell receptor-associated protei...    117   1e-28   Glycine max [soybeans]
ref|XP_003562352.1|  PREDICTED: B-cell receptor-associated protei...    117   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_007134124.1|  hypothetical protein PHAVU_010G021100g             117   1e-28   Phaseolus vulgaris [French bean]
ref|XP_002303054.2|  hypothetical protein POPTR_0002s24670g             116   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002266257.2|  PREDICTED: B-cell receptor-associated protei...    116   2e-28   Vitis vinifera
gb|ACG37455.1|  B-cell receptor-associated protein 31-like contai...    115   4e-28   Zea mays [maize]
ref|XP_008460368.1|  PREDICTED: B-cell receptor-associated protei...    115   4e-28   Cucumis melo [Oriental melon]
ref|NP_001136567.1|  uncharacterized LOC100216689 precursor             115   6e-28   Zea mays [maize]
ref|XP_011011172.1|  PREDICTED: uncharacterized protein LOC105115831    114   1e-27   Populus euphratica
ref|XP_010685051.1|  PREDICTED: B-cell receptor-associated protei...    114   1e-27   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP15777.1|  unnamed protein product                                112   1e-27   Coffea canephora [robusta coffee]
ref|XP_004144386.1|  PREDICTED: uncharacterized protein LOC101213598    113   3e-27   Cucumis sativus [cucumbers]
ref|XP_010099686.1|  hypothetical protein L484_025117                   113   3e-27   Morus notabilis
gb|KHN38264.1|  hypothetical protein glysoja_003929                     111   3e-27   Glycine soja [wild soybean]
ref|XP_006281079.1|  hypothetical protein CARUB_v10027107mg             112   7e-27   Capsella rubella
gb|KHN11907.1|  hypothetical protein glysoja_019880                     109   1e-26   Glycine soja [wild soybean]
ref|XP_004295837.1|  PREDICTED: uncharacterized protein LOC101305253    109   2e-26   Fragaria vesca subsp. vesca
ref|XP_004491710.1|  PREDICTED: B-cell receptor-associated protei...    110   3e-26   Cicer arietinum [garbanzo]
gb|KEH22623.1|  B-cell receptor-associated-like protein                 110   3e-26   Medicago truncatula
ref|XP_006452413.1|  hypothetical protein CICLE_v10009874mg             108   3e-26   
gb|KDP39157.1|  hypothetical protein JCGZ_00914                         107   4e-26   Jatropha curcas
ref|XP_010274041.1|  PREDICTED: B-cell receptor-associated protei...    110   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004987306.1|  PREDICTED: uncharacterized protein LOC101775823    108   5e-26   Setaria italica
ref|XP_002521067.1|  bcr-associated protein, bap, putative              111   5e-26   
ref|XP_010552045.1|  PREDICTED: B-cell receptor-associated protei...    110   7e-26   Tarenaya hassleriana [spider flower]
ref|NP_001143481.1|  hypothetical protein                               107   1e-25   Zea mays [maize]
ref|XP_002863915.1|  hypothetical protein ARALYDRAFT_494932             108   1e-25   
ref|XP_004491413.1|  PREDICTED: uncharacterized protein LOC101509893    106   2e-25   Cicer arietinum [garbanzo]
gb|EMS58132.1|  hypothetical protein TRIUR3_00710                       107   4e-25   Triticum urartu
gb|EYU40619.1|  hypothetical protein MIMGU_mgv1a013665mg                107   5e-25   Erythranthe guttata [common monkey flower]
ref|XP_002437063.1|  hypothetical protein SORBIDRAFT_10g020520          105   1e-24   Sorghum bicolor [broomcorn]
ref|XP_007216855.1|  hypothetical protein PRUPE_ppa021600mg             105   1e-24   
emb|CDP03896.1|  unnamed protein product                                106   2e-24   Coffea canephora [robusta coffee]
ref|XP_009151666.1|  PREDICTED: uncharacterized protein LOC103874978    106   2e-24   Brassica rapa
emb|CDX86287.1|  BnaA06g30040D                                          105   2e-24   
emb|CDX85356.1|  BnaC07g26670D                                          105   2e-24   
ref|XP_008674143.1|  PREDICTED: B-cell receptor-associated protei...    106   3e-24   
gb|KDO62066.1|  hypothetical protein CISIN_1g046403mg                   102   3e-24   Citrus sinensis [apfelsine]
ref|XP_008235454.1|  PREDICTED: B-cell receptor-associated protei...    104   7e-24   Prunus mume [ume]
ref|XP_004963921.1|  PREDICTED: B-cell receptor-associated protei...    101   1e-23   
ref|XP_011089080.1|  PREDICTED: uncharacterized protein LOC105170143    103   1e-23   Sesamum indicum [beniseed]
ref|XP_004290194.1|  PREDICTED: B-cell receptor-associated protei...    103   1e-23   Fragaria vesca subsp. vesca
ref|XP_010913045.1|  PREDICTED: B-cell receptor-associated protei...    102   4e-23   Elaeis guineensis
ref|XP_009775442.1|  PREDICTED: uncharacterized protein LOC104225364    102   5e-23   Nicotiana sylvestris
ref|XP_002317336.1|  hypothetical protein POPTR_0011s09140g           99.8    7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009610381.1|  PREDICTED: uncharacterized protein LOC104104089    101   8e-23   Nicotiana tomentosiformis
ref|XP_007020770.1|  F-box family protein with a domain of Unchar...    104   1e-22   
ref|XP_009388739.1|  PREDICTED: uncharacterized protein LOC103975489  98.6    2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006340009.1|  PREDICTED: B-cell receptor-associated protei...    100   3e-22   Solanum tuberosum [potatoes]
ref|XP_011024634.1|  PREDICTED: uncharacterized protein LOC105125752  99.8    5e-22   Populus euphratica
ref|XP_007201384.1|  hypothetical protein PRUPE_ppa012189mg           98.2    8e-22   
ref|XP_004247073.1|  PREDICTED: uncharacterized protein LOC101251810  99.0    8e-22   Solanum lycopersicum
emb|CDY29829.1|  BnaC05g31610D                                        97.1    1e-21   Brassica napus [oilseed rape]
ref|XP_009778813.1|  PREDICTED: uncharacterized protein LOC104228107  95.9    1e-21   Nicotiana sylvestris
ref|XP_006298783.1|  hypothetical protein CARUB_v10014885mg           96.7    1e-21   Capsella rubella
ref|XP_011013138.1|  PREDICTED: uncharacterized protein LOC105117241  96.3    1e-21   Populus euphratica
ref|XP_010063029.1|  PREDICTED: uncharacterized protein LOC104450...  96.7    1e-21   Eucalyptus grandis [rose gum]
ref|XP_009145629.1|  PREDICTED: uncharacterized protein LOC103869321  95.5    3e-21   Brassica rapa
ref|XP_010464329.1|  PREDICTED: uncharacterized protein LOC104744901  97.4    4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006409380.1|  hypothetical protein EUTSA_v10022940mg           94.0    4e-21   
ref|XP_010488019.1|  PREDICTED: uncharacterized protein LOC104765923  95.1    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010508923.1|  PREDICTED: uncharacterized protein LOC104785412  94.7    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010466234.1|  PREDICTED: uncharacterized protein LOC104746450  94.7    7e-21   Camelina sativa [gold-of-pleasure]
gb|EPS57633.1|  hypothetical protein M569_17183                       96.3    8e-21   Genlisea aurea
ref|XP_010493705.1|  PREDICTED: B-cell receptor-associated protei...  95.9    1e-20   Camelina sativa [gold-of-pleasure]
gb|EPS63018.1|  hypothetical protein M569_11771                       94.4    1e-20   Genlisea aurea
emb|CDY51050.1|  BnaA02g30380D                                        94.7    3e-20   Brassica napus [oilseed rape]
ref|XP_009129743.1|  PREDICTED: uncharacterized protein LOC103854553  94.7    3e-20   Brassica rapa
ref|XP_008455897.1|  PREDICTED: B-cell receptor-associated protei...  91.7    4e-20   Cucumis melo [Oriental melon]
ref|XP_004142754.1|  PREDICTED: uncharacterized protein LOC101213037  92.0    4e-20   
ref|NP_566662.1|  B-cell receptor-associated protein 31-like protein  92.0    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395148.1|  hypothetical protein EUTSA_v10004894mg           94.0    6e-20   Eutrema salsugineum [saltwater cress]
emb|CDY66080.1|  BnaCnng49520D                                        94.0    7e-20   Brassica napus [oilseed rape]
ref|NP_199677.1|  B-cell receptor-associated protein 31-like protein  93.6    7e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39354.1|  hypothetical protein AALP_AA3G233700                  91.7    7e-20   Arabis alpina [alpine rockcress]
ref|XP_006406381.1|  hypothetical protein EUTSA_v10021737mg           91.7    8e-20   Eutrema salsugineum [saltwater cress]
gb|AAM67164.1|  unknown                                               91.3    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458888.1|  PREDICTED: uncharacterized protein LOC103498158  90.5    2e-19   Cucumis melo [Oriental melon]
ref|XP_007142305.1|  hypothetical protein PHAVU_008G269400g           91.7    2e-19   Phaseolus vulgaris [French bean]
ref|XP_002862714.1|  hypothetical protein ARALYDRAFT_497321           89.0    9e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_002885374.1|  hypothetical protein ARALYDRAFT_479569           89.0    9e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_009795272.1|  PREDICTED: uncharacterized protein LOC104241998  90.5    2e-18   Nicotiana sylvestris
gb|KDP22731.1|  hypothetical protein JCGZ_01833                       89.7    3e-18   Jatropha curcas
ref|XP_010545515.1|  PREDICTED: uncharacterized protein LOC104817861  87.4    3e-18   
gb|KFK38172.1|  hypothetical protein AALP_AA3G078300                  89.0    4e-18   
ref|XP_009616881.1|  PREDICTED: uncharacterized protein LOC104109325  89.7    5e-18   
gb|AFW70952.1|  hypothetical protein ZEAMMB73_233499                  86.7    7e-18   
ref|XP_002884632.1|  hypothetical protein ARALYDRAFT_478041           88.2    8e-18   
ref|XP_010666200.1|  PREDICTED: uncharacterized protein LOC104883381  86.3    1e-17   
gb|EMS47744.1|  hypothetical protein TRIUR3_06470                     88.2    1e-17   
gb|EMT23366.1|  hypothetical protein F775_19324                       87.4    3e-17   
ref|XP_010486262.1|  PREDICTED: B-cell receptor-associated protei...  86.3    4e-17   
ref|XP_010449720.1|  PREDICTED: B-cell receptor-associated protei...  86.3    4e-17   
ref|XP_008467068.1|  PREDICTED: uncharacterized protein LOC103504505  84.3    4e-17   
ref|XP_002529922.1|  bcr-associated protein, bap, putative            84.0    2e-16   
ref|NP_187375.1|  B-cell receptor-associated protein 31-like protein  83.2    4e-16   
ref|XP_006407860.1|  hypothetical protein EUTSA_v10021483mg           82.4    9e-16   
emb|CBI29413.3|  unnamed protein product                              80.5    1e-15   
gb|ACU15885.1|  unknown                                               79.0    3e-15   
emb|CBI28815.3|  unnamed protein product                              75.9    2e-14   
ref|XP_007212356.1|  hypothetical protein PRUPE_ppa014571mg           71.6    7e-13   
ref|XP_003617596.1|  hypothetical protein MTR_5g093360                71.6    1e-12   
ref|XP_006443576.1|  hypothetical protein CICLE_v100221651mg          69.7    7e-12   
ref|XP_010096876.1|  hypothetical protein L484_008070                 67.4    2e-11   
gb|EMT13188.1|  hypothetical protein F775_28124                       68.9    2e-11   
gb|EYU39202.1|  hypothetical protein MIMGU_mgv1a024213mg              64.3    1e-09   
ref|XP_006375656.1|  hypothetical protein POPTR_0014s18880g           62.4    3e-09   
emb|CAN62540.1|  hypothetical protein VITISV_031161                   61.6    6e-09   
ref|XP_006342256.1|  PREDICTED: uncharacterized protein LOC102584894  62.4    1e-08   
ref|XP_010063030.1|  PREDICTED: uncharacterized protein LOC104450...  59.7    1e-08   
ref|XP_010466235.1|  PREDICTED: uncharacterized protein LOC104746451  60.1    2e-08   
emb|CDX71552.1|  BnaC04g17870D                                        57.0    6e-08   
gb|KJB13716.1|  hypothetical protein B456_002G090900                  57.4    2e-07   
ref|XP_006375655.1|  hypothetical protein POPTR_0014s18870g           57.0    2e-07   
ref|XP_004240151.1|  PREDICTED: uncharacterized protein LOC101249367  58.2    4e-07   
gb|AFW71006.1|  hypothetical protein ZEAMMB73_389553                  55.1    7e-07   
ref|XP_006443575.1|  hypothetical protein CICLE_v100221652mg          54.7    8e-07   
ref|XP_006479254.1|  PREDICTED: B-cell receptor-associated protei...  55.1    1e-06   
gb|KJB13713.1|  hypothetical protein B456_002G090600                  54.3    2e-06   
gb|AFW77085.1|  hypothetical protein ZEAMMB73_955327                  52.0    7e-06   
ref|NP_001175145.1|  Os07g0291200                                     52.8    7e-06   
ref|XP_008646901.1|  PREDICTED: uncharacterized protein LOC103628485  50.8    2e-05   
ref|XP_008353105.1|  PREDICTED: uncharacterized protein LOC103416652  48.5    2e-04   



>ref|XP_009610364.1| PREDICTED: uncharacterized protein LOC104104077 [Nicotiana tomentosiformis]
Length=219

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EM++ILL LFKTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+Q
Sbjct  11   VVFLEMSLILLFLFKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQ  70

Query  398  SRPLESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
            SRP +++NPTDQ+LLA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEAAKK DR
Sbjct  71   SRPTDTVNPTDQILLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAAKKQDR  130

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
              DNGKNG   E ++LK+EI+S+++K+++LESE EAK +EVK+QK NS+S KGQSEKLLL
Sbjct  131  ALDNGKNG---EASNLKDEISSLRNKVRQLESENEAKEKEVKSQKANSDSLKGQSEKLLL  187

Query  38   EYGQLLEENQHL  3
            EY +LLEENQ+L
Sbjct  188  EYDRLLEENQNL  199



>ref|XP_009795967.1| PREDICTED: uncharacterized protein LOC104242589 [Nicotiana sylvestris]
Length=219

 Score =   262 bits (670),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 169/192 (88%), Gaps = 3/192 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EM++ILL LFKTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+Q
Sbjct  11   VVFLEMSLILLFLFKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQ  70

Query  398  SRPLESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
            SRP +++NPTDQ+LLA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEA KK DR
Sbjct  71   SRPTDTVNPTDQILLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAVKKQDR  130

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
              DNGKNG   E ++LK+EI+S+++K+++LES+ EAK +EVK+QK NS+S KGQSEKLLL
Sbjct  131  ALDNGKNG---EASNLKDEISSLRNKVRQLESDNEAKEKEVKSQKANSDSLKGQSEKLLL  187

Query  38   EYGQLLEENQHL  3
            EY +LLEENQ+L
Sbjct  188  EYDRLLEENQNL  199



>emb|CDP10783.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMAVILLLLFKTPLRKL I++LDR KRG GPLVVKSV ATV V+M Y+VY+++E+
Sbjct  7    TVIFCEMAVILLLLFKTPLRKLEIMALDRVKRGSGPLVVKSVGATVLVMMTYSVYTIREL  66

Query  401  QSRPLESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHD  222
             SRP+ES NPTDQVLLA ++L  SLMGF LFL+LMIDRLHHYIRELR+LRK MEAAKK  
Sbjct  67   NSRPVESFNPTDQVLLAYEVLDTSLMGFSLFLALMIDRLHHYIRELRILRKTMEAAKKQS  126

Query  221  RGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL  42
            R  D GK     EVN+LKEE+ +MK+ I  LESEC+AK +E+KA + NSES K QSE LL
Sbjct  127  REVDEGKKANGAEVNALKEEVTAMKTMINILESECKAKEKELKAAESNSESLKKQSEGLL  186

Query  41   LEYGQLLEENQHL  3
            LEY +LLE+NQ L
Sbjct  187  LEYDRLLEDNQSL  199



>ref|XP_004251523.1| PREDICTED: uncharacterized protein LOC101250189 [Solanum lycopersicum]
Length=219

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EM +IL+ LF+TPLRKL+I+SLDR KRG GPL+VKSVAATV V+MIYTVYS++E+Q
Sbjct  11   VVFLEMGLILMFLFRTPLRKLIIMSLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQ  70

Query  398  SRPLESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
            SRP +S+NPTDQ+LLA QIL+A+LMGF LFL LMIDRLHHYIRELRLLRK MEA KK DR
Sbjct  71   SRPADSVNPTDQILLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRKTMEAVKKQDR  130

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
              DN KNG   E ++L++EI+S+++++K+LESE EAK +EV++Q+ NS+S KGQSEKLLL
Sbjct  131  TLDNIKNG---EASTLRDEISSLRNRMKQLESESEAKEKEVQSQRANSDSLKGQSEKLLL  187

Query  38   EYGQLLEENQHL  3
            EY ++LEENQ+L
Sbjct  188  EYDRILEENQNL  199



>ref|XP_006351969.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=219

 Score =   236 bits (602),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EM +IL+ LF+TPLRKL+I++LDR KRG GPL+VKSVAATV V+MIYTVYS++E+Q
Sbjct  11   VVFLEMGLILMFLFRTPLRKLIIMTLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQ  70

Query  398  SRPLESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
            SRP +S+NPTDQ+LLA QIL+A+LMGF LFL LMIDRLHHYIRELRLLR+ MEA KK DR
Sbjct  71   SRPADSVNPTDQILLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRRTMEAVKKQDR  130

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
              DN KNG   E ++L++EI+S+++K+K+LESE EAK EEV++Q+ NS+S KGQSEKLLL
Sbjct  131  TLDNIKNG---EASTLRDEISSLRNKMKQLESESEAKEEEVQSQRANSDSLKGQSEKLLL  187

Query  38   EYGQLLEENQHL  3
            EY ++LEENQ+L
Sbjct  188  EYDRILEENQNL  199



>ref|XP_010549208.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
 ref|XP_010549209.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=218

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 165/195 (85%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F E+A+I+ LLFKTPLRKL+I++LDR KRGRGP+VVK++A TVFV+++ +VYS+ +I
Sbjct  7    TVIFAEVALIMTLLFKTPLRKLVIMTLDRIKRGRGPVVVKTIATTVFVVLLSSVYSILKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q   +ES  ++PTDQ+L+A+ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRGSVESGVLSPTDQILMAKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GKN   EEV +L EE+A++K+KIK+LESECE KG+E+K+ +  +E+ + Q++ 
Sbjct  127  QNRGFEDGKNASAEEVKALGEEVAALKAKIKRLESECETKGKELKSAQAETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>ref|XP_003605958.1| hypothetical protein MTR_4g049540 [Medicago truncatula]
 gb|AES88155.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK41440.1| unknown [Medicago truncatula]
Length=221

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 156/195 (80%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  FGEM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFGEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK
Sbjct  67   QQRTVEAGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QTRSFEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>gb|AFK33681.1| unknown [Medicago truncatula]
Length=221

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 155/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  FGEM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFGEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK
Sbjct  67   QQRTVEAGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QTRSFEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
              LEY +LLE+NQ+L
Sbjct  187  FFLEYDRLLEDNQNL  201



>ref|XP_010244479.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=222

 Score =   226 bits (575),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 163/196 (83%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EMA+ILL LFKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+++ +VYS+ +I
Sbjct  7    TIIFSEMALILLFLFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVFVVLLSSVYSMMKI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +++   +NPTDQVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK MEA K
Sbjct  67   QKRSMDAAVVVNPTDQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKGMEAIK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RGF++GKNG  EE  +L+EE+A+++ K+K+LESECE + +E+K  + N+ + + QSE
Sbjct  127  KQNRGFEDGKNGVAEETKALEEEMANLRGKVKQLESECEVQTKELKTAEANTVALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
             +LLEY +L+E+NQ+L
Sbjct  187  GILLEYDRLMEDNQNL  202



>ref|XP_010252455.1| PREDICTED: uncharacterized protein LOC104594039 [Nelumbo nucifera]
Length=222

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 163/196 (83%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EMA+ILL LFKTPLRKL+I+ LDR KRGRGP++VK+V  T+ V+++ +VYS+ +I
Sbjct  7    TLIFAEMALILLFLFKTPLRKLIIMGLDRVKRGRGPVMVKTVCGTILVVLLSSVYSMTKI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q+R ++S   +NPTDQVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK+MEA K
Sbjct  67   QNRSMDSAGIVNPTDQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKSMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RGF++GKNGG E+  +L+EE AS+++K+K+LES+ EAK +E KA + N+E+ K QSE
Sbjct  127  KQNRGFEDGKNGGPEDTKALEEERASLRAKVKELESKFEAKTKETKAAEANAEALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLE+NQ L
Sbjct  187  GFLLEYDRLLEDNQSL  202



>ref|XP_002270301.1| PREDICTED: B-cell receptor-associated protein 31-like [Vitis 
vinifera]
Length=214

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 164/195 (84%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I+ LLFKTPLRKL++++LDR KRGRGP++ ++VA TVFV+++ +VYS+ +I
Sbjct  7    TVIFAEMALIMTLLFKTPLRKLVVMALDRVKRGRGPIMAQTVATTVFVVLMSSVYSMMKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q+R +E   INPTDQVL+A+ +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRKAMEA KK
Sbjct  67   QNRSVEPGLINPTDQVLMARHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKAMEAEKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GKNG  EE  ++ EE++S++++IKKLESECE K +E +A + N+ + K QSE 
Sbjct  127  QNRGFEDGKNGRAEEAKAMGEEMSSLRTQIKKLESECETKAKEAEAAEANTVALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  187  FLLEYDRLLEENQNL  201



>gb|ACJ84514.1| unknown [Medicago truncatula]
Length=221

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 155/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  FGEM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFGEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK  EA KK
Sbjct  67   QQRTVEAGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTTEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QTRSFEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>gb|KHN41234.1| hypothetical protein glysoja_017278 [Glycine soja]
Length=213

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 154/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFFEMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLMVVLASSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK
Sbjct  67   QQRTLEAGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG +EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QSRSFEDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ L
Sbjct  187  FLMEYDRLLEDNQSL  201



>ref|XP_010689493.1| PREDICTED: B-cell receptor-associated protein 31 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 155/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMAVILLLLF+TPLRKL+I+ LDR KRGRGP+V+ +V  T+ VL++ T+ ++  I
Sbjct  7    SVIFMEMAVILLLLFRTPLRKLVILGLDRMKRGRGPIVITTVGGTILVLLVTTISTIVNI  66

Query  401  QSRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R +E  +INPTDQ+L  + +L ASLMGF+LFL LM+DRLHHYIRELRLLRK MEA KK
Sbjct  67   QQRDIEPGTINPTDQILFTRSLLDASLMGFILFLGLMMDRLHHYIRELRLLRKTMEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R FD+ KNG  EE+ +++EE+A++KS+IK +ESEC AK +E+KA +  SE+ K QSE 
Sbjct  127  QNRSFDDAKNGSSEELKAMEEEVATLKSRIKTMESECVAKTDEIKASESKSEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LLE+NQ L
Sbjct  187  LLLEYDRLLEDNQSL  201



>ref|NP_001239654.1| uncharacterized protein LOC100798727 [Glycine max]
 gb|ACU21248.1| unknown [Glycine max]
Length=213

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 154/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFFEMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK
Sbjct  67   QQRTLEAGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG +EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QSRSFEDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ L
Sbjct  187  FLMEYDRLLEDNQSL  201



>ref|XP_006403381.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
 gb|ESQ44834.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
Length=218

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 161/195 (83%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  I
Sbjct  7    SVLFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSI  66

Query  401  QSRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +  ++NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAALNPTDQVLASKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GKN   EEV +L EEIA++KSKI KLESE E+KG+E+K  +  +E+ + Q++ 
Sbjct  127  QNRGFEDGKNTSGEEVKALVEEIAALKSKIGKLESESESKGKELKGARAETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>emb|CBI23212.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I
Sbjct  7    TVIFAEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R ++   +NPTDQVL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK
Sbjct  67   RKRGIDDDVVNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK GG  E+ +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE 
Sbjct  127  QNRGFEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  187  FLLEYDRLLEENQNL  201



>ref|XP_003539858.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 152/195 (78%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFSEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK
Sbjct  67   QQRTLEAGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QSRSFEDGKNGNSEEHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ L
Sbjct  187  FLMEYDRLLEDNQSL  201



>ref|XP_002262807.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=248

 Score =   220 bits (560),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I
Sbjct  34   TVIFAEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKI  93

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R ++   +NPTDQVL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK
Sbjct  94   RKRGIDDDVVNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKK  153

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK GG  E+ +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE 
Sbjct  154  QNRGFEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEG  213

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  214  FLLEYDRLLEENQNL  228



>gb|KHN21219.1| hypothetical protein glysoja_006698 [Glycine soja]
Length=221

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 152/195 (78%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFSEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK
Sbjct  67   QQRTLEAGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE 
Sbjct  127  QSRSFEDGKNGNSEEHKALNEEITALKSKIKKLESECEAKGSQAKTLETEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ L
Sbjct  187  FLMEYDRLLEDNQSL  201



>ref|XP_004506274.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=221

 Score =   219 bits (557),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 153/195 (78%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFIEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLVVVLSSSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R +E+  INPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK MEA KK
Sbjct  67   QQRTIEAGIINPTDQVLMSKHMLEASLMGFMLFLSLMIDRLHHYIRELRLLRKTMEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L EEI ++KSK+K LESECE+KG + K      E+ K QSE 
Sbjct  127  QTRSFEDGKNGNTEEQKALAEEITTLKSKVKMLESECESKGNKEKTLHTEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>ref|XP_009123682.1| PREDICTED: uncharacterized protein LOC103848551 [Brassica rapa]
 emb|CDY02396.1| BnaA02g23050D [Brassica napus]
Length=218

 Score =   218 bits (556),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 159/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV++I +VYS+  I
Sbjct  7    SVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLISSVYSLLSI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R F++GKN   EEV +L EEIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++ 
Sbjct  127  QNRSFEDGKNTNGEEVKALGEEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>ref|NP_568607.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
 gb|AAK96684.1| Unknown protein [Arabidopsis thaliana]
 gb|ABD43004.1| At5g42570 [Arabidopsis thaliana]
 gb|AED94830.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
Length=218

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  I
Sbjct  7    TVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++ 
Sbjct  127  QNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>ref|XP_002863762.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40021.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVF++++ ++YS+ +I
Sbjct  7    TVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGITVFIVLLSSIYSLVKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKYLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GKN   EEV ++ EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++ 
Sbjct  127  QNRGFEDGKNTSGEEVKAIGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>gb|AAM62748.1| unknown [Arabidopsis thaliana]
Length=218

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  I
Sbjct  7    TVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + QS+ 
Sbjct  127  QNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQSDG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+N++L
Sbjct  187  FLMEYDRLLEDNRNL  201



>ref|XP_006447584.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 ref|XP_006469667.1| PREDICTED: B-cell receptor-associated protein 31-like [Citrus 
sinensis]
 gb|ESR60824.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 gb|KDO54706.1| hypothetical protein CISIN_1g027898mg [Citrus sinensis]
Length=217

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F +MA+I+ LLFKTPLRKL+I+SLDR KRGRGP+VVK+V  T+F++++ +VYS+ +I
Sbjct  7    TVIFSQMALIMTLLFKTPLRKLVIMSLDRVKRGRGPVVVKTVGGTLFIVLMSSVYSILKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQ+L+++ +L+ASLMGF+LFLSLM+DRLHHYIRELRLLRKAMEAAKK
Sbjct  67   QQRTLETGALNPTDQILMSKHMLEASLMGFLLFLSLMMDRLHHYIRELRLLRKAMEAAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKN  V+E   L ++IA++K+KIKKLESECE K +E  A K  +E+ K QSE 
Sbjct  127  QTRSFEDGKNDNVDERKGLGDDIATLKTKIKKLESECEMKDKEANAAKAEAEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LL +NQHL
Sbjct  187  FLLEYDRLLADNQHL  201



>gb|KFK32917.1| hypothetical protein AALP_AA6G305900 [Arabis alpina]
Length=218

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ ++YS+  I
Sbjct  7    TVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLMSSLYSLLNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GKN   EEV +L EEIA++K+K KKLES+ E+KG+E+K+ +  +E+ + Q++ 
Sbjct  127  QNRGFEDGKNTSGEEVKALGEEIAALKAKNKKLESDSESKGKELKSAQAETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>dbj|BAB09328.1| unnamed protein product [Arabidopsis thaliana]
Length=252

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  I
Sbjct  7    TVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++ 
Sbjct  127  QNRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>ref|XP_007132530.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
 gb|ESW04524.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
Length=212

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 149/195 (76%), Gaps = 3/195 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKT LRKL+IISLDR KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFSEMLLILTLVFKTSLRKLVIISLDRVKRGRGPIVVSTVGATLVVVLSSSLYSMTKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK  E  KK
Sbjct  67   QQRTLEAGILNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRLLRKTNEVIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GKNG  EE  +L  EIA++KSKIKKLESECE KG E K  +   E  K QSE 
Sbjct  127  QSRSFEDGKNGNAEEQKTLT-EIATLKSKIKKLESECETKGNEAKTLETEVEVLKKQSEG  185

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ L
Sbjct  186  FLMEYDRLLEDNQSL  200



>ref|XP_006281077.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
 gb|EOA13975.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
Length=218

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 157/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ D+ KRGRGP+VVK++  TVFV+++ +VYS+  I
Sbjct  7    SVIFSEMALILLLLFKTPLRKLIILTFDKIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEI ++K+KIK LESE E+KG+E+K  K  +E+ + Q++ 
Sbjct  127  QNRGFEDGKTTSGEEVKALGEEIVALKTKIKTLESESESKGKELKGAKGETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>ref|XP_010494193.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 157/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I
Sbjct  7    SVIFSEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLINI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   RRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++ 
Sbjct  127  QNRGFEDGKTTSGEEVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>emb|CDY68895.1| BnaCnng60970D [Brassica napus]
Length=218

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  I
Sbjct  7    SVIFAEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   QRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R F++GKN   EEV +L  EIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++ 
Sbjct  127  QNRSFEDGKNTNGEEVKALGGEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LLE+NQ+L
Sbjct  187  FLMEYDRLLEDNQNL  201



>ref|XP_003540294.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 151/195 (77%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
             V FGEM VI   LFKTP RKL+II+LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I
Sbjct  7    AVIFGEMFVIASFLFKTPARKLVIITLDRVKRGRGPVVVKTVAATLLVVLASSLYSIAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R L++  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK
Sbjct  67   RRRNLDAPVVNPTDQVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GK+    E  +L EE A +K KI+KLESECE +  + KA +   E+ + QSE 
Sbjct  127  QSRSFEDGKSVSAAEHKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LL +NQ+L
Sbjct  187  FLMEYDRLLADNQNL  201



>ref|XP_010481979.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 157/195 (81%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ +VY +  I
Sbjct  7    SVIFSEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLLSSVYGLVNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME+AKK
Sbjct  67   RRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMESAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++ 
Sbjct  127  QNRGFEDGKTKSGEEVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protein 31 [Nicotiana tomentosiformis]
Length=222

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 153/196 (78%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EMA+I++ +FKTPLRKL+I+ LDR KRGRGP++VK+VA T+FV+M+ T+YS+  I
Sbjct  7    TLIFAEMALIVIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTLFVVMLSTIYSIASI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            ++R ++    I PTDQ+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA K
Sbjct  67   RTRWMDEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +R F++GK+G  EE+ +L+EE ++++ KIK+LESE + K +E    + N+ + K QSE
Sbjct  127  KQNRAFEDGKSGASEEIKTLEEEASALRGKIKQLESELQEKAKEASGAEANAVALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|XP_010442176.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 156/195 (80%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I
Sbjct  7    SVIFSEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R  +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   RRRSEDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RGF++GK    EEV +L EEIA +K+KIK +ESE + KG+E+K  K  +E+ + Q+++
Sbjct  127  QNRGFEDGKTTSGEEVKALGEEIAVLKAKIKTVESESDGKGKELKEAKGETEALRKQADE  186

Query  47   LLLEYGQLLEENQHL  3
             L EY +LLE+NQ+L
Sbjct  187  FLKEYDRLLEDNQNL  201



>ref|XP_007149980.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
 gb|ESW21974.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
Length=221

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F +M VI+  LFKTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +IQ
Sbjct  8    VIFAQMFVIVSFLFKTPARKLVILTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R L++  +NPTDQVL+++  L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEAAKK 
Sbjct  68   RRSLDASVVNPTDQVLVSKHTLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAAKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
             R F++GK+    E  +L EEI+  K++++KLESECE K  + K  +   E+ + QSE  
Sbjct  128  SRSFEDGKSVSAAEHKALVEEISGFKAEVEKLESECEVKASKAKTLEAEVEALRKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+EY +LLE+NQ+L
Sbjct  188  LMEYDRLLEDNQNL  201



>ref|XP_006449764.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
 gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
Length=223

 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 152/197 (77%), Gaps = 4/197 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  I
Sbjct  7    TVMFSEMALIIVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMII  66

Query  401  QSRPLES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA  234
            Q R ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA 
Sbjct  67   QKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAI  126

Query  233  KKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQS  54
            K   RGF++GK  G EE+ +L++++ ++KSK+K+LESE E K +E  A + N+ + + QS
Sbjct  127  KNQSRGFEDGKAAGSEEIKALEDQMTTLKSKLKELESELETKSKEANAAETNAVALRKQS  186

Query  53   EKLLLEYGQLLEENQHL  3
            E  L EY +LLEENQ+L
Sbjct  187  EGFLFEYDRLLEENQNL  203



>ref|XP_003543392.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 149/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
             V F EM VI+  LFKTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I
Sbjct  7    AVIFAEMFVIVSFLFKTPARKLVIVTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R L++   NPTDQVL+ + +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK
Sbjct  67   RHRNLDAPVANPTDQVLVYKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F+ GK+    E  +L EEIA +K KI+KLESECE +  + KA +   E+ + QSE 
Sbjct  127  QSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLESECEMEASKAKALETEVEALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LL +NQ+L
Sbjct  187  FLMEYDRLLADNQNL  201



>ref|XP_007026129.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY28751.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=221

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EMAVI++L FKTPLRKL+I+ LDR KRGRGP++VK+VA TV V+M+ +VYS+ +IQ
Sbjct  8    VVFSEMAVIVVLSFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVSVVMMSSVYSMMKIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R ++  + NPTDQVL+A+ +L+A+LMG  LFL+LMIDRLHHYIRELRL RK MEAAKK 
Sbjct  68   KRWIDDGAANPTDQVLMAKHLLEATLMGASLFLALMIDRLHHYIRELRLRRKNMEAAKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
             RGF++ K GG  EV +L+EE+ +++ K K+LES+ E K +E+ A + N+ + + QSE  
Sbjct  128  GRGFEDVKPGGSNEVKALEEEVTALREKFKQLESDLETKTKEMNAAEANAVALRKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            LLEY +LLEENQ+L
Sbjct  188  LLEYDRLLEENQNL  201



>gb|KDO78297.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=223

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  I
Sbjct  7    TVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMI  66

Query  401  QSRPLES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA  234
            Q R ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA 
Sbjct  67   QKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAI  126

Query  233  KKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQS  54
            K   RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QS
Sbjct  127  KNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQS  186

Query  53   EKLLLEYGQLLEENQHL  3
            E  L EY +LLEENQ+L
Sbjct  187  EGFLFEYDRLLEENQNL  203



>ref|XP_011046959.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=219

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 155/196 (79%), Gaps = 6/196 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILL +FK+P+RK LI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +I
Sbjct  7    TVIFSEMAMILLFVFKSPIRKFLIMSLDRLKRGRGPVMVKTVAGTVFVVLMSSVYSMVKI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R ++    +NPTDQVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA K
Sbjct  67   QKRGIDVGGVVNPTDQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +R F++GK   VEE  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE
Sbjct  127  KQNRSFEDGK---VEETKALETEVSTLQEKLKQLQSELEVKTKEVNTSEANAIALSKQSE  183

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  184  GFLLEYDRLLEENQNL  199



>ref|XP_006467408.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X2 [Citrus sinensis]
Length=223

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  I
Sbjct  7    TVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMII  66

Query  401  QSRPLES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA  234
            Q R ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA 
Sbjct  67   QKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAI  126

Query  233  KKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQS  54
            K   RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QS
Sbjct  127  KNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQS  186

Query  53   EKLLLEYGQLLEENQHL  3
            E  L EY +LLEENQ+L
Sbjct  187  EGFLFEYDRLLEENQNL  203



>ref|XP_010046363.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW88772.1| hypothetical protein EUGRSUZ_A01117 [Eucalyptus grandis]
Length=221

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 154/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV   EMA+IL LLFKTPLRKL+I++LDR KRGRGP++VK+V  T+ V++  ++YS+ +I
Sbjct  7    TVIAAEMALILTLLFKTPLRKLVIMALDRVKRGRGPVMVKTVGVTLLVVLASSLYSMVKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLM+DRLHHYIRELRLLRK MEAAKK
Sbjct  67   QRRTVEAGLLNPTDQVLMSKHMLEASLMGFVLFLSLMLDRLHHYIRELRLLRKTMEAAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              RG D GKNG  EEV  LKEEIA++++K+ KLE+E   K +E K  +  +E+ K QSE 
Sbjct  127  QSRGIDEGKNGSAEEVKGLKEEIATLRTKLNKLENEYGTKDKEAKTAEAEAEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LL +NQ L
Sbjct  187  LLLEYDRLLADNQSL  201



>ref|XP_006467407.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
Length=242

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  I
Sbjct  7    TVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMII  66

Query  401  QSRPLES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA  234
            Q R ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA 
Sbjct  67   QKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAI  126

Query  233  KKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQS  54
            K   RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QS
Sbjct  127  KNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQS  186

Query  53   EKLLLEYGQLLEENQHL  3
            E  L EY +LLEENQ+L
Sbjct  187  EGFLFEYDRLLEENQNL  203



>ref|XP_002524828.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF37548.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=209

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            I+SLDR KRGRGP++VK+V  TVFV+++ +VYS+ +IQ+R +E  ++NPTDQVL+++ +L
Sbjct  18   IMSLDRVKRGRGPVMVKTVGGTVFVVLLSSVYSMVKIQNRTIEGGAVNPTDQVLMSKHML  77

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMGFVLFLSLMIDRLHHYIRELR+LRK MEAAKK  RGF++GKNG  +E  +L EE+
Sbjct  78   EASLMGFVLFLSLMIDRLHHYIRELRILRKTMEAAKKQSRGFEDGKNGSADEAKALGEEV  137

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             ++++KIK LES+ E K +E KA +   E+ + QSE  L+EYG+LLE+NQ+L
Sbjct  138  KTLQNKIKYLESKFEEKAKEAKAAEAEVEALRKQSEVFLIEYGRLLEDNQNL  189



>ref|XP_006383887.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
 gb|ERP61684.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
Length=219

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 154/195 (79%), Gaps = 6/195 (3%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EMA+ILL +FK+PLRK LI+SLDR KRGRGP++VK+VA TVF+++I +VYS+ +IQ
Sbjct  8    VIFSEMAMILLFVFKSPLRKFLIMSLDRLKRGRGPVMVKTVAGTVFLVLISSVYSMVKIQ  67

Query  398  SRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             R ++    +NPTDQVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK
Sbjct  68   KRGIDVGGVVNPTDQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R F++GK   VEE  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE 
Sbjct  128  QNRSFEDGK---VEETKALETEVSTLQEKLKQLQSELEVKSKEVNTSEANAAALSKQSEG  184

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  185  FLLEYDRLLEENQNL  199



>gb|KDO78296.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=308

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  I
Sbjct  7    TVMFSEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMI  66

Query  401  QSRPLES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA  234
            Q R ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA 
Sbjct  67   QKRWIDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAI  126

Query  233  KKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQS  54
            K   RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QS
Sbjct  127  KNQSRGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQS  186

Query  53   EKLLLEYGQLLEENQHL  3
            E  L EY +LLEENQ+L
Sbjct  187  EGFLFEYDRLLEENQNL  203



>ref|XP_009629450.1| PREDICTED: uncharacterized protein LOC104119606 [Nicotiana tomentosiformis]
Length=221

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+I++ +FKTPLRKL+I+ LDR KRGRGP+VVK++  T+FV+M+ T+YSV  I
Sbjct  7    SVIFAEMALIVMFVFKTPLRKLVIMGLDRIKRGRGPIVVKTIGGTIFVVMLSTIYSVVSI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            + R ++   +I PTDQ+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  
Sbjct  67   RKRWIDEDGNITPTDQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRIRRKSMEAVN  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RGF++GKNG  +++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE
Sbjct  127  KQNRGFEDGKNGACDDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
               LE   LLE+NQ+L
Sbjct  187  NFGLENDSLLEDNQNL  202



>ref|XP_006389583.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
 gb|ABK95443.1| unknown [Populus trichocarpa]
 gb|ERP48497.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
Length=219

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 153/196 (78%), Gaps = 6/196 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILL +FKTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +I
Sbjct  7    TVIFSEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R ++   ++NPTDQVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  K
Sbjct  67   QKRWIDDGGAVNPTDQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRMRRKTMEDVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +R F++GK   VEE  +L+ E ++++ K+K+LESE E K +EV   + N+ +   QSE
Sbjct  127  KQNRSFEDGK---VEETKALEAEASTLREKLKQLESELEIKTKEVNTSEANAVALSKQSE  183

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  184  GFLLEYDRLLEENQNL  199



>ref|XP_009797812.1| PREDICTED: uncharacterized protein LOC104244159 [Nicotiana sylvestris]
Length=220

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            +V F EMA+I+L +FKTPLRK++I+ LDR KRGRGP+VVK++  T+F++M+ T+YSV  I
Sbjct  7    SVIFAEMALIVLFVFKTPLRKVVIMGLDRIKRGRGPIVVKTIGGTIFMVMLSTIYSVVSI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            + R ++   +I PTDQ+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  
Sbjct  67   RKRWIDEDGNITPTDQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRMRRKSMEAVN  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RGF++GKNG  +++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE
Sbjct  127  KQNRGFEDGKNGASDDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
               LE   LLE+NQ+L
Sbjct  187  NFRLENDYLLEDNQNL  202



>ref|XP_011096040.1| PREDICTED: B-cell receptor-associated protein 31 [Sesamum indicum]
Length=221

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EM +I++ +FKTPLRKL+I+ LDR KRGRGP+VVK+VAAT+FV+M+ +VY+   I
Sbjct  7    TLIFAEMTLIVVFVFKTPLRKLVIMGLDRVKRGRGPVVVKTVAATIFVVMMASVYNAVAI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R ++    NPTDQ+L A  IL+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK
Sbjct  67   QRRWIQDGEANPTDQILFANHILEASLMGFALFLALMIDRLHHYIRELRIRRKTMEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++ K    EE+ +L+EE  +++ +IK LE++ E K +E  + + N+ + K QSE 
Sbjct  127  QSRVFEDSKPPATEEIKALEEETIALRGRIKDLETQLEEKNKESGSAEANAMALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  187  FLLEYDRLLEENQNL  201



>ref|XP_011008025.1| PREDICTED: uncharacterized protein LOC105113519 [Populus euphratica]
Length=219

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 153/196 (78%), Gaps = 6/196 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILL +FKTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +I
Sbjct  7    TVIFSEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R ++   ++NPTDQVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  K
Sbjct  67   QKRWIDDGGAVNPTDQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRVRRKTMEDVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +R F++GK   VEE  +L+ E ++++ K+++LESE E K +EV   + N+ +   QSE
Sbjct  127  KQNRSFEDGK---VEETKALEAEASTLREKLQQLESELEIKTKEVNTSEANAIALSKQSE  183

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  184  GFLLEYDRLLEENQNL  199



>gb|ACU19065.1| unknown [Glycine max]
Length=200

 Score =   197 bits (502),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EM +IL L+FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +I
Sbjct  7    TAIFSEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK
Sbjct  67   QQRTLEAGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKG  60
              R F++GKNG  EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K 
Sbjct  127  QSRSFEDGKNGNSEEHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKS  182



>gb|KJB68573.1| hypothetical protein B456_010G251300 [Gossypium raimondii]
Length=222

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 150/195 (77%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EMAVI++L FKTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ
Sbjct  8    VIFSEMAVIMVLSFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQ  67

Query  398  SRPLESINP---TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             R ++   P   TDQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK
Sbjct  68   KRWVDDDGPVSSTDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              +G D+ K  G ++V SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE 
Sbjct  128  QGQGSDDKKPDGFDKVKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LLEEN+ L
Sbjct  188  LLLEYDRLLEENESL  202



>ref|XP_006348141.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+ILLL+FKTPLRKL+I+ LDR KRGRGP+VVK+   T+F++M+ ++YSV  I
Sbjct  7    TVIFAEMALILLLIFKTPLRKLVIMGLDRVKRGRGPIVVKTTGGTIFIVMLSSIYSVVSI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
              R ++   ++ PTDQ+L+AQ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK+MEA  
Sbjct  67   HKRWIDEDGNVTPTDQILMAQHLLEASLMGFSLFLALMIDRLHHYIRELRMRRKSMEAVN  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RGF++GKNG  +++ SL+EE ++++ KIKKLE+  E K +E    + N  + K QSE
Sbjct  127  KQNRGFEDGKNGASDDMKSLEEEASALRLKIKKLEATVEEKAKESSDAEANVVALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              L E   L E+NQ+L
Sbjct  187  HFLRENDSLHEDNQNL  202



>gb|AFK47348.1| unknown [Lotus japonicus]
Length=222

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F E A+I LLLFKTPLRKL+I+ LDR KRGRGPL+V++V ATV V+++ ++YS+  I
Sbjct  7    TVIFSEAAMIALLLFKTPLRKLMIMGLDRLKRGRGPLMVRTVGATVLVVLLSSLYSMFNI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +E    +NPTDQVL+A+ +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK MEA K
Sbjct  67   QKRGIEDGGVVNPTDQVLMAKHLLEATLMGAVLFLALMIDRLHHYIRELRVRRKTMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG D+GK    EE+ +++EE   ++++I +LESE ++K +EV   + N  + + QSE
Sbjct  127  KQSRGSDDGKAAHSEEIRAMEEETTKLRAEINRLESELKSKTKEVDGAEANVSALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|XP_004233786.1| PREDICTED: uncharacterized protein LOC101255462 [Solanum lycopersicum]
Length=222

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 146/196 (74%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F E+AVILLL+FKTPLRKL+I+ LDR KRGRGP+VVK+   T+FV+M+ ++YSV  I
Sbjct  7    TVIFAEVAVILLLIFKTPLRKLIIMGLDRVKRGRGPIVVKTTGGTIFVVMLSSIYSVVSI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
              R ++   ++ PTDQ+L+AQ +L+ASLMGF LFL LMIDRLHHYIRELR+ RK+MEA  
Sbjct  67   HKRWIDEDGNVTPTDQILMAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKSMEAVN  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RGF++GKNG  +++ SL+EE  +++ KIKKLE+  E K +E    + N  + K QSE
Sbjct  127  KQNRGFEDGKNGASDDMKSLEEEAGALRLKIKKLEATVEEKAKESSDAEANVVALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              L E   L EENQ+L
Sbjct  187  HFLRENDSLHEENQNL  202



>ref|XP_004231615.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
lycopersicum]
Length=222

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 151/196 (77%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EMA+I++ +FKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YSV  I
Sbjct  7    TLIFAEMALIIIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMMSTIYSVASI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
             +R ++    I PTDQ+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA K
Sbjct  67   HTRWVDEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +R F++GKNG  EE+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE
Sbjct  127  KQNRAFEDGKNGASEEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|XP_007046390.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY02222.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=219

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  339
            I++LDR KRGRGP+V+ +VAAT+ V++  T+YS+ +IQ R +++  +NPTDQVL+++ +L
Sbjct  30   IMALDRVKRGRGPVVLTTVAATLMVVLASTLYSMLKIQRRTIDAAALNPTDQVLMSKHML  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMGFVLFL+LMIDRLHHYIRELR LRK+ME AKK  +G+++ KN G  E+ +L EE 
Sbjct  90   EASLMGFVLFLALMIDRLHHYIRELRFLRKSMETAKKQSQGYEDRKNAG--ELKALGEET  147

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              +K+KIKKLESECE K +EV+A +  +E+ + QSE LLLEY +LLE+NQ+L
Sbjct  148  VILKTKIKKLESECETKSKEVEAAQAEAEALRKQSEGLLLEYDRLLEDNQNL  199



>ref|XP_003534595.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN40872.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F E A+I LLLFKTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  I
Sbjct  7    TVIFSETAMIALLLFKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +E    +NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA K
Sbjct  67   QKRGIEEGAIVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++GK    EE+ +++EE A +++++ +LESE ++K ++V A + N  + + QSE
Sbjct  127  KQTRGTEDGKVANSEEIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVAALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>gb|KHG10853.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=219

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EMAVI++L FKTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ
Sbjct  8    VIFSEMAVIMVLSFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMMIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R ++  S NPT+Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK 
Sbjct  68   KRWIDDGSANPTEQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
              G ++GK+GG ++V +L+ E+ ++++K+K+LES+ E K +E+ A   N+ + + QSE  
Sbjct  128  --GPEDGKSGGSDKVKALEGEVTTLQAKLKQLESDLETKTKEMDAADANAVALRKQSEGF  185

Query  44   LLEYGQLLEENQHL  3
            LLEY +LLEENQ+L
Sbjct  186  LLEYDRLLEENQNL  199



>gb|ACU14586.1| unknown [Glycine max]
Length=225

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F E A+I LLLFKTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  I
Sbjct  7    TVIFSETAMIALLLFKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +E    +NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA K
Sbjct  67   QKRGIEEGAVVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++GK    EE+ +++EE A +++++ +LESE ++K ++V A + N  + + QSE
Sbjct  127  KQTRGTEDGKVANSEEIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVAALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>gb|KHG15358.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=222

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 149/195 (76%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EMAVI++L FKTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ
Sbjct  8    VIFSEMAVIMVLSFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQ  67

Query  398  SRPLESINP---TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             R +    P   TDQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK
Sbjct  68   KRWVGDDGPVSSTDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              +G ++ K  G +++ SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE 
Sbjct  128  QGQGSNDKKPDGFDKIKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LLEEN+ L
Sbjct  188  LLLEYDRLLEENESL  202



>gb|KDP20721.1| hypothetical protein JCGZ_21192 [Jatropha curcas]
Length=206

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 133/172 (77%), Gaps = 5/172 (3%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            ++ LDR KRGRGP+VVK+VA TV V++I +VYS+ +IQ R ++  ++NPTDQVL++  +L
Sbjct  18   LMVLDRVKRGRGPIVVKTVAGTVLVVLISSVYSMMKIQKRWIDEGAVNPTDQVLMSGHLL  77

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            QA+LMGF LFL+LMIDRLHHYIRELR+ RK+MEA KK  R F++GK   VEE  +++EEI
Sbjct  78   QATLMGFCLFLALMIDRLHHYIRELRMRRKSMEAIKKQSRAFEDGK---VEESKAMEEEI  134

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             ++++K+K LES+ E K +E  A + N+ + K Q+E  LLEY +L EENQ+L
Sbjct  135  TTLRAKLKHLESDLEMKTKEAHASEANAVALKKQAEGFLLEYDRLHEENQNL  186



>gb|KJB69262.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
 gb|KJB69263.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
Length=219

 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EMAVI++L FKTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ
Sbjct  8    VIFSEMAVIMVLSFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMTIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R ++  S NPT+Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK 
Sbjct  68   KRWIDDGSANPTEQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
              G ++GK+ G ++V +L+ E+ ++++K+K+LES+ E K +E+ A + N+ + + QSE  
Sbjct  128  --GPEDGKSSGSDKVKALEGEVTTLQAKLKQLESDLETKTKEMDAAEANAVALRKQSEGF  185

Query  44   LLEYGQLLEENQHL  3
            LLEY +LLEENQ+L
Sbjct  186  LLEYDRLLEENQNL  199



>ref|XP_010099186.1| B-cell receptor-associated protein 31 [Morus notabilis]
 gb|EXB77058.1| B-cell receptor-associated protein 31 [Morus notabilis]
Length=209

 Score =   192 bits (489),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  563  MAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE  384
            MAVI+L+ FKTPLRKL+I++LDR KRGRGP+VVK+V+AT  VL+  +VYS+ +IQ R ++
Sbjct  1    MAVIILMSFKTPLRKLVIMALDRVKRGRGPVVVKTVSATAAVLLASSVYSMVKIQKRWID  60

Query  383  --SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  210
              + NPTDQV++A+ +L+A+LMG  LFL LMIDRLHHYIRELR+ RK +EA KK ++ F+
Sbjct  61   DGASNPTDQVIMAKHLLEATLMGSSLFLVLMIDRLHHYIRELRIRRKTLEAVKKQNQAFE  120

Query  209  NGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYG  30
            +GK GG +E+ + +EE+A++++ +K+LESE E K +++ A + N+ + + QSE  LLEY 
Sbjct  121  DGKTGGSDEIKAKEEEMATLRTTLKQLESELETKTKDIHAAEANAVALQKQSEGFLLEYD  180

Query  29   QLLEENQHL  3
            +LLEENQ+L
Sbjct  181  RLLEENQNL  189



>ref|XP_008440020.1| PREDICTED: B-cell receptor-associated protein 29 [Cucumis melo]
Length=221

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV   EM +ILL  FKTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  I
Sbjct  7    TVIISEMVLILLFSFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTI  66

Query  401  QSRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R ++  +INPTDQVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK
Sbjct  67   QKRWIDDGAINPTDQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R  ++GK    EE+ +L+EE  ++++K+K+LESE ++K ++V A + N  + + QSE 
Sbjct  127  QSRALEDGKVSKSEEIKALEEERTTLETKLKQLESELDSKTKDVTASEANVVALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LLEENQ+L
Sbjct  187  LLLEYDRLLEENQNL  201



>ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   190 bits (483),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 151/196 (77%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EMA+I++ +FKTPLRKL+I+ LDR KRGRGP+++K+VA TVFV+M+ T+YSV  I
Sbjct  7    TLIFAEMALIIIFVFKTPLRKLVIMGLDRVKRGRGPIIMKTVAGTVFVVMMSTIYSVASI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
             +R ++    I PTDQ+LLAQ +L+ASLMGF LFL+ MID+LHHYIREL + RK MEA K
Sbjct  67   HTRWVDEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDKLHHYIRELSIRRKTMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +R F++GK+G  EE+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE
Sbjct  127  KQNRAFEDGKSGASEEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>gb|KEH36901.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 152/196 (78%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F E  +I LLLFKTPLRKL+I++LDR KRGRGP++VK+VA TV V++  +VYS+ +I
Sbjct  7    TLIFSEATMIALLLFKTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +E   S+NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA K
Sbjct  67   QQRGIEDGASVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++ K G  +E  ++++E A +++++ +LESE ++K +EV A + +  + + QSE
Sbjct  127  KQMRGAEDAKAGTSDETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEASVSALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max]
 gb|ACU15966.1| unknown [Glycine max]
 gb|KHN33010.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 150/196 (77%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F E ++I LLLFKTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+++ +VYS+ +I
Sbjct  7    TVIFSEASMIALLLFKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVLLSSVYSMLKI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R ++    +NPTDQVL+A+ +L+A+LM  VLFL+LMIDRLHHYIRELR+ RK MEA K
Sbjct  67   QKRGIQEGAVVNPTDQVLMAKHLLEATLMVAVLFLALMIDRLHHYIRELRIRRKGMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++GK    EE+ S++EE A +++++ +LESE ++K ++V   + N  + + QSE
Sbjct  127  KQTRGTEDGKVANSEEIKSVEEERARLRAELSRLESELQSKTKDVDGAEANIAALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|XP_004151895.1| PREDICTED: uncharacterized protein LOC101218101 [Cucumis sativus]
 gb|KGN63240.1| hypothetical protein Csa_2G416790 [Cucumis sativus]
Length=210

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 150/195 (77%), Gaps = 5/195 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV   +MA+IL LLF+TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I
Sbjct  7    TVIATQMALILTLLFRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             +R +E+  +NPTDQVL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   HNRMVEAGEVNPTDQVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R     ++   E++ +L EE  +M++KI KLESE E K +E    +  +++ + QSE+
Sbjct  127  QIRA---SEDASAEKLKALGEEATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEE  183

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  184  YLLEYDRLLEDNQNL  198



>gb|AFK46642.1| unknown [Medicago truncatula]
Length=222

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 150/196 (77%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F E  +I L LFKTPLRKL+I++LDR KRGRGP++VK+VA TV V++  +VYS+ +I
Sbjct  7    TLIFSEATMIALPLFKTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +E   S+NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA K
Sbjct  67   QQRGIEDGASVNPTDQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++ K G  +E  ++++E A +++++ +LESE ++K +EV A +    + + QSE
Sbjct  127  KQMRGAEDAKAGTSDETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEAGVSALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>gb|EYU27763.1| hypothetical protein MIMGU_mgv1a012919mg [Erythranthe guttata]
Length=236

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 150/210 (71%), Gaps = 23/210 (11%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR  393
            F EMA+I++ +FKTP+RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ TVY+V +IQ R
Sbjct  10   FTEMALIVVFVFKTPVRKLVIMGLDRVKRGRGPIVVKTVAGTVFVVMMATVYNVVKIQRR  69

Query  392  PLESI--NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
             ++ +  NPTDQVLLA+ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK +R
Sbjct  70   WIQDVEVNPTDQVLLAKHLLEASLMGFSLFLALMIDRLHHYIRELRIRRKNMEAVKKQNR  129

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLE------------------SECEAKGEEVK  93
             F++GK     E+  L+EE  S++ +IK+LE                  ++ E K +E  
Sbjct  130  IFEDGKPL---EIKLLEEEKISLRGRIKQLEAQLEDKTTSLHDRINQLGTQLEEKTKEAS  186

Query  92   AQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            + + N+ + K QSE  LLEY +LLEENQHL
Sbjct  187  SSETNAIALKKQSEGFLLEYDRLLEENQHL  216



>ref|XP_004158560.1| PREDICTED: uncharacterized LOC101218101 [Cucumis sativus]
Length=210

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 150/195 (77%), Gaps = 5/195 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV   +MA+IL LLF+TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I
Sbjct  7    TVIATQMALILTLLFRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             +R +E+  +NPTDQVL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK
Sbjct  67   HNRMVEAGEVNPTDQVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R     ++   E++ +L E+  +M++KI KLESE E K +E    +  +++ + QSE+
Sbjct  127  QIRA---SEDASAEKLKALGEDATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEE  183

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  184  YLLEYDRLLEDNQNL  198



>ref|XP_008224696.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=222

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 149/195 (76%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   EMA+IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I+
Sbjct  8    VILSEMALILAFLFRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIK  67

Query  398  SRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +  ++    ++PTDQVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK
Sbjct  68   NSRIDKAAIVSPTDQVLMVKHLLEATLMGCFLFLALMIDRLHHYIRELRIRRKSMEAIKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RG ++GK   ++E+ +L+ EIA++++++K+LESE E K ++V   + N  + + QSE 
Sbjct  128  QNRGSEDGKASSLDEIKALENEIATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  188  FLLEYDRLLEENQNL  202



>ref|XP_004486174.1| PREDICTED: B-cell receptor-associated protein 29-like [Cicer 
arietinum]
Length=222

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F E A+I LLLFKTPLRKL+I++LDR KRGRGPL+VK++A T+ V++  ++YS+ +I
Sbjct  7    TIIFCEAAMIALLLFKTPLRKLVIMALDRLKRGRGPLMVKTIAGTLLVVLSSSIYSMLKI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q R +E   ++NPTDQVL+A+ +L+A+LMG VLFL+LM+DRLHHYIRELR+ RK+MEA K
Sbjct  67   QKRGIEDAAAVNPTDQVLMAKHLLEATLMGAVLFLALMVDRLHHYIRELRIRRKSMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++ K    E+  +++EE A +++ + +LESE ++K +EV   + N  + + QSE
Sbjct  127  KQMRGSEDAKAATSEDTKAMEEEAAKLRAAVNRLESELQSKNKEVGVSEANVNALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ L
Sbjct  187  GFLLEYDRLLEENQSL  202



>ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=218

 Score =   187 bits (476),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 150/195 (77%), Gaps = 5/195 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EMA+IL+L+FKTP RKL+++ LDR KRG GP++VK+VA T+ V++I +VYS+ +I
Sbjct  7    TGIFSEMALILILVFKTPFRKLVLMGLDRVKRGSGPIIVKTVAGTILVVLISSVYSMMKI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R ++   +NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK
Sbjct  67   QKRGIDEGFVNPTDQVLMAKHLLEATLMGAMLFLALMIDRLHHYIRELRMRRKSMEAVKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R  ++GK    EE  +L EE+ ++++++K+LESE E K +E  A + N+ + + QSE 
Sbjct  127  QSRVAEDGK---AEENKALGEEMTTLRARLKQLESELEVKTKEAHASETNAVALRKQSEG  183

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  184  FLLEYDRLLEENQNL  198



>ref|XP_007212007.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
 gb|EMJ13206.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
Length=222

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 148/195 (76%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   EMA+IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I+
Sbjct  8    VILSEMALILAFLFRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIK  67

Query  398  SRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +  ++    ++PTDQVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK
Sbjct  68   NSRIDKAAIVSPTDQVLMVKHLLEATLMGCSLFLALMIDRLHHYIRELRIRRKSMEAIKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RG ++GK   ++E+ +L+ EIA+ ++++K+LESE E K ++V   + N  + + QSE 
Sbjct  128  QNRGSEDGKASSLDEIKALENEIATSRTRLKQLESEIETKTKDVHTAESNVLALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  188  FLLEYDRLLEENQNL  202



>ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus]
 ref|XP_004170033.1| PREDICTED: uncharacterized protein LOC101228301 [Cucumis sativus]
 gb|KGN49093.1| hypothetical protein Csa_6G513570 [Cucumis sativus]
Length=221

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV   EM +ILL  FKTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  I
Sbjct  7    TVIISEMVLILLFSFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTI  66

Query  401  QSRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R ++  +INPTDQVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK
Sbjct  67   QKRWIDDGAINPTDQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R  ++GK    EE+ +L+EE  ++++K+K+LES  ++K +++   + N  + + QSE 
Sbjct  127  QSRAVEDGKVSKSEEIKALEEERTTLETKLKQLESVLDSKTKDITTSEANVVALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LLEENQ+L
Sbjct  187  LLLEYDRLLEENQNL  201



>gb|KFK40615.1| hypothetical protein AALP_AA2G019200 [Arabis alpina]
Length=221

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL--ESINPTDQVLLAQQIL  339
            I+ LDR+KRGRGP+VVK+V+ T+FV+ + +VYS+ +IQ R     S+NPTD+V++A+ +L
Sbjct  30   IMGLDRSKRGRGPMVVKTVSVTIFVVFVSSVYSMMKIQKRWFVEGSVNPTDEVIMAKHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +++LMG VLFL LMIDRLHHY+RELR+ RK+MEA KK   GF++GK G  +E+  L++E+
Sbjct  90   ESTLMGGVLFLGLMIDRLHHYMRELRVRRKSMEAIKKQTVGFESGKVGASDEIKKLEDEV  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             ++  K K LESE E   +EV++++ NS + + QSE  L+E+ +LLEENQ L
Sbjct  150  KALLEKEKHLESELETMTKEVRSEESNSVALQKQSEGFLIEFNRLLEENQKL  201



>ref|XP_008229967.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=221

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V FGEM +IL LLFK+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I+
Sbjct  8    VIFGEMFLILTLLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYTLVDIK  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
            +R +ES  +NPTD+VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK 
Sbjct  68   NRTIESGMLNPTDEVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
             +     KNG  E++ +L +E  ++++KIK LESE E K ++ KA     E+ + QSE L
Sbjct  128  SQSIQEEKNGSSEQLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGL  187

Query  44   LLEYGQLLEENQHL  3
            L+EY +LL +NQ+L
Sbjct  188  LMEYDRLLADNQNL  201



>ref|XP_007215939.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
 gb|EMJ17138.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
Length=221

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 151/194 (78%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V FGEM +IL LLFK+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I+
Sbjct  8    VIFGEMFLILTLLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYNLVDIK  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
            +R +ES  +NPTD+VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK 
Sbjct  68   NRTIESGVLNPTDEVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
             +     KNG  E++ +L +E  ++++KIK LESE E K ++ KA     E+ + QSE L
Sbjct  128  SQSIQEEKNGSSEQLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGL  187

Query  44   LLEYGQLLEENQHL  3
            L+EY +LL +NQ+L
Sbjct  188  LMEYDRLLADNQNL  201



>emb|CDP04423.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 144/195 (74%), Gaps = 5/195 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            ++ F EMA+I++ +FKTPLRKL+I+ +DR KRGRGP VVK+VA T+ V+M+ + Y+   I
Sbjct  7    SLIFAEMALIVIFVFKTPLRKLVIMGIDRVKRGRGPTVVKAVAGTLSVVMMSSGYNAVAI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             +R  +   INPTDQ+L A  +L+ASLMGF LFL+ MIDRLHHYIRELR+ RK+MEA KK
Sbjct  67   HNRWSQDADINPTDQILFANYLLEASLMGFSLFLAFMIDRLHHYIRELRIRRKSMEAGKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R  D+GKNG   +  +L+EE A++++K+K LE+E + K +E  + + N  + K QSE 
Sbjct  127  QNRISDDGKNG---DFKALEEESAALRAKVKNLEAELDEKTKEASSAEANKLALKKQSEG  183

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ L
Sbjct  184  FLLEYDRLLEENQSL  198



>ref|XP_008342021.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342022.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342023.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342024.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
Length=221

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 153/195 (78%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EM +IL+LLFK+PLRKL+I++LD+ KRG+GP++VK+VA TVF++++  VY++ +I
Sbjct  7    TVIFSEMLLILILLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFIVLLANVYNLVDI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            ++R  ES  +NPTD+VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAMEAAK+
Sbjct  67   KNRTNESGVLNPTDEVLMSMKMLENSLMGFFLFLSLMMDRLHHYIRELRFLRKAMEAAKR  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             ++   + KNG  E++ +L +E  ++++KI+ LESE E K ++ KA     E+ + QSE 
Sbjct  127  QNQSSQDDKNGSSEQLKTLVQENETLRTKIETLESEYETKAKKAKAAGSEVEALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LL+EY +LL +NQ+L
Sbjct  187  LLMEYDRLLADNQNL  201



>ref|XP_009353295.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009353296.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EM +IL LLFK PLRKL+I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I
Sbjct  7    TVIFSEMLLILTLLFKNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            ++R +ES  + PTD++L++ ++L+ SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+
Sbjct  67   KNRTIESGVLKPTDEILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKR  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             ++     KNG  E++ ++ +E  ++++KIK LE E E K ++ KA     E+ K QSE 
Sbjct  127  QNQSSQEEKNGSSEQLKTIVQENETLRTKIKTLEFEYETKEKKAKAAGSEVEALKKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LL+EY +LL +NQ+L
Sbjct  187  LLMEYDRLLADNQNL  201



>ref|XP_010686812.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 145/197 (74%), Gaps = 11/197 (6%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV FGE A+I+LLLFK+PLRKL+I  LD+ KRGRGP+VVK+V+AT+ +  I T+YS  +I
Sbjct  7    TVIFGEAAMIMLLLFKSPLRKLVIAVLDKIKRGRGPIVVKTVSATISIFFISTLYSTLKI  66

Query  401  QSRPL------ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAME  240
            Q R +      +++NPTDQVL ++ +L+ASLMGF+LFLSLMIDRLHHYIRELRL RK ME
Sbjct  67   QRRGIGEDGAPDALNPTDQVLFSKHLLEASLMGFILFLSLMIDRLHHYIRELRLRRKTME  126

Query  239  AAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKG  60
            A KK+D      K  G EE+ + ++++ + K+ I++LES+ E+K +E    +   E+ + 
Sbjct  127  AVKKND-----VKCAGPEEIKAREQQVETFKAMIRQLESDLESKVKEASTSEATVEALRK  181

Query  59   QSEKLLLEYGQLLEENQ  9
            QSE LLLEY +LL ENQ
Sbjct  182  QSEGLLLEYDRLLAENQ  198



>ref|XP_008348138.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=221

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EM +IL  LFK PLRKL+I++LD+ K+G+GP++VK+VA TVF +++  VY++ +I
Sbjct  7    TVIFSEMLLILAFLFKNPLRKLVILALDKMKQGKGPVMVKTVAGTVFAVLMADVYNLVDI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            ++R +ES  +NPTD+VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEA K+
Sbjct  67   KNRTIESGVLNPTDEVLMSVKMLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAVKR  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             ++     KNG  +++ ++ +E  ++++KIK LESE E K ++ +A     E+ + QSE 
Sbjct  127  QNQSSQEEKNGSSKQLKTIVQENETLRTKIKTLESEYETKEKKAEAAGSEVEALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LL+EY +LL +NQ+L
Sbjct  187  LLMEYDRLLADNQNL  201



>ref|XP_008784370.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=221

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+   E+ V+++LLFKTPLRKL I+ LDR KRGRGP++VK+VAAT+ +++  +VYS+ +I
Sbjct  7    TLLSAEVGVVVVLLFKTPLRKLAILGLDRLKRGRGPVMVKTVAATLLIVLASSVYSIAKI  66

Query  401  QSRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +S   E  S+ PTDQVL+++ +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K
Sbjct  67   RSHSTEIGSLTPTDQVLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R  +  K GG +E+ S  ++I ++  +IK L+ E EA+ +E KA + N+ + + QSE 
Sbjct  127  QNRALEETKGGGSDELKSQDKDITNLNEEIKHLKLELEARTKEAKAAEANTTALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>gb|KFK35240.1| hypothetical protein AALP_AA5G258500 [Arabis alpina]
Length=221

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+ VI+ L FKTP+RKLLI+SLDRAKRGRGP+V+++++ TV V+++ +VYS+  IQ
Sbjct  8    VVLSEVVVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTISVTVLVVLVASVYSMMNIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E  ++NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK 
Sbjct  68   KRWIEDGAMNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
              G +  K   ++EV +LKEEI S++ + K+L SE E + +E++ +K ++ + + QSE  
Sbjct  128  GAGLEGVKAKALDEVKNLKEEIMSLQERQKQLASEIETRSKEIRTEKTSAIALQKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +LLEENQ L
Sbjct  188  LIEFNRLLEENQEL  201



>ref|XP_004293309.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 146/195 (75%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   EMA+IL  LF+TPLRKL+I+ LD+ KRGRGP+VVK+ A TVFV+++ ++Y + +I+
Sbjct  8    VIISEMALILACLFRTPLRKLVIVGLDQIKRGRGPVVVKTAAGTVFVVLLTSLYGMVKIK  67

Query  398  SRPLESI---NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
                +++   +PTDQ+L+ + +L+ +LMGF LFL LMIDR+HHYIRELR+ RK MEA KK
Sbjct  68   RSGADAVGILSPTDQILMFKHLLEVTLMGFFLFLVLMIDRIHHYIRELRVRRKTMEAIKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RG ++GK GG++EV +L+ E+++ + +IK+LES  E   +E  A + + ++ + QSE 
Sbjct  128  QNRGSEDGKAGGLDEVKALENEMSTSRLRIKQLESNIETTTKEAHAAEASVDALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+L
Sbjct  188  FLLEYDRLLEENQNL  202



>ref|XP_009347127.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 145/195 (74%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EM +IL LLFK PLRKL+I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I
Sbjct  7    TVIFSEMLLILTLLFKNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            ++R +ES  + PTD++L++ ++L+ SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+
Sbjct  67   KNRTIESGVLKPTDEILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKR  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             ++     KNG  E++ ++ +E  ++K+KIK LESE E   ++ K      E+ + QSE 
Sbjct  127  QNQSSQEEKNGSPEQLKTIVQENETLKTKIKTLESEYETNAKKAKVAGSEVEALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
            LL+EY +L  +NQ+L
Sbjct  187  LLMEYDRLQADNQNL  201



>ref|XP_010493468.1| PREDICTED: uncharacterized protein LOC104770706 [Camelina sativa]
Length=221

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            I+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKNLKEEI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ L
Sbjct  150  MSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQDL  201



>gb|KHN44866.1| hypothetical protein glysoja_040795 [Glycine soja]
Length=217

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
             V FGEM VI   LFKTP RKL+II+LDR KR     VVK+VAAT+ V++  ++YS+ +I
Sbjct  7    AVIFGEMFVIASFLFKTPARKLVIITLDRVKRV----VVKTVAATLLVVLASSLYSIAKI  62

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R L++  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK
Sbjct  63   RRRNLDAPVVNPTDQVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  122

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
              R F++GK+    E  +L EE A +K KI+KLESECE +  + KA +   E+ + QSE 
Sbjct  123  QSRSFEDGKSVSAAEHKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEG  182

Query  47   LLLEYGQLLEENQHL  3
             L+EY +LL +NQ+L
Sbjct  183  FLMEYDRLLADNQNL  197



>ref|XP_003596956.1| hypothetical protein MTR_2g088060 [Medicago truncatula]
 gb|ABN08523.1| Prefoldin [Medicago truncatula]
 gb|AES67207.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 143/195 (73%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V F EM +I+  LFKTPLR L+II+L++ KRGRGP++VK+V  TV  ++   +Y++ +IQ
Sbjct  8    VIFVEMLMIMSFLFKTPLRNLVIITLNKVKRGRGPVIVKTVVGTVVTMLGSALYNIFKIQ  67

Query  398  SRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             R +E   +++ TDQVLL+  +LQASL+GFVLFLSLMIDRLHHYIRELRLLR A+E  KK
Sbjct  68   RRSIEGFATVDSTDQVLLSNHVLQASLLGFVLFLSLMIDRLHHYIRELRLLRNAVETGKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R F N  N    E  SLKEEI +++ KI+KLESECE KG  VK+ +   E+FK QSE 
Sbjct  128  QNRCFQNNTNIKAMEHTSLKEEIGALRFKIEKLESECEVKGSRVKSLEIEVEAFKKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
             L+EY  LL +NQ+L
Sbjct  188  FLMEYDGLLIDNQNL  202



>ref|XP_010458605.1| PREDICTED: uncharacterized protein LOC104739838 [Camelina sativa]
Length=221

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            I+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKNLKEEI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ L
Sbjct  150  TSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQGL  201



>ref|XP_006417293.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
 gb|ESQ35646.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
Length=221

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+AVI+ L FKTP+RKLLI+SLDRAKRGRGP+V+++++ATV V+++ +VYS+ +IQ
Sbjct  8    VVLSEVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTISATVCVVLVASVYSMMKIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E  ++NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK 
Sbjct  68   KRGIEDGAMNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKMMEVIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K    +EV +LKEE+ S++ + K+L SE EA+ +E++ +K ++ + + QSE  
Sbjct  128  GAVLEGVKARASDEVKNLKEEVVSLQERQKQLVSEIEARSKEIRTEKTSAVALEKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +LLEENQ L
Sbjct  188  LIEFNRLLEENQDL  201



>ref|XP_010476134.1| PREDICTED: uncharacterized protein LOC104755448 [Camelina sativa]
Length=221

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            I+SLDRAKRGRGP+V+++V+ TV VL + +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSVTVIVLFVASVYNMMAIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKNLKEEI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ L
Sbjct  150  MSLRKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQGL  201



>ref|NP_849648.4| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AAM98189.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28811.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=221

 Score =   174 bits (442),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ
Sbjct  8    VVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E   +NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK 
Sbjct  68   KRWIEDGVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K  G++EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  
Sbjct  128  GALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +LLEENQ L
Sbjct  188  LIEFNRLLEENQVL  201



>ref|XP_002889902.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66161.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ
Sbjct  8    VVLFEVVVIMALSFKTPMRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMAIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E   +NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK 
Sbjct  68   KRWIEDGVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K  G++EV +L EEI S++ + ++L+SE EA+ +E++ ++ ++ + + QSE  
Sbjct  128  GALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTERTSAVALQKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +LLEENQ L
Sbjct  188  LIEFNRLLEENQVL  201



>emb|CDY34821.1| BnaA09g47470D [Brassica napus]
Length=221

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+AVIL L FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ
Sbjct  8    VVLAEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E  ++NPTD+V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK 
Sbjct  68   KRWVEEGAMNPTDEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K    +EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  
Sbjct  128  GSVLEGEKARASDEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +L EENQ L
Sbjct  188  LIEFNRLSEENQDL  201



>ref|XP_009118164.1| PREDICTED: uncharacterized protein LOC103843216 [Brassica rapa]
Length=221

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+AVIL L FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VY + +IQ
Sbjct  8    VVLAEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYGMMKIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E  ++NPTD+V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK 
Sbjct  68   KRWVEEGAMNPTDEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K    +EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  
Sbjct  128  GSVLEGEKARASDEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +L EENQ L
Sbjct  188  LIEFNRLSEENQDL  201



>ref|XP_002320470.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
 gb|ABK92570.1| unknown [Populus trichocarpa]
 gb|EEE98785.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
Length=218

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR  393
            F EM VIL L+F+ PLRK +I+ LDR KRGRGP+VVK+VA T+ VL++  VYS+  +Q+R
Sbjct  10   FSEMGVILTLIFRNPLRKFVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYSIGNMQNR  69

Query  392  PLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
             +E+  +NPT++VL+A Q+LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R
Sbjct  70   KMEAGALNPTEEVLMAMQLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNR  129

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
             F++GKNG   E   L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL
Sbjct  130  SFEDGKNG---EGKGLGEEVETLRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLL  186

Query  38   EYGQLLEENQHL  3
            +Y  LLE+NQ L
Sbjct  187  QYDHLLEDNQSL  198



>ref|XP_011047243.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=218

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR  393
            F EM VIL L+F+ PLRKL+I+ LDR KRGRGP+VVK+VA T+ VL++  VY++  IQ+R
Sbjct  10   FSEMGVILTLIFRNPLRKLVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYTIGNIQNR  69

Query  392  PLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
             +E+  +NPTD+VL+A  +LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R
Sbjct  70   KMEAGALNPTDEVLMAMLLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNR  129

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
             F++GKNG   E   L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL
Sbjct  130  SFEDGKNG---EGKGLGEEVEALRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLL  186

Query  38   EYGQLLEENQHL  3
            +Y  LLE+NQ L
Sbjct  187  QYDHLLEDNQSL  198



>ref|XP_009419329.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 125/172 (73%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            I+ LDR KRGRGP++VK+VA TV +++  ++YS+ +I+SR  E  +  PTDQVL+++ +L
Sbjct  30   ILGLDRFKRGRGPVMVKTVAGTVVIVLASSLYSMAKIRSRSAEFGAFTPTDQVLMSRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL L+IDRLHHYIRELR LRK+MEA  K +R  +  K GG +E+ +   EI
Sbjct  90   EASLMGYSLFLVLIIDRLHHYIRELRGLRKSMEAVMKQNRVLEETKCGGSDEIKTRDREI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            A +  +IK L+ E E + +E +A + N  + K QS+ LL+EY +LLE+NQ++
Sbjct  150  ACLNEQIKHLKFESEERIKEARAAEANVMALKKQSDDLLIEYDRLLEDNQNI  201



>ref|XP_007147709.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
 gb|ESW19703.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
Length=222

 Score =   169 bits (429),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 150/196 (77%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F E  +I LLLFKTPLRKL+I+ LDR KRGRGPL+VK+VA T+ V+++ +VYS+ +I
Sbjct  7    TLIFSEAGMIALLLFKTPLRKLVIMGLDRLKRGRGPLIVKTVAGTILVVLLSSVYSMIKI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q   +E   S+NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA K
Sbjct  67   QKHEIEDGGSVNPTDQVLMAKHLLEATLMGGILFLALMIDRLHHYIRELRIRRKGMEAVK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K  RG ++GK    EE+ +++EE A +++++++LESE ++K ++    + N  + + QSE
Sbjct  127  KQTRGSEDGKFTFSEEMKAVEEERARLRAELRRLESELQSKTKDADIAEANVSALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|XP_009403539.1| PREDICTED: uncharacterized protein LOC103987073 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            ++ LDR KRGRGP++VK+VA TV V++  ++YS+ +I S   E  ++ PTDQVL+++ +L
Sbjct  30   VVGLDRLKRGRGPVMVKTVAGTVLVVLASSLYSIAKISSGSAELGALTPTDQVLMSRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL+L+IDRLHHY+RELR LRK+MEA  K +R  +  K GG  EV +L   I
Sbjct  90   EASLMGYSLFLALIIDRLHHYVRELRGLRKSMEAVLKQNRVLEEAKTGGSSEVKALDGMI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            AS+  +IK+L+SE E + +E KA +  + + K QSE LLLEY +LLE+NQ+L
Sbjct  150  ASLNEQIKQLKSESEDRLQEAKAAEARAAALKKQSEDLLLEYDRLLEDNQNL  201



>ref|XP_008780367.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
 ref|XP_008780411.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
Length=221

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 127/171 (74%), Gaps = 2/171 (1%)
 Frame = -3

Query  509  ISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQ  336
            + LD  KRGRGP++VK+VA TV +++  +VYS+ EI+ R  E  S+ PTDQVL++Q +L+
Sbjct  31   LGLDHLKRGRGPVMVKTVAGTVLLVLASSVYSMVEIRGRFTEIGSLTPTDQVLMSQNLLE  90

Query  335  ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIA  156
            ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +E+ S  +E+ 
Sbjct  91   ASLMGYSLFLALIIDRLHHYIRELRRLRKSMEAVMKQNRALEETKNGGSDELKSRDKEVT  150

Query  155  SMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            ++  +IK+L+ E EA+ +E KA + ++ + K QSE  LLEY  LLE+N++L
Sbjct  151  NLNEQIKQLKLELEARTKEAKAAEASATALKKQSEGFLLEYDHLLEDNKNL  201



>gb|KHN36526.1| ATP-dependent helicase rhp16 [Glycine soja]
Length=1121

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 122/160 (76%), Gaps = 2/160 (1%)
 Frame = -3

Query  476   PLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFVLFLS  303
             P+VVK+VAAT+ V++  ++YS+ +I+ R L++   NPTDQVL+ + +L+ASLMGFVLFLS
Sbjct  942   PVVVKTVAATLLVVLASSLYSIAKIRHRNLDAPVANPTDQVLVYKHMLEASLMGFVLFLS  1001

Query  302   LMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLES  123
             LMIDRLHHYIRELRLLRKAMEAAKK  R F+ GK+    E  +L EEIA +K KI+KLES
Sbjct  1002  LMIDRLHHYIRELRLLRKAMEAAKKQSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLES  1061

Query  122   ECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             ECE +  + KA +   E+ + QSE  L+EY +LL +NQ+L
Sbjct  1062  ECEMEASKAKALETEVEALRKQSEGFLMEYDRLLADNQNL  1101



>ref|XP_010533802.1| PREDICTED: uncharacterized protein LOC104809492 [Tarenaya hassleriana]
Length=221

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 148/190 (78%), Gaps = 2/190 (1%)
 Frame = -3

Query  566  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  387
            E+AVI+ L FKTP+RKLLI+SLDRAKRGRGP+VVK+V ATV V+M  +VYSV +IQ R +
Sbjct  12   EVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVVKTVVATVCVVMASSVYSVMKIQKRWI  71

Query  386  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  213
            +  ++NPTD+VL+ + +L+++LMG  LFL LMIDRLHHY+RELR+ RK+MEA KK   GF
Sbjct  72   DEGTVNPTDEVLMTRNLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKSMEAIKKQGLGF  131

Query  212  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  33
            ++GK    +E+ S++E+I S++    +LESE +AK +E ++++ N+ + + QSE  LLE+
Sbjct  132  EDGKAVASDELKSMEEQIRSLQEIKNQLESELDAKAKEARSEESNAVALRKQSEGFLLEF  191

Query  32   GQLLEENQHL  3
             +LLEENQ L
Sbjct  192  NRLLEENQDL  201



>ref|XP_010546686.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
 ref|XP_010546696.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
Length=221

 Score =   167 bits (422),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+AVI+ L FKTP+RKLLI+SLDRAKRGRGP+VVK+VAATV V+M  +VYS+ +IQ
Sbjct  8    VVLSEVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVVKTVAATVCVVMASSVYSMMKIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R ++  ++NPTD+VL+ + +L+++LMG  LFL LM DRLHHY+RELR+ RK+MEA KK 
Sbjct  68   KRWIDEGTVNPTDEVLMKKNLLESTLMGGFLFLGLMTDRLHHYMRELRVRRKSMEAIKKQ  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
              GF+ GK G  +E+  ++E+I +++   K+LESE EAK +E   ++  + + + QSE  
Sbjct  128  GLGFNGGKPGNSDEIKGMEEQIRTLQEIQKQLESELEAKTKEANGEESGAVALRQQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            LLE+ +LLEENQ L
Sbjct  188  LLEFNRLLEENQEL  201



>ref|XP_009390004.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390005.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 141/192 (73%), Gaps = 2/192 (1%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR  393
              E+AV+ +LLF TPLRKL ++ LDR KRGRGPLVV+++AAT  V++  ++YS+ +I SR
Sbjct  10   LAEVAVVGVLLFNTPLRKLALLGLDRLKRGRGPLVVRTIAATGLVVLGSSLYSMSKIWSR  69

Query  392  P--LESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
               + ++ PTDQVL ++  L+ASLMG+ LFL+L+IDRLHHYIRE R LRK+MEAA K +R
Sbjct  70   SDQIGALTPTDQVLHSRHFLEASLMGYSLFLALIIDRLHHYIREWRGLRKSMEAATKQNR  129

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
              +  K+G  +E+   +E+I S+  +I++L+   E + +EVK  + N+ + + QSE LLL
Sbjct  130  LLEEAKSGKSDEIKGREEKITSLNEEIQQLKLASEERMKEVKTAEANAIALRKQSEGLLL  189

Query  38   EYGQLLEENQHL  3
            EY +LLE+NQ+L
Sbjct  190  EYDRLLEDNQNL  201



>ref|XP_008649481.1| PREDICTED: uncharacterized protein LOC103630179 [Zea mays]
 gb|AFW77553.1| hypothetical protein ZEAMMB73_124915 [Zea mays]
Length=221

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVLLAQQIL  339
            ++++DRAKRGRGP++ K++A T+ ++++   YSV +I+ R   L  + PTDQVL ++ +L
Sbjct  30   LLAIDRAKRGRGPVMAKTIAGTMLLVLVSAFYSVAKIRRREGELGQLTPTDQVLASRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL L+IDRLHHYIRELR+LRK MEA  +  R  +  K+G  +E+   ++E+
Sbjct  90   EASLMGYSLFLGLIIDRLHHYIRELRMLRKDMEAVTEQGRTLEAAKSGSTDEIQGYQKEV  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            AS+K ++++L+++ + K E +K  + NS + + QSE LL EY +L+ EN+ L
Sbjct  150  ASLKEQVQELQNQSQKKTERLKTAEANSVALQKQSEGLLAEYDRLIAENRDL  201



>ref|XP_010916117.1| PREDICTED: uncharacterized protein LOC105041025 [Elaeis guineensis]
Length=221

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 143/195 (73%), Gaps = 2/195 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+   E+ V+++LLFKTPLRKL I+ LDR KRGRGP++VK+VA TV +++  +VYS+ +I
Sbjct  7    TLLLAEVGVVVVLLFKTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLIVLASSVYSMAKI  66

Query  401  QSRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +S   E  S+ PTDQVL+++ +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K
Sbjct  67   RSHSTEIGSLTPTDQVLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +R  +  K+GG +E+    +EI  +  +IK+L  + E+  +E KA + N+ + + QSE 
Sbjct  127  QNRALEETKSGGSDELKLRDKEITYLNEQIKQLNLKLESSTKEAKAAEANATALRKQSEG  186

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLE+NQ+L
Sbjct  187  FLLEYDRLLEDNQNL  201



>ref|XP_004287957.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 145/195 (74%), Gaps = 5/195 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F +MA+IL LLFK+PLRKL+I+ LD+ KRG+GP+VVK+V  TV  ++   +Y++ E+
Sbjct  7    TAIFSQMALILTLLFKSPLRKLVILGLDKLKRGKGPVVVKTVGGTVAAVLCANIYNLNEL  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +SR  E+  +NPTD+VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEAAKK
Sbjct  67   KSRTNEAGMLNPTDEVLMSMKLLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             ++     K+ G +   +L +E  ++++K+K LESE E K ++ KA     ++ K QSE 
Sbjct  127  QNQPTQEEKSEGHK---TLVQENETLRAKVKNLESEHETKEKKAKATGAEVQALKKQSEG  183

Query  47   LLLEYGQLLEENQHL  3
            LLLEY +LLEENQHL
Sbjct  184  LLLEYDRLLEENQHL  198



>ref|XP_010926189.1| PREDICTED: uncharacterized protein LOC105048548 [Elaeis guineensis]
Length=221

 Score =   162 bits (409),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 126/172 (73%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  339
            I+ LDR KRGRGP++VK+VA TV V++  +VYS+ +I+ R  E+  + PTDQVL++Q +L
Sbjct  30   ILGLDRLKRGRGPVMVKTVAGTVLVVLASSVYSMLKIRDRSAETGFLTPTDQVLMSQNLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +++ S  +E 
Sbjct  90   EASLMGYSLFLALIIDRLHHYIRELRGLRKSMEAVMKQNRALEETKNGGSDDLKSRDKET  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              +  +IK+L+ E +A  +E KA + N+ +   QSE LL EY +LLE+N++L
Sbjct  150  TDLNEQIKQLKLELDAISKEAKAAEANATALGKQSEGLLQEYDRLLEDNKNL  201



>ref|XP_008384089.1| PREDICTED: B-cell receptor-associated protein 29-like [Malus 
domestica]
Length=222

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 146/196 (74%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
             V   EM +IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I
Sbjct  7    VVILSEMVLILAFLFRTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVLMTNVYSIVKI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            +   ++    ++PTDQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA K
Sbjct  67   RGSRIDKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RG ++GK+  ++++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE
Sbjct  127  KQNRGSEDGKSSSLDKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSILALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ+L
Sbjct  187  GFLLEYDRLLEENQNL  202



>ref|XP_006303826.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
 gb|EOA36724.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
Length=221

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+ VI+ L FKTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL++ +VY++  IQ
Sbjct  8    VVLFEVVVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLLVASVYNMMGIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E  ++NPTD+V++A+ +L+++LMG +LFL LMIDRLHHY+RELR+ RK ME  KK 
Sbjct  68   KRWIEDGAVNPTDEVIMAKHLLESTLMGGLLFLGLMIDRLHHYMRELRIRRKTMEVIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K  G++E+ +LKEEI S++ + ++L+SE EAK +E++ +K ++ + + QSE  
Sbjct  128  GALLEGVKARGLDEIKTLKEEIMSLRKRQEQLDSELEAKSKEIRTEKTSAVALQKQSEGF  187

Query  44   LLEYGQLLEENQHL  3
            L+E+ +LLEENQ L
Sbjct  188  LIEFNRLLEENQDL  201



>ref|XP_011086195.1| PREDICTED: B-cell receptor-associated protein 31-like [Sesamum 
indicum]
Length=221

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR  393
            F EMA+I+L +FK PLRK +I+ LDR KRG GP+VV++V  TVFV+M+ T+Y+   I+ R
Sbjct  10   FAEMALIVLFIFKNPLRKTVIMGLDRIKRGSGPIVVQTVGGTVFVVMLATLYNAVAIKRR  69

Query  392  PLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
             +   + + TDQ+L A+ +L ASLMGF LFL L IDRLHHYIRELR+ RK++EA KK ++
Sbjct  70   QMRDATTDSTDQILCARHLLGASLMGFSLFLVLTIDRLHHYIRELRIWRKSIEALKKQNQ  129

Query  218  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  39
              ++ K    +++  ++EE A+++ +IK+LE++ E K +E      ++ + K QS+  L+
Sbjct  130  ALEDEKPAVSKQIKVMEEEKATLQERIKELETQLEEKSKEASRAGASAVALKKQSDGFLI  189

Query  38   EYGQLLEENQHL  3
            EY +LLEENQ L
Sbjct  190  EYERLLEENQKL  201



>ref|XP_010089483.1| hypothetical protein L484_011937 [Morus notabilis]
 gb|EXB37876.1| hypothetical protein L484_011937 [Morus notabilis]
Length=253

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 148/222 (67%), Gaps = 34/222 (15%)
 Frame = -3

Query  566  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  387
            EM +IL L+FKTPLR+L++++LD+ KRGRGP++VK++A TVF+L + +V S   IQ+   
Sbjct  12   EMVLILTLIFKTPLRQLVLMALDKVKRGRGPVMVKTIAITVFLLFVVSVCSFVNIQNHIT  71

Query  386  ES---INPTDQVLLAQQILQASLMGFVL-----FLSLMID--------------------  291
            E+   INPTDQVL+A+ +L+ASLMGF L     F +L ++                    
Sbjct  72   EAGGGINPTDQVLMAKHLLEASLMGFQLEIIMNFPNLYVEGSHLGFASITAIMKDYAIIA  131

Query  290  ------RLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKL  129
                  RLHHYIRELR+LRK MEAAKK +RG +NGKNG   E+ + +++IA +K+ IKKL
Sbjct  132  SVYKNYRLHHYIRELRILRKTMEAAKKQNRGHENGKNGNAAELKASEQDIAQLKATIKKL  191

Query  128  ESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            ESEC+ K EE +A +  +E+ K QSE  L+EY  LL ENQ+L
Sbjct  192  ESECKTKTEEAEAAEGKAEALKKQSEGFLMEYDHLLAENQNL  233



>emb|CDY34616.1| BnaC08g41750D [Brassica napus]
Length=224

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+AVIL L FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ
Sbjct  8    VVLAEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSL---MIDRLHHYIRELRLLRKAMEAA  234
             R +E  + NPTD+V++++ +L+++LMG   F S+   MIDRLHHY+RELR+ RK ME  
Sbjct  68   KRWVEEGATNPTDEVIMSKHLLESTLMGKSSFASVAAEMIDRLHHYMRELRMRRKTMEVI  127

Query  233  KKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQS  54
            KK     +  K    +EV SLK+EI +++ + K+L +E EA  +E++ ++ +  + + QS
Sbjct  128  KKEGSVLEGEKARASDEVKSLKQEITALQERQKQLAAEMEAMSKEIRTEETSGIALQKQS  187

Query  53   EKLLLEYGQLLEENQHL  3
            E  L+E+ +L EENQ L
Sbjct  188  EGFLIEFNRLSEENQDL  204



>ref|NP_001055067.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|AAT85231.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16981.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|EAY97334.1| hypothetical protein OsI_19258 [Oryza sativa Indica Group]
 dbj|BAG97944.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63061.1| hypothetical protein OsJ_17869 [Oryza sativa Japonica Group]
Length=221

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            ++++DRAKRGRGP++VK+VAAT+ V++  + YS+ +I+ R   L  + PTDQVL ++ +L
Sbjct  30   LLAIDRAKRGRGPVMVKTVAATMLVVLGSSGYSIAKIRRRVGDLGQLTPTDQVLASRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL L+IDRLHHYIRELR ++K MEA  K  R  +  K+G VEE+   ++EI
Sbjct  90   EASLMGYSLFLGLIIDRLHHYIRELRTMKKNMEAVTKQSRTLEEAKHGSVEEIQQYQKEI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            + +  ++++ +   E K EE+K  + N+ + + QSE LL EY +L+ EN+
Sbjct  150  SRLNEQVQEFKRLSETKTEELKTAEANTLALQKQSEGLLTEYERLIAENE  199



>gb|EMT11422.1| hypothetical protein F775_31561 [Aegilops tauschii]
Length=222

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 123/178 (69%), Gaps = 8/178 (4%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVL  357
            ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       +++PTDQVL
Sbjct  30   MLGLDRLKRGRRAPVAVKTVAGVVITLLASTLYSMAEISGRAGDPEAGGGAALSPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  177
             ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + GK+G  +E+ 
Sbjct  90   FSRHLLEASLMGYTLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKTLEEGKHGRSQEIA  149

Query  176  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              +EE+A++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+NQHL
Sbjct  150  KYQEEVATLNEEMKKLKLQVQEKTEEVHVAEDKALAIQKQSESLLLEYDRLLEDNQHL  207



>dbj|BAK02060.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 124/178 (70%), Gaps = 8/178 (4%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVL  357
            ++ LDR KRGR  P+ VK+VA  VF L+  T+YS+ EI  R  +       +++PTDQVL
Sbjct  30   MLGLDRLKRGRRAPVAVKTVAGVVFTLLASTLYSMAEISGRAGDPEGGGGAALSPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  177
             ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + GK+G  +E+ 
Sbjct  90   FSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKMLEEGKHGRSQEIA  149

Query  176  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              +EE+A++  ++KKL+ + + K +EV   +D + + + QSE LLLEY +LLE+NQHL
Sbjct  150  KYQEEVATLNEEMKKLKLQVQEKTKEVHVAQDKTLAIQKQSESLLLEYDRLLEDNQHL  207



>ref|XP_006654198.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=221

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            +++LDRAKRGRGP++V++VAAT+ V++  + YS+ +I+ R   L  + PTDQVL ++ +L
Sbjct  30   LLALDRAKRGRGPVMVRTVAATMIVVLGSSGYSIAKIRRRVGDLGQLTPTDQVLASRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL ++IDRLHHYIRELR ++K MEA  K  R  +  K+G VE +   ++EI
Sbjct  90   EASLMGYSLFLGIIIDRLHHYIRELRTMKKNMEAVTKQSRVLEEAKHGSVEGIQQYQKEI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +S+  ++++L+   E K EE+K  + N+ + + QSE LL EY +L+ EN+  
Sbjct  150  SSLNEQVQELKRLSEKKTEELKTAEANALALQKQSEGLLTEYERLIAENEQF  201



>ref|XP_009357471.1| PREDICTED: uncharacterized protein LOC103948199 [Pyrus x bretschneideri]
Length=222

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   EM +IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VAATV V+++  VYS+ +I+
Sbjct  8    VILSEMVLILAFLFRTPFRKLVILGLDQIKRGRGPVVVKTVAATVLVVLMTNVYSIVKIR  67

Query  398  SRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
               ++    ++PTDQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK
Sbjct  68   GSRIDKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RG ++GK+  ++++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE 
Sbjct  128  QNRGSEDGKSSSLDKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSVLALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ+ 
Sbjct  188  FLLEYDRLLEENQNF  202



>ref|NP_001046689.1| Os02g0321800 [Oryza sativa Japonica Group]
 dbj|BAD28852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08603.1| Os02g0321800 [Oryza sativa Japonica Group]
 gb|EAZ22804.1| hypothetical protein OsJ_06479 [Oryza sativa Japonica Group]
 dbj|BAG92174.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-----------SINPT  369
            ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R              S++PT
Sbjct  30   VMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGGGGGASLSPT  89

Query  368  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  189
            DQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  +  K+G  
Sbjct  90   DQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVTKHNKMLEEAKHGRS  149

Query  188  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+NQ
Sbjct  150  EETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLEYDRLLEDNQ  209

Query  8    HL  3
            HL
Sbjct  210  HL  211



>ref|XP_006647215.1| PREDICTED: B-cell receptor-associated protein 29-like [Oryza 
brachyantha]
Length=225

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-----------SINPT  369
            ++ +D  KRGR  P+ VK+VA  V  L+  T+YS+ EI  R              S++PT
Sbjct  30   VLGIDCLKRGRRAPVAVKTVAGVVTALLTSTLYSMAEISGRAGGDPESGGGGGGASLSPT  89

Query  368  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  189
            DQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  +  K+G +
Sbjct  90   DQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKHNKMLEEAKHGSI  149

Query  188  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            EE    +EEIA++   +KKL+ + + K EE    +D + + + QSE LLLEY +LLE+NQ
Sbjct  150  EETKKYQEEIAALNEDMKKLKLQVQEKTEEAHIAEDKALAIRKQSESLLLEYDRLLEDNQ  209

Query  8    HL  3
            HL
Sbjct  210  HL  211



>ref|XP_010234160.1| PREDICTED: uncharacterized protein LOC100839925 [Brachypodium 
distachyon]
Length=222

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 121/178 (68%), Gaps = 8/178 (4%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVL  357
            ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       +++PTDQVL
Sbjct  30   VLGLDRLKRGRRAPVAVKTVAGVVLTLLASTLYSMAEISGRTGDPESGGGGALSPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  177
             ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  +  K+G  EE  
Sbjct  90   FSRHLLEASLMGYSLFLALIIDRLHQYIRELRGLKKNVEAVSKQNKMLEETKHGRNEETI  149

Query  176  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+NQHL
Sbjct  150  KYQEEIATLNEEMKKLKLQVQEKTEEVHVAEDKALAIRKQSENLLLEYDRLLEDNQHL  207



>gb|EAY85610.1| hypothetical protein OsI_06982 [Oryza sativa Indica Group]
Length=227

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 119/183 (65%), Gaps = 13/183 (7%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRP------------LESINP  372
            ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R               S++P
Sbjct  30   VMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGGGGGGASLSP  89

Query  371  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  192
            TDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  +  K+G 
Sbjct  90   TDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVIKHNKMLEEAKHGR  149

Query  191  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  12
             EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+N
Sbjct  150  SEETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLEYDRLLEDN  209

Query  11   QHL  3
            QHL
Sbjct  210  QHL  212



>ref|XP_009358864.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=222

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 147/195 (75%), Gaps = 3/195 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   EM +IL  LFKTP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I+
Sbjct  8    VILSEMVMILAFLFKTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVVMTNVYSIVKIR  67

Query  398  SRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +  ++    ++PTDQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK
Sbjct  68   ASRIDKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKSMEALKK  127

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  48
             +RG ++GK+  ++++   + E+A++++++K+LESE E K ++V   + N  + + QSE 
Sbjct  128  QNRGSEDGKSSILDQMKVSENEMATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEG  187

Query  47   LLLEYGQLLEENQHL  3
             LLEY +LLEENQ L
Sbjct  188  FLLEYDRLLEENQKL  202



>ref|XP_010057913.1| PREDICTED: B-cell receptor-associated protein 31-like [Eucalyptus 
grandis]
 gb|KCW75271.1| hypothetical protein EUGRSUZ_E04024 [Eucalyptus grandis]
Length=223

 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE----SINPTDQVLLAQQ  345
            I+ LDR KRG GP+VV +VAATV V++   VYS+ +I+ R  E    + NPTDQVL+A+ 
Sbjct  30   IVGLDRVKRGHGPVVVTTVAATVCVVLGSGVYSMVKIRRRGAEDGGGAANPTDQVLMAKH  89

Query  344  ILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKE  165
            +L+ +LMG  LFL+LMIDRLHHYIRELRL RK+MEA KK  R F++GKNG +EE+ +L+E
Sbjct  90   LLECTLMGATLFLALMIDRLHHYIRELRLRRKSMEAVKKQTRAFEDGKNGNLEELKNLEE  149

Query  164  EIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            E   ++ K+K+LES+ + + ++V A + NS + + QSE  LLEY +LLEENQ+L
Sbjct  150  ETRVLREKVKQLESDLDTRTKDVHAAEANSVALRKQSEGFLLEYDRLLEENQNL  203



>ref|NP_001170289.1| LOC100384252 [Zea mays]
 gb|ACG36076.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|AFW71005.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=220

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES-----INPTDQVLLA  351
            ++ +DR KRGR  P+VVK+VA  +  L+  T+YS+ +I     +S       PTDQVL +
Sbjct  30   VLVIDRLKRGRHAPVVVKTVAGVILALLASTLYSMTQIAGSTSDSDSGGGPTPTDQVLFS  89

Query  350  QQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSL  171
            + +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+G  EE    
Sbjct  90   RHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKHGNSEEAKKY  149

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LLE+NQHL
Sbjct  150  QEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLEDNQHL  205



>ref|XP_003580219.1| PREDICTED: B-cell receptor-associated protein 31-like [Brachypodium 
distachyon]
Length=221

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            ++++DR+KRGRGP++ ++VAAT+F+++  + YS+ +I+ R      + PTDQVL ++ +L
Sbjct  30   LLAVDRSKRGRGPIMARTVAATMFMVLGSSGYSIAKIRRREGDFAQLTPTDQVLASRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL L+IDRLHHYIR++R ++K+MEA  K  +  +  K  G EE+   +++I
Sbjct  90   EASLMGYSLFLGLVIDRLHHYIRQIRTMKKSMEAVTKQSKTLEEAKLQGAEEIQGYQKKI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +S+  +++ ++ + E K EE+K  + N+ + + QSE LL EY +L+ EN+ L
Sbjct  150  SSLNEQVQAVKHQYETKTEELKTAEANTLALRKQSEGLLTEYERLIAENEEL  201



>ref|XP_008371075.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=222

 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 143/196 (73%), Gaps = 3/196 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
             V   EM +IL  LFKTP RKL+I+ LD+ KRGRGP+VV +VAATVFV+++  VY   +I
Sbjct  7    VVILXEMVMILAFLFKTPFRKLVILGLDQIKRGRGPVVVATVAATVFVVLMTNVYGXVKI  66

Query  401  QSRPLES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            ++  ++    ++PTDQVLL + +L A+LMG  LFL+LMIDRLHHYIRELR  RK+MEA K
Sbjct  67   RASRIDKAAVLSPTDQVLLIKHLLDATLMGCSLFLALMIDRLHHYIRELRJRRKSMEALK  126

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
            K +RG ++GK+  ++++   + E+A++++++K+LES+ E K ++V   + N  + + QSE
Sbjct  127  KQNRGSEDGKSSILDQMKVSENEMATLRARLKQLESDIETKTKDVHTAESNVLALRKQSE  186

Query  50   KLLLEYGQLLEENQHL  3
              LLEY +LLEENQ L
Sbjct  187  GFLLEYDRLLEENQKL  202



>ref|NP_001057612.2| Os06g0367500 [Oryza sativa Japonica Group]
 dbj|BAD69146.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF19526.2| Os06g0367500 [Oryza sativa Japonica Group]
Length=199

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 125/179 (70%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--------SINPTDQVL  357
            ++ LDR KRGRGP++V++VAATV V++  +V+S+ +I+ R           ++ PTDQVL
Sbjct  1    MLGLDRLKRGRGPVMVRTVAATVLVVLASSVHSMNKIRGRAAGELDGAGAGTLTPTDQVL  60

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-NGGVEEV  180
            LA+ +L+ASLMG+ LFL+L+IDRLH+YIRE+R L++ +EAA K ++  D  K  G  +E 
Sbjct  61   LARHLLEASLMGYSLFLALVIDRLHNYIREVRGLKRNLEAASKLNKTLDEAKLIGSSDES  120

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             + +++IAS+  +IKK++ + + K  E K  +  + + + QSE L++EY  L+E+N+HL
Sbjct  121  KTYQKDIASLNEEIKKMKRQLKEKANEAKDAEAKALAAQKQSEGLMIEYNHLVEDNKHL  179



>ref|XP_004952370.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=219

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES-----INPTDQVLLA  351
            ++ LDR KRGR  P+ VK+VA     L+  T+YS+ EI  R  +      + PTDQVL +
Sbjct  30   VLGLDRLKRGRRAPVAVKTVAGVFLALLASTLYSMAEISGRASDPDSGGGLTPTDQVLFS  89

Query  350  QQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSL  171
            + +L+ASLMG+ LFL L+IDRLH YIR+LR  +K +EA  KH+   +  K G  EE    
Sbjct  90   RHLLEASLMGYTLFLMLVIDRLHQYIRDLRGFKKNLEAVSKHNNMLEEAKVGISEETKKY  149

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +EEIA++  ++ KL+ + + K EEV   +D + + + QSE LL+EY +LLE+NQHL
Sbjct  150  QEEIANLNKEMNKLKLQVQEKTEEVHVAEDKALAIQKQSEGLLIEYDRLLEDNQHL  205



>gb|KHG00718.1| separin [Gossypium arboreum]
 gb|KJB67240.1| hypothetical protein B456_010G182000 [Gossypium raimondii]
Length=160

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 124/156 (79%), Gaps = 4/156 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMAVI++L FKTPLRKL+++ LDRAKRGRGP++VK+V  TV V+M+  ++S+  +
Sbjct  7    TVIFAEMAVIIVLCFKTPLRKLVLMVLDRAKRGRGPVIVKTVGGTVSVVMLSYIFSMMML  66

Query  401  QSRPLESINP--TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R +   N   TD++L+A+ +L+ +LMG +LFLSL+ID+LHHYI+ELR+ RK ME AKK
Sbjct  67   KKRWIVDGNASLTDEILMAKNLLETTLMGGLLFLSLIIDKLHHYIKELRIRRKTMETAKK  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESE  120
              +GF++   GG ++V +L+EEIA+++++IK+LES+
Sbjct  127  QGQGFEDA--GGSDKVTALEEEIATLRARIKQLESD  160



>ref|NP_001154328.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AEE28812.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=220

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ
Sbjct  8    VVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E   +NPTD+V++A+ +L+++LM  VL L L++  LHHY+RELR+ RK ME  KK 
Sbjct  68   KRWIEDGVVNPTDEVIMAKHLLESTLMVRVLELCLLLW-LHHYMRELRIRRKNMEVIKKE  126

Query  224  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  45
                +  K  G++EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  
Sbjct  127  GALLEGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGF  186

Query  44   LLEYGQLLEENQHL  3
            L+E+ +LLEENQ L
Sbjct  187  LIEFNRLLEENQVL  200



>dbj|BAJ86435.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            ++++D +KRGRGP++ ++VAAT+ V++  + YS+ +I+ R  E   + PTDQVL ++ +L
Sbjct  30   LLAVDCSKRGRGPVMARTVAATMLVVLGSSGYSIAKIRRREGEFAQLTPTDQVLASRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +ASLMG+ LFL L+IDRLHHYIR+LR ++K MEA  K  R  +  K G  EE+   +++I
Sbjct  90   EASLMGYSLFLGLIIDRLHHYIRQLRAMKKNMEAVTKQSRVLEETKLGDSEEIQRYQKKI  149

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             S+  +++ L+ + E++ EE+K  + N+ + + QSE LL EY +L+ EN+ L
Sbjct  150  DSLNEQVQALKHQSESQTEELKTAEINNLALRKQSEGLLTEYERLIAENEEL  201



>ref|XP_006847259.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
 gb|ERN08840.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
Length=219

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVLLAQQIL  339
            ++ LDR KRGRGP VVK++A TVFV+++ +V SV +IQ R   + SI PTDQVL+++ +L
Sbjct  30   LLGLDRVKRGRGPAVVKTLATTVFVVLVSSVNSVMKIQRRASAVGSITPTDQVLMSKHML  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            +AS+MG+ LFL+LMIDR+HH++ ELR+LRK + ++ +      +G N       +L+E+I
Sbjct  90   EASMMGYALFLTLMIDRMHHHMTELRILRKQIRSSGEGKSAGGSGDNSNSNR-RALEEDI  148

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            A+++ K+K+L+ E EAK  E K  + N+ + + QSE  LLEY +LLE+NQ+L
Sbjct  149  AALQEKVKELQLESEAKDREAKTAETNAMALRKQSEGFLLEYDRLLEDNQNL  200



>ref|XP_003563854.1| PREDICTED: B-cell receptor-associated protein 29 [Brachypodium 
distachyon]
Length=226

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 122/177 (69%), Gaps = 7/177 (4%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP----LES---INPTDQVLL  354
            +++LDR KRG+GP++V++VAATV V++  +++S+ +I        L++   + PTDQVLL
Sbjct  30   MLALDRLKRGKGPVMVRTVAATVLVVLASSLHSMAKIHGHASGGELDAPGALTPTDQVLL  89

Query  353  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS  174
            A+ +L+ASLMG+ LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  K    +    
Sbjct  90   ARHLLEASLMGYSLFLALIIDRLHRYIREMRGLKKNLEAVSKQNKTLEEVKLVTSDGSKP  149

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             +++IAS+  +IKKL  + + K +EVK  +  + + + QSE L+L+Y +LLE+ +HL
Sbjct  150  YQKDIASLNEEIKKLRLQLKEKADEVKDAEARAVAAQTQSEGLMLKYDRLLEDKKHL  206



>gb|ADE75913.1| unknown [Picea sitchensis]
Length=228

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            LD+ K G+G  +VK++  T+ V++  ++ S+ +IQ+R ++  +I PTDQ+L+   +L+AS
Sbjct  34   LDQTKTGKGSAIVKTLGGTMLVILASSITSILKIQTRSVKMGTIAPTDQILMRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD------NGKNGGVEEVNSLK  168
            LMGF LFL+++IDRLHHYIREL  LR  ME+ +K  +           +  G  E+  LK
Sbjct  94   LMGFALFLAIIIDRLHHYIRELSGLRMNMESLRKQAKSSQEEYFRLKEEKEGSNEMTLLK  153

Query  167  EEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +EIA +K K++KL  E + K  E +  + N+ + + QSE  LLEY +LLE+NQ+L
Sbjct  154  DEIADLKQKLQKLTLESKEKEREAEVAESNALALRKQSEGFLLEYDRLLEDNQNL  208



>ref|XP_002453641.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
 gb|EES06617.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
Length=222

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -3

Query  512  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI-------NPTDQVL  357
            ++ +DR KRGR  P+VVK+VA  V  L+  T+YS+ +I     +S         PTDQVL
Sbjct  30   VLVVDRLKRGRHAPVVVKTVAGVVLALLASTLYSMSQISGGASDSDSGSGGGPTPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  177
             ++ +L+A LMG+ LFL+L+IDRLH YIR+LR+ +K +EA +KH++  +  K+G  E+  
Sbjct  90   FSRHLLEACLMGYSLFLALVIDRLHQYIRDLRVFKKDLEAVRKHNKMLEETKHGNSEDAK  149

Query  176  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              +EEIA +  ++KKL+ + + K EEV   +D + + + QSE LL+EY +LLE+NQHL
Sbjct  150  KYQEEIAILNKEMKKLKLQVQEKIEEVHVAEDKALTIQKQSEGLLIEYDRLLEDNQHL  207



>gb|AAC17626.1| Contains similarity to BAP31 protein gb|X81816 from Mus musculus 
[Arabidopsis thaliana]
 gb|ACB88825.1| At1g11905 [Arabidopsis thaliana]
Length=228

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 109/144 (76%), Gaps = 2/144 (1%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            V   E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ
Sbjct  8    VVLFEVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +E   +NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK 
Sbjct  68   KRWIEDGVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKE  127

Query  224  DRGFDNGKNGGVEEVNSLKEEIAS  153
                +  K  G++EV +L EEI S
Sbjct  128  GALLEGVKARGLDEVKNLMEEITS  151



>ref|XP_007215894.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
 gb|EMJ17093.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
Length=241

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 127/196 (65%), Gaps = 6/196 (3%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSVQEI-  402
            F EM +I+ LLF  P+ K  I+ LD  K  +G+G L+VK V  T+F++++   YSV  I 
Sbjct  21   FSEMVLIMTLLFDAPMTKTAILELDSLKLNQGKGLLIVKIVTGTLFLVLMANFYSVLRIT  80

Query  401  -QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
             ++R  E   +NPT++VL +  ILQ SL+G VLFL LMID LHHYIR L  L  AMEAAK
Sbjct  81   MKNRTNEGGGLNPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIRGLPSLVMAMEAAK  140

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
              ++ F   K   V+++N++ +E  ++++K+K LESEC+++  E    +  +E+ + +SE
Sbjct  141  TQNQSFRKEKTESVQKLNTMVQEKDTLRTKLKYLESECKSEANEANKARAEAEALRQESE  200

Query  50   KLLLEYGQLLEENQHL  3
            + L EY +LL +NQ+ 
Sbjct  201  EFLKEYDRLLADNQNF  216



>ref|XP_008229970.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=241

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 127/196 (65%), Gaps = 6/196 (3%)
 Frame = -3

Query  572  FGEMAVIllllfktplrklLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSV--QE  405
            F EM +I+ LLF TP+ K  I  LD  K  +G+G L+VK V  T+F++++   YS+    
Sbjct  21   FSEMVLIMTLLFDTPVTKTAISELDSLKLNQGKGLLLVKIVTGTLFLVVMANFYSLLRMN  80

Query  404  IQSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            +++R  E   +NPT++VL +  ILQ SL+G VLFL LMID LHHYI+ L  L  AMEAAK
Sbjct  81   MKNRTNEGSGLNPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIKGLPSLVMAMEAAK  140

Query  230  KHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  51
              ++ F   K G V+++N++ +E  ++++K+K LESECE++  E    +  +E+ + +SE
Sbjct  141  TQNQSFRKEKTGSVQKLNTMVQEKDTLRTKLKYLESECESEANEANKARAEAEALRQESE  200

Query  50   KLLLEYGQLLEENQHL  3
              L EY +LL +NQ+ 
Sbjct  201  GFLKEYDRLLADNQNF  216



>dbj|BAJ87002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLL  354
            +++LDR KRG+ P++V++VAATV V++  +++S+ +I             +++PTDQVLL
Sbjct  30   MLALDRLKRGQAPVMVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGALSPTDQVLL  89

Query  353  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS  174
            A+ +L+ASLMG++LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  ++G  +E   
Sbjct  90   ARHLLEASLMGYILFLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEARSGKSDESKP  149

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
               ++AS+  +IKKL+ + + K +E K  +  + + + QSE L  +Y  LLE+N+HL
Sbjct  150  HHNDMASLNEEIKKLKLQLKEKAQEAKDAEAKAVAAQTQSEGLARKYDSLLEDNKHL  206



>ref|XP_010247234.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ+R   L ++ P DQVL    +L+A
Sbjct  33   ALDQLKTGKGPATVKTIAGTMSVILASSITSLLKIQNRGTKLGTVTPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEVNS  174
            SLMG+ LFL  +IDRLHHY+++L  LR     +K       K        +    EE+  
Sbjct  93   SLMGYSLFLGFVIDRLHHYLQKLGGLRTTARYSKQEVEKLHKDHLQLKEKEVKASEEIKL  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+EEI+S+K  IKKL+ ECE K ++V++ + +  + + Q+E LLLEY +LLE+NQ+L
Sbjct  153  LQEEISSLKENIKKLKLECEEKDKQVQSAEAHVTALQKQAEDLLLEYDRLLEDNQNL  209



>ref|XP_006650891.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=217

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 114/174 (66%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +++AK+G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VEQAKQGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  171
            L+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   +     E+  L
Sbjct  94   LIGFTLFLAFVIDRLHHYLRKLVTLRKAANTSREEVEKLQMENRSFHEKEEKSSGEIKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            ++EIA +   +KKL+SE E   +     + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  QQEIAKLNESMKKLKSESEDHEKAALEAEAHVNALQKQSEELLLEYDRLLEDNQ  207



>ref|XP_009802750.1| PREDICTED: uncharacterized protein LOC104248228 [Nicotiana sylvestris]
Length=145

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 100/119 (84%), Gaps = 2/119 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F E+AV+L+L+F+TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ
Sbjct  8    LVFFEVAVVLILVFRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +R  ES  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  68   NRATESGTVNPTDQVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|NP_001051893.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|AAO37960.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99895.1| B-cell receptor-associated protein 31-like containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13807.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|EAZ29303.1| hypothetical protein OsJ_13364 [Oryza sativa Japonica Group]
 dbj|BAG90494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87435.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 113/174 (65%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  171
            L+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   +     E+  L
Sbjct  94   LIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEEKSSSEIKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
             +EIA +   +KKL+SE E    +V   + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  HQEIAKLNESMKKLKSESEDHERKVLEAEAHVNALQKQSEELLLEYDRLLEDNQ  207



>gb|EMS49195.1| hypothetical protein TRIUR3_29235 [Triticum urartu]
Length=183

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 109/163 (67%), Gaps = 7/163 (4%)
 Frame = -3

Query  470  VVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLLAQQILQASLMGFVL  312
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGALSPTDQVLLARHLLEASLMGYIL  60

Query  311  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  132
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K+G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKSGRSDESKPHHNDIASLNEEIKK  120

Query  131  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+ + + K EE K  +  + + + QSE L  +Y +LLE+N+HL
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLEDNKHL  163



>ref|XP_006479253.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
 gb|KDO65964.1| hypothetical protein CISIN_1g027820mg [Citrus sinensis]
Length=218

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHY+ +L  LR       + +E  +K      + +    +E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKEL  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+EEI+++   +KKL+SECE K ++++    +  + + QS  LLLEY +LLE+NQ+L
Sbjct  151  KRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNL  209



>gb|EMT32966.1| hypothetical protein F775_31670 [Aegilops tauschii]
Length=183

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 108/163 (66%), Gaps = 7/163 (4%)
 Frame = -3

Query  470  VVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLLAQQILQASLMGFVL  312
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPAALSPTDQVLLARHLLEASLMGYIL  60

Query  311  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  132
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKPGRSDESKPHHNDIASLNEEIKK  120

Query  131  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+ + + K EE K  +  + + + QSE L  +Y +LLE+N+HL
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLEDNKHL  163



>ref|XP_009381320.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381321.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381322.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381323.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 112/174 (64%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL    +++AS
Sbjct  34   LDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRGAKLGTVTPMDQVLWRTHLVEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+L+IDRLHHY+R+L  LR+        +E  KK  + F   +   + E+  L
Sbjct  94   LIGYTLFLALVIDRLHHYLRKLINLRRTANSSQEEVENLKKEQQRFKEKEETSLNEIKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
             EE+AS+K +++KL+SE     +  +  + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  HEEVASLKERLQKLKSESAEHEKRAETAEAHVTALQKQSEELLLEYDRLLEDNQ  207



>ref|XP_009599718.1| PREDICTED: uncharacterized protein LOC104095323 [Nicotiana tomentosiformis]
Length=145

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 100/119 (84%), Gaps = 2/119 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F E+AV+L+L+F+TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ
Sbjct  8    LVFFEVAVVLILVFRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +R  +S  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  68   NRATDSGTVNPTDQVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>gb|ACN36491.1| unknown [Zea mays]
Length=157

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  377  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  198
             PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+
Sbjct  18   TPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKH  77

Query  197  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  18
            G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LLE
Sbjct  78   GNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLE  137

Query  17   ENQHL  3
            +NQHL
Sbjct  138  DNQHL  142



>gb|EAY92582.1| hypothetical protein OsI_14323 [Oryza sativa Indica Group]
Length=217

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 112/174 (64%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  171
            L+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   +     E+  L
Sbjct  94   LIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEEKSSSEIKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
             +EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  HQEIAKLNESMKKLKSESEDHERKALEAEAHVNALQKQSEELLLEYDRLLEDNQ  207



>gb|KHG09837.1| hypothetical protein F383_09194 [Gossypium arboreum]
Length=218

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 117/179 (65%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEV  180
            +ASL+GF LFL  +IDR+HHYI++L  LR  + ++K+     +  +       +   +E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKEEAERIEKERIQLKEKDDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEEI+++   +KKL+SE E K +++K  + +  S + QS  LLLEY +LLE+NQ+L
Sbjct  151  KLLKEEISTLSENLKKLKSESEEKDKKIKTAEAHVASLQKQSADLLLEYDRLLEDNQNL  209



>ref|XP_006365288.1| PREDICTED: uncharacterized protein LOC102597522 [Solanum tuberosum]
Length=147

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F E+ VIL L+F+TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q
Sbjct  9    LVFLEVVVILTLIFRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQ  68

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
            +R  +S  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +E  KK 
Sbjct  69   NRATDSGTVNPTDQVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTLEGEKKT  128

Query  224  DRGFDNGKNGG  192
            ++  D  +N  
Sbjct  129  NQSRDQVENAA  139



>ref|XP_010927692.1| PREDICTED: B-cell receptor-associated protein 31-like [Elaeis 
guineensis]
Length=218

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 111/176 (63%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKSGKGPATVKTLACTLAVILVSSVTSILKIQNRGVKLGTVTPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+L+IDRLHHY R+L  LRK        +E  KK   GF   +    +E+  L
Sbjct  94   LIGYTLFLALVIDRLHHYHRKLITLRKIVGTSSEEVEKLKKEHHGFKEKEEKSSDEIKEL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            + E++++  K++KL+ E E + +     +    + + QSE+LLLEY +LLE+NQ L
Sbjct  154  QMEVSNLTEKLQKLKCEFEEQEKRAITAEAYVTALQKQSEELLLEYDRLLEDNQIL  209



>ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protein 31-like, partial 
[Nicotiana sylvestris]
Length=150

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  323  GFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKS  144
            GF LFL+ MIDRLHHYIREL + RK MEA +K +R F++GK+G  EE+ +L+EE ++++ 
Sbjct  24   GFSLFLAFMIDRLHHYIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRG  83

Query  143  KIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            KIK+LESE + K +E    + N+ + K QSE  LLEY +LLEENQ+L
Sbjct  84   KIKQLESELQVKAKEASGAEANAVALKKQSEGFLLEYDRLLEENQNL  130



>gb|EAZ03537.1| hypothetical protein OsI_25672 [Oryza sativa Indica Group]
 gb|EAZ39454.1| hypothetical protein OsJ_23885 [Oryza sativa Japonica Group]
Length=214

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 110/170 (65%), Gaps = 5/170 (3%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL    +L+AS
Sbjct  34   VEQAKDGKGPAAVKTLACTLLVIFMSSVASILRIQNRGIKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD---NGKNGGVEEVNSLKEEI  159
            L+G++LFL+ +IDRLHHY R+L +L+K    +++          GK    +EV  L+ E+
Sbjct  94   LIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQIELQGKEDKSKEVKKLRAEL  153

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            AS+  K+KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  ASLSEKMKKLKSESEEHERQRLEAEAHVNALQKQSEELLLEYDRLLEDNQ  203



>ref|XP_004248701.1| PREDICTED: uncharacterized protein LOC101261860 [Solanum lycopersicum]
Length=147

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F E+ VIL L+F+TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q
Sbjct  9    LVFLEVLVILTLIFRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQ  68

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
            +R  +S  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK ME  KK 
Sbjct  69   NRATDSGTVNPTDQVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTMEGEKKM  128

Query  224  DRGFD  210
            ++  D
Sbjct  129  NQNRD  133



>ref|XP_006830526.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
 gb|ERM97942.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
Length=220

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 114/176 (65%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            LD+ K GRGP  VK++A T+ V+M  ++ S+ +IQ+R L+  ++ P DQVL    +L+AS
Sbjct  34   LDQLKMGRGPATVKTLACTMAVIMASSITSILKIQNRGLKIGTVTPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN-------GKNGGVEEVNSL  171
            L+G+ LFL+L+IDR+H+Y+ +L   +K +  +K+  + F          +    EE+ +L
Sbjct  94   LIGYSLFLALVIDRMHNYLSKLSGSKKTLGNSKQQAKKFQEEYALLKEKQEKASEEIRAL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            KEEI+S+  +++KL+ E + K +  +A + N  + + QSE LLLEY +LLE+NQ L
Sbjct  154  KEEISSLTERLQKLKLESDEKEKRAQAAEANVIALQKQSEDLLLEYDRLLEDNQIL  209



>ref|XP_002463520.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
 gb|EER90518.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
Length=217

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 107/174 (61%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            + EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  QREIAKLNESMKKLKSETEEHERKASVAEAHVNALQKQSEELLLEYDRLLEDNQ  207



>gb|ACG43219.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|ACG44967.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 tpg|DAA52496.1| TPA: b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 110/176 (63%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKRL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            + EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LLE+NQ L
Sbjct  154  QREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLEDNQIL  209



>ref|XP_009371858.1| PREDICTED: B-cell receptor-associated protein 31 [Pyrus x bretschneideri]
Length=219

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           +N   +E+
Sbjct  91   EASLMGFTLFLGFVIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKENKSSQEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KELQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLEDNQNL  209



>gb|KJB26033.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=202

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL    +L
Sbjct  17   IKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVLWRTHLL  76

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +    E+
Sbjct  77   EASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDDKASLEI  136

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LLE+NQ+L
Sbjct  137  KKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLEDNQNL  195



>gb|KJB10919.1| hypothetical protein B456_001G232500 [Gossypium raimondii]
Length=218

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEV  180
            +ASL+GF LFL  +IDR+HHYI++L  LR  + ++K      +  +       +   +E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKDEAERIEKERIQLKEKDDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEEI+++   +KKL+SE E K ++++  + +  S + QS  LLLEY +LLE+NQ+L
Sbjct  151  KLLKEEISTLSENLKKLKSESEEKDKKIEIAEAHVASLQKQSADLLLEYDRLLEDNQNL  209



>gb|KJB26032.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=216

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +    E+
Sbjct  91   EASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDDKASLEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LLE+NQ+L
Sbjct  151  KKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLEDNQNL  209



>ref|XP_008380294.1| PREDICTED: uncharacterized protein LOC103443257 [Malus domestica]
Length=150

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+   EMA+IL LLF+TPLRKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +
Sbjct  7    TLVLAEMALILSLLFRTPLRKLVIVGLDRSKQGRGPLVXKSVGGTILVFFSSTIYSVFSV  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  E+  +NPTD+VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLR+ +E  K 
Sbjct  67   QKRLSEAGFVNPTDEVLMAHRLLEASLIGFSLFLAMIIDRLHYYIKELHLLRERVEEVKN  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIA  156
              + +++ K+    EV    + I+
Sbjct  127  LKKDYEHKKSTDPAEVKKATQRIS  150



>ref|XP_006452411.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475037.1| PREDICTED: uncharacterized protein LOC102621381 [Citrus sinensis]
 gb|ESR65651.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=131

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F EMA+IL LLF+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ
Sbjct  8    IVFTEMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R  E  +INPT++VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E  K  
Sbjct  68   RRAREGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEGLKNL  127

Query  224  DR  219
            ++
Sbjct  128  NK  129



>ref|XP_006657620.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=214

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 109/170 (64%), Gaps = 5/170 (3%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL    +L+AS
Sbjct  34   VEQAKDGKGPAAVKTLACTLLVIFMSSVTSILRIQNRGAKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN---GKNGGVEEVNSLKEEI  159
            L+G++LFL+ +IDRLHHY R+L +L+K    +++      N   GK    +E+  L+ E+
Sbjct  94   LIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQNELQGKEDNSKEIKKLRGEL  153

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            A++  K+KKL+ E E         + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  ATLSEKMKKLKFESEEHERRRLEAEAHVNALQKQSEELLLEYDRLLEDNQ  203



>ref|XP_010069636.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW58050.1| hypothetical protein EUGRSUZ_H00780 [Eucalyptus grandis]
Length=218

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 115/177 (65%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            SL++ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLEQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEVNS  174
            SLMGF LFL  +IDR+HHY+++L  LR       + +E+ +K        +   ++E+  
Sbjct  93   SLMGFTLFLGFVIDRVHHYLQKLITLRSKEGVSKEEVESLRKEQLELKEKEGKSLKEIKQ  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L++EI++M   +KKL+ ECE K ++V+  + +  + + QS  LLLEY +LLE+NQ+L
Sbjct  153  LQKEISNMLEGLKKLKLECEEKDKKVETAESHVAALQKQSADLLLEYDRLLEDNQNL  209



>ref|XP_011095414.1| PREDICTED: uncharacterized protein LOC105174881 [Sesamum indicum]
Length=149

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 106/140 (76%), Gaps = 8/140 (6%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + FGE+ VILLLLF+TPLRK L++ LDR K+GRGP+V  + A T+FV+M+  ++++  IQ
Sbjct  8    LVFGEVFVILLLLFRTPLRKPLLLLLDRLKQGRGPIVSSTAAGTLFVIMVSILFNITSIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R +ES  +NPTDQVLLA Q+L+ASL+GF LFL LMIDR+H+YI+E+R+LRK +EA K+ 
Sbjct  68   KRSMESASVNPTDQVLLANQLLEASLLGFALFLWLMIDRIHYYIKEVRMLRKHLEAVKRM  127

Query  224  D------RGFDNGKNGGVEE  183
            D      R  + GK+  VEE
Sbjct  128  DQKSEEVRSKEKGKSKAVEE  147



>ref|XP_008809940.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=218

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 113/174 (65%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGVKLGTVTPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL L+IDRLHHY+R++  L+K +  +       KK    F + ++    E++ L
Sbjct  94   LIGYTLFLGLVIDRLHHYLRKMVSLKKTVGTSKEEVEKLKKEHHYFKDKEDKVSSEIHKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            + E+ S+  K++KL++ECE + +   + + +  S + QSE+LLLEY +LLE+NQ
Sbjct  154  QGEVGSLTEKLQKLKTECEQQEKRAVSAEAHVVSLQKQSEELLLEYDRLLEDNQ  207



>ref|NP_001141677.1| uncharacterized protein LOC100273803 precursor [Zea mays]
 gb|ACF86841.1| unknown [Zea mays]
Length=217

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 109/176 (62%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSGVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKRL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            + EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LLE+NQ L
Sbjct  154  QREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLEDNQIL  209



>ref|XP_009370674.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009334907.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=218

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K       K        +    +EV
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKETMQLKKQEEKASQEV  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+ +I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KQLQAKISTLTEDLKKLKLECAEKDKSIETAECHVASLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_003532279.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN10978.1| hypothetical protein glysoja_026713 [Glycine soja]
Length=218

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVLWRSHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR HHY+++L  LR       + +E  KK             +E+
Sbjct  91   EASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEELENLKKETVQLKEKDEKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEE++ +   ++K++SE E K ++V+  + +  S + Q+  LLLEY +LLEENQ+L
Sbjct  151  KQLKEELSCLSKSLEKIKSESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEENQNL  209



>ref|XP_007049723.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
 gb|EOX93880.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
Length=213

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  +K++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATMKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+R+L  LR  + ++K       K         +   +E+
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLRKLIGLRSKVGSSKEEVERLQKERIELKEKDDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEEI+++   +KKL+ E E K ++++  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KLLKEEISTLSENLKKLKLESEEKDKKIETAEAHVASLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_008385961.1| PREDICTED: uncharacterized protein LOC103448478 [Malus domestica]
Length=155

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+   EMA+IL LLF+TP+RKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +
Sbjct  7    TLVLAEMALILSLLFQTPVRKLVIVGLDRSKQGRGPLVAKSVGGTILVFFSSTIYSVFSV  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  231
            Q+R  E+  +NPTD+VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLRK +E  K
Sbjct  67   QNRLTETGFVNPTDEVLMAHRLLEASLIGFSLFLAMVIDRLHYYIKELXLLRKRVEEVK  125



>gb|KDO62065.1| hypothetical protein CISIN_1g045614mg, partial [Citrus sinensis]
Length=123

 Score =   117 bits (294),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F EMA+IL LLF+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ
Sbjct  8    IVFTEMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEA  237
             R  E  +INPT++VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E 
Sbjct  68   RRAREGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEG  123



>ref|XP_008226862.1| PREDICTED: uncharacterized protein LOC103326424 [Prunus mume]
Length=153

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 2/133 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            +   EMA+IL LLF+TPLR L+I+ LDR+K+GRGPLV KSV  TV V    T+Y V  +Q
Sbjct  8    LVLAEMALILSLLFRTPLRTLVIVGLDRSKQGRGPLVAKSVGGTVLVFFSSTLYGVFSVQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R  E+  +NPTD+VL+A ++L+ASL+GF LFL L+IDRLH+YI+EL LLRK  E  K  
Sbjct  68   KRLTEAGFVNPTDEVLMAHRLLEASLIGFSLFLVLIIDRLHYYIKELNLLRKFNEEIKNL  127

Query  224  DRGFDNGKNGGVE  186
               F+  KN   E
Sbjct  128  KNDFEQRKNADAE  140



>ref|XP_008372494.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=219

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           ++   +E+
Sbjct  91   EASLLGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKEDKSSQEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KQLQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_008382607.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++  +K+  DR           +    +EV
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLSKLIGLRXSVGXSKEELDRLQKETIQLKEKEEKASQEV  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+ +I+++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KQLQAKISTLTEDLKKLKLECAEKDKSVETAECHVASLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_009410623.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410624.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410625.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410626.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410627.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410629.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 108/174 (62%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRAAKLGTVTPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLL-------RKAMEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+L+IDRLHHY+R+L  L       R+ ++  KK  + F   +   + E   L
Sbjct  94   LIGYTLFLALVIDRLHHYLRKLVSLKTTVGTSREEVDNLKKEQQSFKEKEKTSLSERKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
             EE+  +K +++KL+ + E   +  +  + +  + + QSE+LLLEY  LLE+NQ
Sbjct  154  HEEVTRLKERLQKLKLDSEEHEKRAQTAEAHVAALQKQSEELLLEYDHLLEDNQ  207



>ref|XP_008794596.1| PREDICTED: B-cell receptor-associated protein 31 [Phoenix dactylifera]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 114/177 (64%), Gaps = 11/177 (6%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ V+++ +V ++ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKSGKGPATVKTLACTLSVILVSSVATILKIQNRGVKLGTVTPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK--------KHDRGFDNGKNGGVEEVNS  174
            L+G+ LFL+L+IDRLHHY+++L  LRK +  ++        +H R F   +    +E+  
Sbjct  94   LIGYSLFLALVIDRLHHYLQKLINLRKTVGTSREEVEKLKMEHHR-FKEKEEKSSDEIKK  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+ E++++  K++KL+SE E + +     +    S + QSE+LLLEY +LLE+NQ L
Sbjct  153  LQVEVSNLTEKLQKLKSEFEEQEQRAITAEAYVASLRKQSEELLLEYDRLLEDNQIL  209



>gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Erythranthe guttata]
Length=149

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 108/140 (77%), Gaps = 8/140 (6%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + FGE+AVIL+LLF+TPLRK L+I LDR K+GRGP+V  +   T+FV+M+  +Y++  IQ
Sbjct  8    LVFGEVAVILVLLFRTPLRKPLLILLDRLKQGRGPVVATTAGGTLFVIMVSLLYNITTIQ  67

Query  398  SRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
            +R LE+  +NPTDQVLLA Q+L+ASL+GF LFL+LMIDR+H+YIRE+R+LRK MEA KK 
Sbjct  68   NRSLEAGGVNPTDQVLLANQLLEASLLGFALFLALMIDRIHYYIREVRMLRKHMEAIKKS  127

Query  224  DRGF------DNGKNGGVEE  183
            D+        D GKN  VE+
Sbjct  128  DQESEELKIKDKGKNKVVED  147



>ref|XP_004981056.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=217

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 109/176 (62%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  S++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLTVILMSDVASILKIQNRGLKLGSVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  ++     +     E+  L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENQSLREKEGNSSGEMKKL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            + EIA +   +KKL+ E E    +  A + +  + + QSE+LLLEY +LLE+NQ L
Sbjct  154  QREIAKLNESMKKLKFENEEHERKASAAEAHVNALQKQSEELLLEYDRLLEDNQIL  209



>gb|KDP26363.1| hypothetical protein JCGZ_17521 [Jatropha curcas]
Length=216

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK---NGGVE----EVNS  174
            SLMGF LFL  +IDR+HHY+ +L  LR  + ++K+        K    G  E    E+  
Sbjct  93   SLMGFTLFLGFIIDRMHHYLTKLISLRSNIGSSKEEVERLQKEKMQLKGKAEKASTEIKQ  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+E+I+++   +KKL+ E E K ++++  + +  + + QS  LLLEY +LLEENQ+L
Sbjct  153  LQEQISTLSESLKKLKLENEEKDKQIETAEAHVVALQKQSADLLLEYDRLLEENQNL  209



>ref|XP_009361097.1| PREDICTED: uncharacterized protein LOC103951454 [Pyrus x bretschneideri]
Length=153

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+   EMA+IL LLF+TPLRKL+I+ LDR+K+GRGPLVVKSV  T+ V    T+YSV  +
Sbjct  7    TLVLAEMALILSLLFRTPLRKLVIVGLDRSKQGRGPLVVKSVGGTILVFFSSTIYSVFSV  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            Q R  E+  +NPTD+VL+A ++L+ASL+GF LFL+++IDRLH+ I+ELRLLR  +E  K 
Sbjct  67   QKRLSEAGFVNPTDEVLMAHRLLEASLIGFSLFLAMIIDRLHYSIKELRLLRGLVEEVKN  126

Query  227  HDRGFDNGKNGGVEEVNSLKEEIA  156
              +  ++ K+    EV    + I+
Sbjct  127  LKKDDEHRKSTAPAEVKKATQMIS  150



>ref|XP_007140653.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
 gb|ESW12647.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
Length=218

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+++L  LR +  A+       +K             +E+
Sbjct  91   EASLMGFALFLGFLIDRIHHYLQKLVNLRSSTRASNEDLENLRKETVQLKGKGEKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEE++ +   +K ++ E E K ++V+  + +  S + Q+  LLLEY +LLEENQ+L
Sbjct  151  KQLKEELSRVSESLKNIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEENQNL  209



>ref|XP_008802267.1| PREDICTED: B-cell receptor-associated protein 29-like [Phoenix 
dactylifera]
Length=221

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 108/174 (62%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            LD+ K G+GP +VK++A T+ V++  ++  +  IQ+R L+  S+ PTDQVL    +L+AS
Sbjct  34   LDKLKTGKGPAMVKALACTLSVILASSITGILRIQNRGLKLGSVTPTDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+L+IDRLHH ++++  LRK        +E  KK    F + +     E   L
Sbjct  94   LIGYTLFLALLIDRLHHCLQKVINLRKTVGTSRDEVEKLKKEHHHFKDEEEKSSNERTEL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            +EE+ ++  K++KL+SE E   +     + +  + + Q EKLLLEY +LLE+NQ
Sbjct  154  REEVCNLTEKLQKLKSEIEELKKRALTAEAHVAALQKQFEKLLLEYDRLLEDNQ  207



>ref|XP_006452412.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 gb|ESR65652.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = -3

Query  578  VAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQ  399
            + F EMA+IL LLF+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ
Sbjct  8    IVFTEMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQ  67

Query  398  SRPLE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH  225
             R  E  +INPT++VL+A  +LQASLMGF LFL++M+DRLH YI+  ++L + +   K+H
Sbjct  68   RRAREGGAINPTEEVLMANLLLQASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQH  127

Query  224  DR  219
            ++
Sbjct  128  NQ  129



>ref|XP_003552124.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
 gb|KHN41384.1| hypothetical protein glysoja_032570 [Glycine soja]
Length=218

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR HHY+++L  LR       + +E  KK             +E+
Sbjct  91   EASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEELENLKKETVQLKEKDEKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKEE++ +   ++K++ E E K ++V+  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KQLKEELSHLSKSLEKIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_003562352.1| PREDICTED: B-cell receptor-associated protein 31 [Brachypodium 
distachyon]
Length=217

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQA  333
            ++++ K G+GP  VK++A T+ V+ + +V S+ +IQ+R L+  +++P DQVL    +L+A
Sbjct  33   TVEQVKTGKGPATVKTLACTLSVIFMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNS  174
            SL+G+ LFL+ +IDRLHHY+++L  LRK    +++        +R F   +     E+  
Sbjct  93   SLIGYTLFLAFVIDRLHHYLQKLITLRKTANTSREEVEKLQMENRSFREKEEKSSSEIKK  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+++IA +   +KK++SE +    +    + +  + + QSE+LLLEY +LLE+NQ L
Sbjct  153  LQQDIAKLTEGMKKMKSESDDNERKALEAEAHVNALQKQSEELLLEYDRLLEDNQIL  209



>ref|XP_007134124.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
 gb|ESW06118.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
Length=219

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 110/179 (61%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKTLDQMKMGKGPATVKTIAGTMSVILFSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+++L  LR    A+K+               +    +E+
Sbjct  91   EASLMGFTLFLGFIIDRVHHYLQKLNKLRSNAGASKEEVESIEKEKVELKEKEEKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LKE+I+ +   +KK + ECE K + V+  + +  S + Q+  LLLEY +LLEENQ+L
Sbjct  151  MQLKEQISGLSESLKKTKVECEEKDKRVETAEVHVTSLQKQAADLLLEYDRLLEENQNL  209



>ref|XP_002303054.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
 gb|ABK95486.1| unknown [Populus trichocarpa]
 gb|EEE82327.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
Length=218

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+ +L  LR+++ ++K       K        ++    E+
Sbjct  91   EASLMGFTLFLGFLIDRMHHYLSKLIGLRRSVGSSKEEVERLQKEKMQLKEKEDKASMEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L E+I+++   +KKL+ E E K +++K  + +  S + Q   LLLEY +LLE+NQ+L
Sbjct  151  KLLLEQISTLSENLKKLKLESENKDKQIKTAEAHVVSLQKQCADLLLEYDRLLEDNQNL  209



>ref|XP_002266257.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=218

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 109/176 (62%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ++   L ++ P DQVL    +L+ S
Sbjct  34   LDQVKMGKGPATVKTIAGTMSVILLSSVTSILKIQNKGAKLGTMTPMDQVLWRTHLLETS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEVNSL  171
            LMGF LFL  +IDR+HHY+++L  LR    A+K       K        +    +E+  L
Sbjct  94   LMGFSLFLGFLIDRMHHYLQKLNRLRGNAGASKEEFEKLQKERAQLKEKEEQASKEIKLL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +E+I+++   +KKL+ E E K ++V+  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  154  QEQISTLTQDLKKLKLEAEEKDKKVETAEAHVVSLQKQAADLLLEYDRLLEDNQNL  209



>gb|ACG37455.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=216

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 106/173 (61%), Gaps = 8/173 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-SINPTDQVLLAQQILQASL  327
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+ +++P DQVL    +L+ASL
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLTVSPMDQVLWRTHLLEASL  93

Query  326  MGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSLK  168
            +G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     +     E   L+
Sbjct  94   IGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSGETKRLQ  153

Query  167  EEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
             E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  REVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLEDNQ  206



>ref|XP_008460368.1| PREDICTED: B-cell receptor-associated protein 31-like [Cucumis 
melo]
Length=219

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL   Q+L
Sbjct  31   IKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLWRTQLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +    +++
Sbjct  91   EASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEKCSKQI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+EEI+ +   +KK++ E E K + ++    +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KELREEISILSENLKKVKQESEEKDKRIETADAHVTSLQKQAADLLLEYDRLLEDNQNL  209



>ref|NP_001136567.1| uncharacterized LOC100216689 precursor [Zea mays]
 ref|XP_008645522.1| PREDICTED: LOW QUALITY PROTEIN: B-cell receptor-associated protein 
31-like [Zea mays]
 gb|ACF82188.1| unknown [Zea mays]
 gb|AFW66986.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 106/174 (61%), Gaps = 9/174 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSGETKRL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
            + E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LLE+NQ
Sbjct  154  QREVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLEDNQ  207



>ref|XP_011011172.1| PREDICTED: uncharacterized protein LOC105115831 [Populus euphratica]
Length=218

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V++  ++ S+ +IQS+   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKGPATVKTIAGTMSVILFSSLMSIVKIQSKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK------NGGV-EEV  180
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++ ++K+        K       G V +E+
Sbjct  91   EASLMGFTLFLGFLIDRMHHYLSKLIGLRSSVGSSKEEVERLQKEKMQLKEEEGKVSKEM  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+E+ +++   +KKL+ E E K ++++  + +  +   +S  LLLEY +LLE+NQ+L
Sbjct  151  KLLQEQFSTLSENLKKLKLESEQKDKQIETAEAHVVALHKRSADLLLEYDRLLEDNQNL  209



>ref|XP_010685051.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 115/177 (65%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKNGGVEEVNS  174
            SLMGF LFL  +IDR+HHY+R+L  +R  + ++       +K  +   + +    +E+ +
Sbjct  93   SLMGFTLFLGFLIDRMHHYLRKLINIRSKVGSSKEEVEKLEKEKQQLKDKEEKASKEITA  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L++E++ + +++KKL+ E + K + ++    +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  153  LQDELSKVSNEVKKLKIESQEKDKTIETADAHVVALQKQAADLLLEYDRLLEDNQNL  209



>emb|CDP15777.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            ++ +D+ K+GRGP+V K+VA T+F++ I T+ ++ +IQ+R +E  +INPTDQ+LL   IL
Sbjct  30   VMMVDKMKQGRGPVVAKTVAGTLFMIFISTLNNIMKIQNRAVEAGTINPTDQILLVNHIL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  210
            +A L+GF LFL +MIDRLH+YI+EL  LRK++EA KK +   D
Sbjct  90   EAILLGFSLFLGVMIDRLHYYIKELHRLRKSLEATKKSNYETD  132



>ref|XP_004144386.1| PREDICTED: uncharacterized protein LOC101213598 [Cucumis sativus]
 ref|XP_004162649.1| PREDICTED: uncharacterized LOC101213598 [Cucumis sativus]
 gb|KGN58366.1| hypothetical protein Csa_3G629240 [Cucumis sativus]
Length=219

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL   Q+L
Sbjct  31   IKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLWRTQLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +    +++
Sbjct  91   EASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEKCSKQI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+EEI+ + + +KK++ E   K + ++    +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KELREEISILSANLKKVKQESVEKDKRIETADAHVTSLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_010099686.1| hypothetical protein L484_025117 [Morus notabilis]
 gb|EXB80263.1| hypothetical protein L484_025117 [Morus notabilis]
Length=216

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K  RG ++  ++A T+F + + + +S+ +IQ+R   L S++P DQVL    +L
Sbjct  31   IKSLDQLKMKRGTVL--TIAGTMFAIFMSSFFSIVKIQNRGAKLGSMSPMDQVLWRTHLL  88

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHYIR+L  LR +       +E  +K        +    +E+
Sbjct  89   EASLMGFTLFLGFIIDRMHHYIRKLIGLRSSVGSSKEELEKLQKEKMQLKEKEQKYSKEI  148

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              LK+E++++   +KKL+ + E K ++V+  + + ++ + Q+  LLLEY +LLE+NQ+L
Sbjct  149  KLLKDEVSTLSESLKKLKIKSEEKDKKVETAEAHVQALQKQAADLLLEYDRLLEDNQNL  207



>gb|KHN38264.1| hypothetical protein glysoja_003929 [Glycine soja]
Length=154

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  339
            +I LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPTD+VL+A ++L
Sbjct  30   VIGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDASIVNPTDEVLMAHRLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  201
            +A+ +GF LFL L+IDR H+YIRE+ LLRK +E  KK +   D+ K
Sbjct  90   EAAFLGFSLFLGLVIDRQHYYIREINLLRKNLETWKKRNHNHDSLK  135



>ref|XP_006281079.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
 gb|EOA13977.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
Length=217

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V++   + ++ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILFSNLMNIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN-------GGVEEV  180
            +ASL+G VLFL  +IDR+HHY+ +L  LR    ++K+     +  +           +E+
Sbjct  91   EASLLGVVLFLGFIIDRMHHYLSKLINLRSNAGSSKEELEQLEKERTELKEKDEKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+E ++S+  K+KK E+E + K ++++  + + E+ + QS +LLLEY +LLE+NQHL
Sbjct  151  KKLQENLSSILEKLKKAEAESKEKDKKLETAETHVEALQKQSAELLLEYDRLLEDNQHL  209



>gb|KHN11907.1| hypothetical protein glysoja_019880 [Glycine soja]
Length=139

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQAS  330
            LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPTD+VL+A ++L+A+
Sbjct  33   LDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDAGIVNPTDEVLMAHRLLEAA  92

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
             +GF LFL L+IDR H+YIRE+ LLRK ME AKK
Sbjct  93   FLGFSLFLGLVIDRQHYYIREINLLRKNMETAKK  126



>ref|XP_004295837.1| PREDICTED: uncharacterized protein LOC101305253 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EM +IL LLF++PLR+L+I+ LD +K+GRGPLV KSV  T+ V  I T+YSV  +
Sbjct  7    TIVFAEMVLILSLLFRSPLRQLVIMGLDCSKQGRGPLVAKSVGGTILVFFISTIYSVFNV  66

Query  401  -QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRK  249
             + R  E+  INPT++VL+A +IL+ASL GF LFL+LMIDRLH+YI+EL  LRK
Sbjct  67   HKKRSTEAGFINPTNEVLMAHRILEASLTGFSLFLALMIDRLHYYIKELYRLRK  120



>ref|XP_004491710.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=218

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 110/177 (62%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKNGGVEEVNS  174
            SL+GF LFL  +IDR+HHY+++L  LR  M A+K+               +    +E+  
Sbjct  93   SLIGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKETMEFKEKEEKASKEIKQ  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            LK+E++++   +KK + E E K + V+  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  153  LKKELSTLSEGLKKAKMESEEKDKRVETAESHVASLQKQAADLLLEYDRLLEDNQNL  209



>gb|KEH22623.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=218

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 111/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            SLD+ K G+ P  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKMGKAPATVKTIAGTMFVILLSSLMSLVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKNGGVEEVNS  174
             L+GF LFL  +IDR+HHY+++L  LR  M A+K+               +    +E+  
Sbjct  93   YLLGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKENVELKEKEEKASKEIKQ  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            LK+E++++   +KK++ E E K + V+  + +  S + Q+  LLLEY +LLE+NQ+L
Sbjct  153  LKKELSTLTEGLKKVKMESEEKDKRVETAEAHVASLQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_006452413.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475036.1| PREDICTED: uncharacterized protein LOC102621108 [Citrus sinensis]
 gb|ESR65653.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T  F EMA+IL LLF++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI
Sbjct  7    TTVFTEMALILALLFESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
              R  ES  +NPT++VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+
Sbjct  67   HKRSRESGALNPTEEVLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQ  126

Query  227  HDR  219
            H++
Sbjct  127  HNQ  129



>gb|KDP39157.1| hypothetical protein JCGZ_00914 [Jatropha curcas]
Length=104

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  339
            ++ +D  KRGRG LV K+VAAT+F +    +YSV +IQ R LES  +NPTD+VLLA+++L
Sbjct  6    MVGIDYMKRGRGQLVAKTVAATLFGVFSAILYSVMQIQKRTLESGVVNPTDEVLLAERLL  65

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            +A+LMGF LFL++M DRLH+YI+EL  +RK +E  K+
Sbjct  66   EATLMGFSLFLAMMADRLHYYIKELYRVRKEVEQLKR  102



>ref|XP_010274041.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 108/176 (61%), Gaps = 9/176 (5%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            +D+ K G+G   +K++A T+ V++  ++ S+  IQ++   L ++ P DQVL    +L+AS
Sbjct  34   MDQLKTGKGSATLKTIAGTMSVILASSIISLLNIQNKGTKLGTVTPMDQVLWRSHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKNGGVEEVNSL  171
            LMG  LFL  +IDR+HHY+++L  LR A  ++KK               +     E+  L
Sbjct  94   LMGCSLFLGFVIDRIHHYLQKLIALRTAARSSKKEVEKLQIEHIQLKEKEEKASYEIKLL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +EEI+S+K  +K L+ + + K +++K+ + +  + + Q+E LLLEY +LL+++QHL
Sbjct  154  QEEISSLKENLKNLKLQSDEKDKQIKSAESHVTALEKQTEDLLLEYDRLLDDSQHL  209



>ref|XP_004987306.1| PREDICTED: uncharacterized protein LOC101775823 [Setaria italica]
Length=163

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 92/134 (69%), Gaps = 9/134 (7%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LESINPTDQVL  357
            +++LDR KRGRGP++V++VAATV V++  +++S+ +I+ R         +  + PTDQVL
Sbjct  30   VLALDRLKRGRGPVMVRTVAATVLVVLASSLHSMAQIRGRAEGELDGAGVVGLTPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-FDNGKNGGVEEV  180
            LA+ +L+ASLMG+ LFL+L+IDRLH+Y++E+R L+K +EA  K ++   +   +G  EE 
Sbjct  90   LARHLLEASLMGYSLFLALVIDRLHNYVKEIRRLKKNLEAVSKQNKTMLEEATHGRSEES  149

Query  179  NSLKEEIASMKSKI  138
                ++I+  K  +
Sbjct  150  ERDLKDISDAKKDV  163



>ref|XP_002521067.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF41218.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=292

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A+T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIASTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASL+GF LFL  +IDR+HHY+ +L  LR  + ++K       K        ++    E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYLTKLIGLRINIGSSKEEVERLQKEKMQLKEKEDKSSMEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+++++++   ++KL+ E E K ++++  + +  S + QS  LLLEY +LLE+NQ+L
Sbjct  151  EQLRKQVSTLSENLEKLKLENEQKDKQIETAEAHVVSLQKQSADLLLEYDRLLEDNQNL  209



>ref|XP_010552045.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=219

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
            SLD+ K G+GP  VK++A T+ V+++ T+ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKMGKGPATVKTIAGTMSVILLSTLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKNGGVEEVNS  174
            SLMG VLFL  +IDR+HHY+ +L  LR  +  +K+               +    +E+  
Sbjct  93   SLMGVVLFLGFVIDRMHHYLTKLLYLRSNIGMSKEELEKLQKERTELKEKEEKASKEMKQ  152

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            L+E+++S+   ++KLE+E + K ++++  + +  + + QS +LLLEY +LLE+NQ+L
Sbjct  153  LQEKLSSLSQNLEKLEAESKDKDKKLETAEAHVSALQKQSAELLLEYDRLLEDNQNL  209



>ref|NP_001143481.1| hypothetical protein [Zea mays]
 gb|ACF83647.1| unknown [Zea mays]
 gb|ACG32480.1| hypothetical protein [Zea mays]
 gb|AFW77082.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_955327 [Zea 
mays]
Length=161

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LESINPTDQVL  357
            +++LD  KRGRGP++V+++AATV V++  +++S+ +I+           +  + PTDQVL
Sbjct  30   VLALDHLKRGRGPVMVRTIAATVLVVLASSLHSMAKIRGHAEGELDGSGVVGLTPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  183
            LA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K ++  +   NG +EE
Sbjct  90   LARHLLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVLKQNKALEEATNGKLEE  147



>ref|XP_002863915.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40174.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V++   + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASL+G VLFL  +IDR+HHY+R+L  LR  + ++K       K   G    ++   +E+
Sbjct  91   EASLLGVVLFLGFIIDRMHHYLRKLINLRSNVGSSKDELEQLQKERAGLKEKEDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+EE++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQHL
Sbjct  151  KQLQEELSSILERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQHL  209



>ref|XP_004491413.1| PREDICTED: uncharacterized protein LOC101509893 [Cicer arietinum]
Length=140

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQAS  330
            LD  KRG+GPL+ K+VA+TVFV+   T+Y++ +I  R  ++  INPT++VL+A  +L+AS
Sbjct  33   LDVLKRGKGPLITKTVASTVFVVFGSTIYTILKIHKRSKDAGMINPTEEVLMAHHLLEAS  92

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            LMGF LF  LMIDR H+Y++E+  LRK ME AKK
Sbjct  93   LMGFSLFFGLMIDRQHYYVKEITSLRKNMEIAKK  126



>gb|EMS58132.1| hypothetical protein TRIUR3_00710 [Triticum urartu]
Length=190

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 101/167 (60%), Gaps = 22/167 (13%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            +++ K G+GP  VK++A T+ V+++ +V ++  IQ R   + +++P DQVL    +L+AS
Sbjct  34   VEQVKTGKGPATVKTLACTLSVILMSSVAAIVRIQDRGHKIGNVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  150
            L+G+ LFL+ +IDRLHHY+R+L  LRK+   ++                    +E++A +
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLITLRKSANTSR--------------------EEDMAKL  133

Query  149  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  9
               +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ
Sbjct  134  SEDMKKLKSESEDHQRKASDAEAHVNALQKQSEELLLEYDRLLEDNQ  180



>gb|EYU40619.1| hypothetical protein MIMGU_mgv1a013665mg [Erythranthe guttata]
Length=213

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 111/180 (62%), Gaps = 19/180 (11%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            LD+ K  R    V ++AATVFV+++  ++S+ +IQ++  +  ++ P DQVL    +L+A+
Sbjct  34   LDQVKMRRAT--VLTIAATVFVILLSDLFSIFKIQNKGAKHGAMTPMDQVLWRTNVLEAT  91

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-----------NGKNGGVEE  183
            LMGF LFL L+IDR+HH++R+L  L+ +   +K+    FD           N +  G+ E
Sbjct  92   LMGFFLFLGLLIDRMHHHMRKLDELKSSNGVSKEE---FDRVEREKLQLKENQEKTGL-E  147

Query  182  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            V  L++EI+ +   +KKL+ E   K + VK+ +    S + Q+ +LLLEY +LLE+NQ+L
Sbjct  148  VERLRKEISGLTENVKKLKLESTEKDKSVKSAEARVASLQKQTAELLLEYDRLLEDNQNL  207



>ref|XP_002437063.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
 gb|EER88430.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
Length=160

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LESINPTDQVL  357
            +++LDR K+GRGP++V+++AATV V++  +++S+ +I+SR         +  + PTDQVL
Sbjct  30   VVALDRLKQGRGPVMVRTIAATVLVVLASSLHSMTKIRSRADGELDGAGIVGLTPTDQVL  89

Query  356  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  186
            LA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K +       +G  E
Sbjct  90   LARHVLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVSKQNETMLEATHGPKE  146



>ref|XP_007216855.1| hypothetical protein PRUPE_ppa021600mg [Prunus persica]
 gb|EMJ18054.1| hypothetical protein PRUPE_ppa021600mg [Prunus persica]
Length=192

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 92/169 (54%), Gaps = 31/169 (18%)
 Frame = -3

Query  509  ISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVLLAQQILQAS  330
            I++DR KRGRGPLVV+ +A +V  +++  VY                             
Sbjct  32   IAVDRLKRGRGPLVVRIIAGSVLFVLVARVY-----------------------------  62

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  150
              GF+LFLS+++DRLHHY RE+ LLR  MEAA++ ++     KNG   E+  L +EIA +
Sbjct  63   --GFLLFLSVILDRLHHYTREVSLLRTEMEAAQRENQTLKEEKNGRAMELKILGQEIAKL  120

Query  149  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            ++ I   E+E E K +  K +K  + + + Q E LL E  ++ E+NQ L
Sbjct  121  RTNIMNTETEYETKAKGAKLEKTKAYALRKQYEGLLAEIDRVQEDNQIL  169



>emb|CDP03896.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 104/176 (59%), Gaps = 11/176 (6%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K  +G   V ++A T   +++   +S+ +IQ++   L +++P DQVL    +L+AS
Sbjct  34   LDQVKMRKGT--VLTIAGTFAAILLSNFFSIVKIQNKGAKLGTMSPMDQVLWRTNLLEAS  91

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEVNSL  171
            LMGF LFL  +IDR+HHY+R+L  LR    A +K +   +  K           EE+  +
Sbjct  92   LMGFCLFLGFLIDRMHHYLRKLIGLRSTAGALRKENERLEKDKLQLKEKAEKADEEIKVM  151

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            K+EI+S+   + KLE E   K ++V+  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  152  KKEISSLTENLNKLEMESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLEDNQNL  207



>ref|XP_009151666.1| PREDICTED: uncharacterized protein LOC103874978 [Brassica rapa]
Length=217

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++   +E+
Sbjct  91   EASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERTEFKEKEDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQ L
Sbjct  151  KQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQKL  209



>emb|CDX86287.1| BnaA06g30040D [Brassica napus]
Length=217

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++   +E+
Sbjct  91   EASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKEDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQ L
Sbjct  151  KQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQKL  209



>emb|CDX85356.1| BnaC07g26670D [Brassica napus]
Length=217

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++   +E+
Sbjct  91   EASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKEDKASKEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+E ++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQ L
Sbjct  151  KQLQETLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQKL  209



>ref|XP_008674143.1| PREDICTED: B-cell receptor-associated protein 31-like [Zea mays]
Length=270

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 104/180 (58%), Gaps = 14/180 (8%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  330
            +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  171
            L+G+ LFL+ +IDRLHHY+R+L  LRK    +++        +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLLTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKRL  153

Query  170  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL-----LEYGQLLEENQH  6
            + EIA +   +KKL+SE E    +    + + ++ + QSE+LL       +GQL     H
Sbjct  154  QREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLHSFLAARHGQLPSVADH  213



>gb|KDO62066.1| hypothetical protein CISIN_1g046403mg [Citrus sinensis]
Length=117

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = -3

Query  563  MAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE  384
            MA+IL LLF++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  E
Sbjct  1    MALILALLFESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSRE  60

Query  383  S--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
            S  +NPT++VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  61   SGALNPTEEVLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  117



>ref|XP_008235454.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=218

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIACTMSVILLSSFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+ +L  LR  + A+K       K        ++   +E+
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLSKLIGLRSNVGASKEEVDRLQKETMQLKEKEDKSSQEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L+E+I+++   +KKL+ EC+ K + ++  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  151  KQLQEKISTLSEDLKKLKLECKEKDKNIETAEAHVAALQKQAADLLLEYDRLLEDNQNL  209



>ref|XP_004963921.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=134

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -3

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  150
            L G+ LFL L+IDRLHHYIRELR + K MEA  K  R  +  K GG EE+   ++EIAS+
Sbjct  6    LAGYSLFLGLIIDRLHHYIRELRTMNKNMEAVTKQSRTLEEAKLGGTEEIQGYQKEIASL  65

Query  149  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            K +++ L+++ + K EE+K  + NS + + QSE LL+EY +L+ EN  L
Sbjct  66   KEQVELLKNQSQKKTEELKTAEANSVALQKQSEGLLMEYDRLIAENGDL  114



>ref|XP_011089080.1| PREDICTED: uncharacterized protein LOC105170143 [Sesamum indicum]
Length=216

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 106/179 (59%), Gaps = 11/179 (6%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  339
            I  LD+ K  R    V ++A T+FV+++  ++S+ +IQ++  +  ++ P DQVL    +L
Sbjct  31   IKGLDQVKMRRA--TVLTIAGTIFVILLSNLFSILKIQNKGAKHGTMTPMDQVLWRTNLL  88

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  180
            +A+LMGF LFL  +IDR+HHY+R+L  LR       + +E  +K        +     EV
Sbjct  89   EATLMGFSLFLGFLIDRMHHYMRKLIKLRSNTGVSKQEVEMLEKEKLQLKEKEEKAAGEV  148

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L++E++S+   + KL SE   K ++V+  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  149  KRLQKEMSSLTENLNKLRSESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLEDNQNL  207



>ref|XP_004290194.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458169.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 102/172 (59%), Gaps = 5/172 (3%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K GRGP+ +  +A T+ V+++    S+ ++Q++   L +++P DQVL    IL+AS
Sbjct  34   LDQLKVGRGPVTLIGIAGTMGVILLSRFISIVKMQNKGEKLGTMSPMDQVLYRTHILEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLL---RKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  159
            LM F +FL  +IDR H Y+ +L  L   ++ +E  +K        +    +E+  L+E+I
Sbjct  94   LMSFAVFLGFIIDRTHDYLTKLDGLTSTKEEVERLQKEKVQLTEKEEKSSKEIKQLQEKI  153

Query  158  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            A++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY  LLE+NQ L
Sbjct  154  ATLSEDLKKLKLECAEKDKAVETAESHVTSLQKQAADLLLEYDHLLEDNQKL  205



>ref|XP_010913045.1| PREDICTED: B-cell receptor-associated protein 29-like [Elaeis 
guineensis]
Length=218

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 89/139 (64%), Gaps = 9/139 (6%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  330
            LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGTKLGTVTPMDQVLWRTHLLEAS  93

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-------FDNGKNGGVEEVNSL  171
            L+G+ LFL L+IDRLHHY+R++  L+K +  +K+           F + ++    E+  L
Sbjct  94   LIGYTLFLGLVIDRLHHYLRKMVTLKKTVGTSKEEVEKLKKEHLHFKDKEDKASSEMQKL  153

Query  170  KEEIASMKSKIKKLESECE  114
            + E+ S+  K++KL++ECE
Sbjct  154  QREVGSLTEKLQKLKTECE  172



>ref|XP_009775442.1| PREDICTED: uncharacterized protein LOC104225364 [Nicotiana sylvestris]
Length=216

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 104/177 (59%), Gaps = 11/177 (6%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
             LD+ K  +G   V ++A T+  ++     S+ +IQ++   L ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGT--VLTIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVLWRTNLLEA  90

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEVNS  174
            +LMGF LFL  +IDR+HHY+R+L +LR       K  E+ +K    F    +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRNNAGSSKKEFESLEKEKLQFKEKADKAAEEMKQ  150

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  151  SQKEISSLTESLKKVKLQLEQKNKLVETAEAHVAALQKQAADLLLEYDRLLEDNQNL  207



>ref|XP_002317336.1| hypothetical protein POPTR_0011s09140g [Populus trichocarpa]
 gb|EEE97948.1| hypothetical protein POPTR_0011s09140g [Populus trichocarpa]
Length=128

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            TV F EMA+IL+LLF+TP+RKL+I+++D+ K+G+GPLV K+VA T+ V+    +++  +I
Sbjct  7    TVVFTEMALILILLFRTPVRKLVIMAIDQLKQGKGPLVAKTVATTLIVVFTSVLHNALQI  66

Query  401  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            + R L++  +N  D+VL+ ++IL+ASL+GF LFL++MIDRLH YI+EL  +R  +EA K+
Sbjct  67   RKRLLDAGAVNSADEVLMVERILEASLLGFSLFLAMMIDRLHCYIKELLQVRNELEAVKR  126



>ref|XP_009610381.1| PREDICTED: uncharacterized protein LOC104104089 [Nicotiana tomentosiformis]
Length=216

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 104/177 (59%), Gaps = 11/177 (6%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
             LD+ K  +G ++  ++A T+  ++     S+ +IQ++   L ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGTVL--TIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVLWRTNLLEA  90

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEVNS  174
            +LMGF LFL  +IDR+HHY+R+L +LR       K  E  +K    F    +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRNSAGSSKKEFERLEKEKLQFKEKADKAAEEMKQ  150

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  151  SQKEISSLTESLKKVKLQMEEKDKRVETAEAHVAALQKQAADLLLEYDRLLEDNQNL  207



>ref|XP_007020770.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
 gb|EOY12295.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
Length=543

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQAS  330
            LD+ K GRGP++ K+VA T+FV+ I   Y+  EIQ R LE   INPTD+VLLA +IL+AS
Sbjct  420  LDKIKEGRGPVISKTVAGTLFVVFISISYNAIEIQKRALEGGVINPTDEVLLANRILEAS  479

Query  329  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  228
            LMGF LFL+L+  RLH++I+EL   R+ +EA +K
Sbjct  480  LMGFALFLALVTYRLHYHIKELNPARRRLEADEK  513



>ref|XP_009388739.1| PREDICTED: uncharacterized protein LOC103975489 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            ++ LDR KRGR  ++VK++AAT  +++  ++YS+ EI+ R   L +  PTDQ+L+++ +L
Sbjct  30   VLGLDRLKRGRSTVMVKTLAATAVLVLASSIYSMAEIRLRFAELGAPTPTDQILMSRHLL  89

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  195
            +ASL+G+ LFL+L+IDRLH YI EL  LR +M+A  K +R     K G
Sbjct  90   EASLLGYSLFLALIIDRLHLYIGELHGLRNSMKAVMKQNRVIGTAKTG  137



>ref|XP_006340009.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=216

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
             LD+ K  +G ++  ++A T+  +++    S+ +IQ++   + ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGTVL--TIAGTISAILVSNFISIIKIQNKGAKIGTMTPMDQVLWRTNLLEA  90

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEVNS  174
            +LMGF LFL  +IDR+HHY+R+L +LR +  ++KK     +  K       +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRSSAGSSKKEFERLEKEKLQLKEKADKAAEEIKL  150

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             +++++S+   +KK++ E E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  151  SQKQLSSLTETLKKVKLESEEKDKRVETAEAHVAALQKQAADLLLEYDRLLEDNQNL  207



>ref|XP_011024634.1| PREDICTED: uncharacterized protein LOC105125752 [Populus euphratica]
Length=218

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 110/179 (61%), Gaps = 9/179 (5%)
 Frame = -3

Query  512  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  339
            I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  338  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  180
            +ASLMGF LFL  +IDR+HHY+  L  LR+ + ++K       K        ++    E+
Sbjct  91   EASLMGFTLFLGFLIDRMHHYLSRLIGLRRCVGSSKEEVERLQKEKMQLKEKEDKASMEI  150

Query  179  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
              L E+I+++   +KKL+ E E K ++++  + +  S + Q   LLLEY +LLE+NQ+L
Sbjct  151  KLLLEQISTLSESLKKLKLESEKKDKQIETAEAHVVSLQKQCADLLLEYDRLLEDNQNL  209



>ref|XP_007201384.1| hypothetical protein PRUPE_ppa012189mg [Prunus persica]
 gb|EMJ02583.1| hypothetical protein PRUPE_ppa012189mg [Prunus persica]
Length=180

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 107/170 (63%), Gaps = 9/170 (5%)
 Frame = -3

Query  485  GRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQASLMGFVL  312
            G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L+ASLMGF L
Sbjct  2    GKGPATVKTIACTMSVILLSSFISIVKIQNKGVKLGTMSPMDQVLWRTHLLEASLMGFTL  61

Query  311  FLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEVNSLKEEIAS  153
            FL  +IDR+HHY+ +L  LR  + A+K       K        ++   +E+  L+E+I++
Sbjct  62   FLGFIIDRMHHYLSKLIGLRSNVGASKEEVDRLQKETMHLKEKEDKSSQEIKQLQEKIST  121

Query  152  MKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
            +   +KKL+ EC+ K + ++  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  122  LSEDLKKLKLECKEKDKNIETAEAHVAALQKQAADLLLEYDRLLEDNQNL  171



>ref|XP_004247073.1| PREDICTED: uncharacterized protein LOC101251810 [Solanum lycopersicum]
Length=216

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 106/177 (60%), Gaps = 11/177 (6%)
 Frame = -3

Query  506  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  333
             LD+ K  +G ++  ++A T+  ++     S+ +IQ++   + ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGTVL--TIAGTISAILFSNFISIIKIQNKGAKIGTMTPMDQVLWRTNLLEA  90

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEVNS  174
            +LMGF LFL  +IDR+HHY+R+L +LR +  ++KK     +  K       +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRSSAGSSKKEFERLEKEKLQLKEKADKAAEEIKL  150

Query  173  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  3
             +++++S+   +KK++ E E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L
Sbjct  151  SQKQLSSLTETLKKVKLESEEKDKRVETAEAHVAALQKQAADLLLEYDRLLEDNQNL  207



>emb|CDY29829.1| BnaC05g31610D [Brassica napus]
Length=137

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = -3

Query  503  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQVLLAQQILQA  333
            LD  K+GRGPLV K+VAAT+ VL    ++S  +I +R  ES    NPTDQV+ A +IL++
Sbjct  37   LDLLKQGRGPLVTKTVAATMLVLFGSVLFSTIQINTRVSESGGVANPTDQVMFANRILES  96

Query  332  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  219
             LMG VLFL+L++DR+H+Y REL++ R+ +E A K  +
Sbjct  97   FLMGTVLFLALVMDRMHYYTRELQITRRNLEVAVKKTK  134



>ref|XP_009778813.1| PREDICTED: uncharacterized protein LOC104228107 [Nicotiana sylvestris]
Length=108

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = -3

Query  581  TVAFGEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI  402
            T+ F EMA+I++ +FKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YS+  I
Sbjct  7    TLIFAEMALIVIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMLSTIYSIASI  66

Query  401  QSRPLE---SINPTDQVLLAQQILQASLMGFVL  312
            ++R ++    I PTDQ+LLAQ +L+ASLMG VL
Sbjct  67   RTRWMDEGGDITPTDQILLAQHLLEASLMGIVL  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455