BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024F24

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008787377.1|  PREDICTED: uncharacterized protein LOC103705447  96.3    3e-39   
ref|XP_003545913.2|  PREDICTED: uncharacterized protein LOC100787648  90.9    3e-34   Glycine max [soybeans]
ref|XP_008383068.1|  PREDICTED: uncharacterized protein LOC103445...  90.5    4e-34   
ref|XP_010645008.1|  PREDICTED: protein PAT1 homolog 1 isoform X3     87.4    1e-33   Vitis vinifera
ref|XP_010645006.1|  PREDICTED: uncharacterized protein LOC100267...  87.4    1e-33   Vitis vinifera
ref|XP_010645007.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     87.4    1e-33   Vitis vinifera
ref|XP_004488834.1|  PREDICTED: uncharacterized protein LOC101500903  89.4    1e-33   Cicer arietinum [garbanzo]
ref|XP_006585424.1|  PREDICTED: uncharacterized protein LOC100812...  89.7    2e-33   Glycine max [soybeans]
ref|XP_003532940.1|  PREDICTED: uncharacterized protein LOC100812...  89.7    2e-33   Glycine max [soybeans]
ref|XP_003545912.1|  PREDICTED: protein PAT1 homolog 1-like           84.7    4e-33   Glycine max [soybeans]
ref|XP_011097653.1|  PREDICTED: protein PAT1 homolog 1                89.0    6e-33   
gb|KEH38343.1|  topoisomerase II-associated protein PAT1              84.0    2e-32   Medicago truncatula
ref|XP_007214538.1|  hypothetical protein PRUPE_ppa002090mg           90.1    3e-32   
ref|XP_002520595.1|  hypothetical protein RCOM_0673440                89.0    3e-32   Ricinus communis
ref|XP_006585425.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  84.0    5e-32   
ref|XP_008226080.1|  PREDICTED: protein PAT1 homolog 1                90.1    7e-32   Prunus mume [ume]
ref|XP_010109206.1|  hypothetical protein L484_002129                 87.8    2e-31   Morus notabilis
gb|KJB42927.1|  hypothetical protein B456_007G174200                  81.6    5e-31   Gossypium raimondii
gb|KHN27739.1|  Protein PAT1 like 1                                   84.3    5e-31   Glycine soja [wild soybean]
ref|XP_009416760.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  82.0    7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419549.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     83.2    7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419548.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     83.2    8e-31   
gb|KHG07107.1|  Protein PAT1                                          82.0    1e-30   Gossypium arboreum [tree cotton]
gb|KHN16432.1|  hypothetical protein glysoja_046875                   88.2    1e-30   Glycine soja [wild soybean]
ref|XP_007149276.1|  hypothetical protein PHAVU_005G0567001g          82.0    1e-30   Phaseolus vulgaris [French bean]
ref|XP_006597999.1|  PREDICTED: uncharacterized protein LOC100779...  87.4    2e-30   Glycine max [soybeans]
ref|XP_006597997.1|  PREDICTED: uncharacterized protein LOC100779...  87.4    2e-30   Glycine max [soybeans]
ref|XP_006597998.1|  PREDICTED: uncharacterized protein LOC100779...  87.4    2e-30   Glycine max [soybeans]
emb|CDP13609.1|  unnamed protein product                              89.4    2e-30   Coffea canephora [robusta coffee]
ref|XP_004251956.1|  PREDICTED: protein PAT1 homolog 1                88.6    7e-30   Solanum lycopersicum
dbj|BAJ88890.1|  predicted protein                                    80.5    1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002308825.2|  hypothetical protein POPTR_0006s02270g           85.1    1e-29   
ref|XP_006373646.1|  hypothetical protein POPTR_0016s02130g           83.6    1e-29   
ref|XP_011008549.1|  PREDICTED: uncharacterized protein LOC105113895  83.6    2e-29   Populus euphratica
ref|XP_004514400.1|  PREDICTED: uncharacterized protein LOC101512706  79.0    2e-29   
ref|XP_006388794.1|  hypothetical protein POPTR_0098s00230g           83.6    3e-29   
ref|XP_009361780.1|  PREDICTED: protein PAT1 homolog 1-like           87.0    4e-29   Pyrus x bretschneideri [bai li]
ref|XP_011036076.1|  PREDICTED: protein PAT1 homolog 1-like           84.7    5e-29   Populus euphratica
ref|XP_011004464.1|  PREDICTED: uncharacterized protein LOC105110947  84.7    7e-29   Populus euphratica
ref|XP_007133386.1|  hypothetical protein PHAVU_011G174900g           81.6    9e-29   Phaseolus vulgaris [French bean]
gb|EYU33763.1|  hypothetical protein MIMGU_mgv1a002553mg              79.7    4e-28   Erythranthe guttata [common monkey flower]
ref|XP_009405382.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  80.1    5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405381.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  80.1    6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006344917.1|  PREDICTED: uncharacterized protein LOC102604...  88.2    7e-28   Solanum tuberosum [potatoes]
ref|XP_006344918.1|  PREDICTED: uncharacterized protein LOC102604...  88.2    7e-28   Solanum tuberosum [potatoes]
ref|XP_009767161.1|  PREDICTED: uncharacterized protein LOC104218381  85.1    8e-28   Nicotiana sylvestris
gb|EMT17005.1|  Lipoyl synthase, mitochondrial                        79.3    9e-28   
ref|XP_009604527.1|  PREDICTED: uncharacterized protein LOC104099288  83.6    1e-27   Nicotiana tomentosiformis
gb|KHN26819.1|  Protein PAT1 like 1                                   80.1    2e-27   Glycine soja [wild soybean]
gb|KDP44628.1|  hypothetical protein JCGZ_22047                       85.1    6e-27   Jatropha curcas
gb|EPS66560.1|  hypothetical protein M569_08215                       75.9    2e-26   Genlisea aurea
gb|ACL52964.1|  unknown                                               81.6    3e-26   Zea mays [maize]
ref|XP_008649853.1|  PREDICTED: uncharacterized protein LOC103630586  76.3    6e-25   Zea mays [maize]
ref|XP_009594235.1|  PREDICTED: protein PAT1 homolog 1-like             112   2e-24   Nicotiana tomentosiformis
ref|XP_009757677.1|  PREDICTED: uncharacterized protein LOC104210470    111   4e-24   Nicotiana sylvestris
ref|XP_009781689.1|  PREDICTED: uncharacterized protein LOC104230555    110   8e-24   Nicotiana sylvestris
ref|XP_009602223.1|  PREDICTED: uncharacterized protein LOC104097371    109   2e-23   Nicotiana tomentosiformis
ref|NP_001169926.1|  uncharacterized protein LOC100383823             75.1    3e-23   
ref|XP_006351984.1|  PREDICTED: protein PAT1 homolog 1-like             107   1e-22   Solanum tuberosum [potatoes]
emb|CAD80089.1|  hypothetical protein                                 98.6    1e-22   Momordica charantia [balsam pear]
ref|XP_006354416.1|  PREDICTED: uncharacterized protein LOC102594...    106   2e-22   Solanum tuberosum [potatoes]
gb|KHG11535.1|  Protein PAT1                                          83.6    3e-22   Gossypium arboreum [tree cotton]
ref|XP_007022269.1|  Topoisomerase II-associated protein PAT1, pu...  82.0    4e-22   
ref|XP_007022271.1|  Uncharacterized protein TCM_032442               83.2    6e-22   
ref|XP_009797313.1|  PREDICTED: protein PAT1 homolog 1-like             104   9e-22   Nicotiana sylvestris
ref|XP_009595696.1|  PREDICTED: protein PAT1 homolog 1-like             104   1e-21   Nicotiana tomentosiformis
ref|XP_008451848.1|  PREDICTED: uncharacterized protein LOC103493011    104   1e-21   Cucumis melo [Oriental melon]
gb|KJB12762.1|  hypothetical protein B456_002G0355002                 81.3    1e-21   Gossypium raimondii
ref|XP_010313689.1|  PREDICTED: uncharacterized protein LOC101260...    103   2e-21   Solanum lycopersicum
ref|XP_004251557.1|  PREDICTED: uncharacterized protein LOC101260...    103   2e-21   Solanum lycopersicum
ref|XP_008809752.1|  PREDICTED: uncharacterized protein LOC103721355  98.6    2e-21   
ref|XP_002513418.1|  conserved hypothetical protein                   71.2    3e-21   Ricinus communis
ref|XP_004165263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   5e-21   
gb|ABR25724.1|  unknown                                               73.2    5e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004147742.1|  PREDICTED: uncharacterized protein LOC101213130    102   5e-21   Cucumis sativus [cucumbers]
ref|XP_002317021.2|  hypothetical protein POPTR_0011s14710g           69.7    9e-21   
gb|KDP25122.1|  hypothetical protein JCGZ_22657                       75.1    1e-20   Jatropha curcas
gb|KHG10037.1|  Protein PAT1                                          76.6    1e-20   Gossypium arboreum [tree cotton]
ref|XP_011030729.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     70.5    1e-20   Populus euphratica
ref|XP_011030730.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     70.5    1e-20   Populus euphratica
ref|XP_011030731.1|  PREDICTED: protein PAT1 homolog 1 isoform X3     70.5    1e-20   Populus euphratica
ref|XP_010112872.1|  hypothetical protein L484_017708                   100   2e-20   
gb|KHG07822.1|  Protein PAT1                                          77.8    2e-20   Gossypium arboreum [tree cotton]
ref|XP_011085449.1|  PREDICTED: protein PAT1 homolog 1-like             100   2e-20   Sesamum indicum [beniseed]
gb|KJB82133.1|  hypothetical protein B456_013G178200                  76.3    3e-20   Gossypium raimondii
gb|KJB26984.1|  hypothetical protein B456_004G270000                  74.7    3e-20   Gossypium raimondii
ref|XP_004239250.1|  PREDICTED: uncharacterized protein LOC101257075  99.0    6e-20   Solanum lycopersicum
emb|CDP16041.1|  unnamed protein product                              99.0    8e-20   Coffea canephora [robusta coffee]
gb|EYU42843.1|  hypothetical protein MIMGU_mgv1a001457mg              97.1    4e-19   Erythranthe guttata [common monkey flower]
ref|XP_011100381.1|  PREDICTED: uncharacterized protein LOC105178578  95.9    7e-19   Sesamum indicum [beniseed]
gb|KDP25124.1|  hypothetical protein JCGZ_22659                       68.9    1e-18   Jatropha curcas
ref|XP_010923783.1|  PREDICTED: uncharacterized protein LOC105046771  95.1    1e-18   
gb|ACF84116.1|  unknown                                               90.1    2e-18   Zea mays [maize]
gb|AAM61209.1|  unknown                                               64.3    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036063.1|  PREDICTED: protein PAT1 homolog 1-like           94.0    3e-18   Eucalyptus grandis [rose gum]
dbj|BAD94175.1|  hypothetical protein                                 63.5    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17049.1|  Similar to hypothetical protein product gb|Z97337...  63.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002264820.1|  PREDICTED: protein PAT1 homolog 1-like           94.0    4e-18   Vitis vinifera
emb|CAN68728.1|  hypothetical protein VITISV_033604                   93.6    4e-18   Vitis vinifera
ref|XP_010511200.1|  PREDICTED: uncharacterized protein LOC104787331  63.2    6e-18   
ref|XP_010539588.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     64.3    8e-18   Tarenaya hassleriana [spider flower]
ref|XP_010539589.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     64.7    8e-18   Tarenaya hassleriana [spider flower]
ref|XP_010532520.1|  PREDICTED: uncharacterized protein LOC104808528  62.8    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_004303935.1|  PREDICTED: protein PAT1 homolog 1                92.4    1e-17   Fragaria vesca subsp. vesca
ref|XP_008793553.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  92.0    1e-17   
ref|XP_008793552.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  92.0    1e-17   Phoenix dactylifera
ref|XP_010466506.1|  PREDICTED: uncharacterized protein LOC104746679  63.2    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002300546.2|  hypothetical protein POPTR_0001s46190g           70.5    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010488248.1|  PREDICTED: uncharacterized protein LOC104766124  63.2    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006414611.1|  hypothetical protein EUTSA_v10024461mg           61.2    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010907163.1|  PREDICTED: uncharacterized protein LOC105033889  91.3    2e-17   Elaeis guineensis
gb|KFK23118.1|  hypothetical protein AALP_AAs49591U000400             61.2    3e-17   Arabis alpina [alpine rockcress]
gb|EYU43158.1|  hypothetical protein MIMGU_mgv1a023840mg              90.5    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_008383066.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     90.5    5e-17   Malus domestica [apple tree]
ref|XP_002883351.1|  hypothetical protein ARALYDRAFT_479740           62.0    5e-17   
ref|XP_009377953.1|  PREDICTED: protein PAT1 homolog 1-like           90.5    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_008342293.1|  PREDICTED: protein PAT1 homolog 1-like           90.1    6e-17   
ref|XP_009345081.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  90.1    6e-17   
ref|XP_009345080.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  90.1    6e-17   Pyrus x bretschneideri [bai li]
ref|XP_010243918.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  90.1    6e-17   Nelumbo nucifera [Indian lotus]
ref|NP_188866.1|  Topoisomerase II-associated protein PAT1            61.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243919.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  90.1    6e-17   Nelumbo nucifera [Indian lotus]
dbj|BAF00849.1|  hypothetical protein                                 61.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297023.1|  hypothetical protein CARUB_v10013016mg           61.6    6e-17   Capsella rubella
dbj|BAB01945.1|  unnamed protein product                              61.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011014090.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  70.5    1e-16   Populus euphratica
ref|XP_011014091.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  70.5    1e-16   Populus euphratica
ref|NP_001140581.1|  uncharacterized protein LOC100272651             89.4    1e-16   Zea mays [maize]
ref|XP_011038109.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  70.5    1e-16   Populus euphratica
ref|XP_008378353.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  89.4    1e-16   
ref|XP_011038110.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  70.1    1e-16   Populus euphratica
ref|XP_002456407.1|  hypothetical protein SORBIDRAFT_03g035750        89.4    1e-16   Sorghum bicolor [broomcorn]
ref|XP_009375342.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  89.4    1e-16   
ref|XP_009375341.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  89.4    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_010926895.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     89.0    2e-16   
ref|XP_010243929.1|  PREDICTED: protein PAT1 homolog 1-like           89.0    2e-16   Nelumbo nucifera [Indian lotus]
emb|CDY37402.1|  BnaC05g30280D                                        60.8    2e-16   Brassica napus [oilseed rape]
ref|XP_010926894.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     89.0    2e-16   Elaeis guineensis
ref|XP_010062704.1|  PREDICTED: protein PAT1 homolog 1                89.0    2e-16   Eucalyptus grandis [rose gum]
gb|KFK39518.1|  hypothetical protein AALP_AA3G254500                  59.7    2e-16   Arabis alpina [alpine rockcress]
ref|XP_004970101.1|  PREDICTED: uncharacterized protein LOC101761506  88.6    2e-16   Setaria italica
ref|XP_002889231.1|  predicted protein                                63.9    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_008229675.1|  PREDICTED: protein PAT1 homolog 1-like           88.6    2e-16   Prunus mume [ume]
ref|XP_007049006.1|  Topoisomerase II-associated protein PAT1, pu...  88.2    2e-16   
ref|XP_007049005.1|  Topoisomerase II-associated protein PAT1, pu...  88.2    3e-16   
ref|XP_004488835.1|  PREDICTED: uncharacterized protein LOC101501...  87.0    6e-16   Cicer arietinum [garbanzo]
ref|XP_007217055.1|  hypothetical protein PRUPE_ppa001180mg           86.7    9e-16   
gb|KJB10632.1|  hypothetical protein B456_001G212600                  86.3    1e-15   Gossypium raimondii
ref|XP_002980379.1|  hypothetical protein SELMODRAFT_112306           65.1    1e-15   
ref|XP_002962712.1|  hypothetical protein SELMODRAFT_165728           65.1    1e-15   
gb|KHG26425.1|  Protein PAT1                                          86.3    1e-15   Gossypium arboreum [tree cotton]
ref|XP_003569904.1|  PREDICTED: uncharacterized protein LOC100838182  85.9    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_006283147.1|  hypothetical protein CARUB_v10004170mg           59.7    2e-15   Capsella rubella
ref|XP_008775079.1|  PREDICTED: protein PAT1 homolog 1-like           85.5    2e-15   Phoenix dactylifera
ref|XP_006283146.1|  hypothetical protein CARUB_v10004170mg           59.7    2e-15   
emb|CAB10277.1|  hypothetical protein                                 61.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01932.1|  hypothetical protein                                 61.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162291.1|  PREDICTED: uncharacterized protein LOC101226533  85.5    2e-15   
ref|XP_004144681.1|  PREDICTED: uncharacterized protein LOC101207256  85.5    2e-15   Cucumis sativus [cucumbers]
ref|XP_009406732.1|  PREDICTED: uncharacterized protein LOC103989...  85.5    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567452.2|  Topoisomerase II-associated protein PAT1            61.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525174.1|  PREDICTED: uncharacterized protein LOC104803017  57.0    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_008444289.1|  PREDICTED: protein PAT1 homolog 1                85.1    3e-15   Cucumis melo [Oriental melon]
gb|KEH38344.1|  topoisomerase II-associated protein PAT1, putative    84.7    4e-15   Medicago truncatula
ref|XP_009399054.1|  PREDICTED: protein PAT1 homolog 1-like           84.3    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294192.1|  PREDICTED: protein PAT1 homolog 1                84.0    6e-15   Fragaria vesca subsp. vesca
gb|KHM98853.1|  hypothetical protein glysoja_022263                   69.3    9e-15   Glycine soja [wild soybean]
gb|EAY75968.1|  hypothetical protein OsI_03887                        83.6    1e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90621.1|  predicted protein                                    83.6    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00541.1|  predicted protein                                    83.6    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52590.1|  hypothetical protein TRIUR3_20541                     83.2    1e-14   Triticum urartu
emb|CDY50269.1|  BnaAnng10330D                                        58.9    1e-14   Brassica napus [oilseed rape]
gb|EMT11670.1|  Protein PAT1-1-like protein                           82.8    1e-14   
ref|XP_009397355.1|  PREDICTED: protein PAT1 homolog 1-like           82.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009147964.1|  PREDICTED: protein PAT1 homolog 1                58.9    2e-14   Brassica rapa
ref|XP_009416762.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  82.0    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416761.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  82.0    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002457098.1|  hypothetical protein SORBIDRAFT_03g001160        81.6    3e-14   
ref|XP_006647188.1|  PREDICTED: protein PAT1 homolog 1-like           82.0    3e-14   Oryza brachyantha
ref|XP_002513421.1|  conserved hypothetical protein                   54.7    4e-14   Ricinus communis
ref|XP_004952292.1|  PREDICTED: uncharacterized protein LOC101759904  81.6    5e-14   Setaria italica
ref|XP_010497980.1|  PREDICTED: protein PAT1 homolog 1-like           59.7    5e-14   Camelina sativa [gold-of-pleasure]
gb|KJB08599.1|  hypothetical protein B456_001G092700                  81.3    5e-14   Gossypium raimondii
gb|EEC72953.1|  hypothetical protein OsI_06835                        81.3    5e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001172909.1|  Os02g0295700                                     81.3    5e-14   
gb|KJB08598.1|  hypothetical protein B456_001G092700                  81.3    5e-14   Gossypium raimondii
gb|EAZ23222.1|  hypothetical protein OsJ_06910                        81.3    5e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86044.1|  hypothetical protein OsI_07409                        81.3    5e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001044369.2|  Os01g0769000                                     81.3    6e-14   
ref|NP_001046960.1|  Os02g0517300                                     81.3    6e-14   
gb|EAY85452.1|  hypothetical protein OsI_06832                        81.3    6e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006406189.1|  hypothetical protein EUTSA_v10020108mg           53.9    6e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006648671.1|  PREDICTED: uncharacterized protein LOC102700029  80.9    6e-14   Oryza brachyantha
gb|EAZ13676.1|  hypothetical protein OsJ_03596                        80.9    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010480501.1|  PREDICTED: protein PAT1 homolog 1-like           58.9    7e-14   
dbj|BAJ94686.1|  predicted protein                                    80.9    8e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI34052.3|  unnamed protein product                              72.8    9e-14   Vitis vinifera
gb|KJB42926.1|  hypothetical protein B456_007G174200                  80.5    1e-13   Gossypium raimondii
ref|XP_007149274.1|  hypothetical protein PHAVU_005G056500g           80.1    1e-13   Phaseolus vulgaris [French bean]
ref|XP_006845982.1|  hypothetical protein AMTR_s00155p00028780        80.1    1e-13   Amborella trichopoda
ref|XP_001755124.1|  predicted protein                                60.8    1e-13   
ref|XP_003568135.1|  PREDICTED: protein PAT1 homolog 1-like           79.7    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_004961544.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  79.7    2e-13   Setaria italica
ref|XP_006646364.1|  PREDICTED: uncharacterized protein LOC102701783  79.7    2e-13   Oryza brachyantha
ref|NP_001145976.1|  hypothetical protein                             79.3    2e-13   Zea mays [maize]
ref|XP_004961543.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  79.3    2e-13   Setaria italica
gb|EMS48493.1|  hypothetical protein TRIUR3_07139                     79.3    3e-13   Triticum urartu
ref|XP_010238435.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  78.6    3e-13   
ref|XP_003578526.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  78.6    3e-13   Brachypodium distachyon [annual false brome]
ref|XP_004967457.1|  PREDICTED: protein PAT1 homolog 1-like           78.6    4e-13   Setaria italica
ref|XP_010228365.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  78.6    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_010228364.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  78.6    4e-13   
ref|XP_002868239.1|  hypothetical protein ARALYDRAFT_915331           53.9    4e-13   Arabidopsis lyrata subsp. lyrata
ref|NP_001046606.2|  Os02g0294700                                     78.2    5e-13   
emb|CDY39512.1|  BnaA01g24760D                                        52.8    5e-13   Brassica napus [oilseed rape]
ref|XP_003568134.1|  PREDICTED: uncharacterized protein LOC100841028  78.2    5e-13   
ref|XP_009108988.1|  PREDICTED: uncharacterized protein LOC103834...  52.4    5e-13   Brassica rapa
ref|XP_009108983.1|  PREDICTED: uncharacterized protein LOC103834...  52.4    6e-13   Brassica rapa
gb|EAZ22672.1|  hypothetical protein OsJ_06342                        78.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001783364.1|  predicted protein                                59.7    6e-13   
ref|XP_002441360.1|  hypothetical protein SORBIDRAFT_09g025190        77.8    6e-13   Sorghum bicolor [broomcorn]
ref|XP_010459204.1|  PREDICTED: protein PAT1 homolog 1-like           57.4    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002890176.1|  hypothetical protein ARALYDRAFT_889054           57.4    1e-12   Arabidopsis lyrata subsp. lyrata
gb|KJB82134.1|  hypothetical protein B456_013G178200                  76.3    2e-12   Gossypium raimondii
ref|XP_010440363.1|  PREDICTED: protein PAT1 homolog 1-like           50.1    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010496132.1|  PREDICTED: protein PAT1 homolog 1-like           50.1    2e-12   Camelina sativa [gold-of-pleasure]
gb|KJB12766.1|  hypothetical protein B456_002G0357002                 50.4    2e-12   Gossypium raimondii
ref|XP_009145394.1|  PREDICTED: uncharacterized protein LOC103869095  52.4    2e-12   Brassica rapa
emb|CDY35105.1|  BnaA06g11150D                                        57.0    2e-12   Brassica napus [oilseed rape]
emb|CDY10630.1|  BnaA05g17320D                                        52.8    3e-12   Brassica napus [oilseed rape]
ref|XP_010692206.1|  PREDICTED: protein PAT1 homolog 1                75.5    4e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008655297.1|  PREDICTED: uncharacterized protein LOC100383...  75.1    5e-12   
ref|XP_010435003.1|  PREDICTED: protein PAT1 homolog 1-like           50.1    5e-12   Camelina sativa [gold-of-pleasure]
gb|EMT27507.1|  hypothetical protein F775_52260                       74.7    7e-12   
emb|CDY40046.1|  BnaC05g12690D                                        55.1    8e-12   Brassica napus [oilseed rape]
ref|XP_009149098.1|  PREDICTED: protein PAT1 homolog 1-like           55.1    8e-12   Brassica rapa
gb|EMS67142.1|  hypothetical protein TRIUR3_06605                     73.9    1e-11   Triticum urartu
ref|XP_010684289.1|  PREDICTED: uncharacterized protein LOC104898860  74.3    1e-11   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY46332.1|  BnaC01g31660D                                        48.5    1e-10   Brassica napus [oilseed rape]
gb|EPS71565.1|  hypothetical protein M569_03193                       67.4    1e-09   Genlisea aurea
gb|KFK42288.1|  hypothetical protein AALP_AA2G236100                  65.9    5e-09   Arabis alpina [alpine rockcress]
gb|AEN81988.1|  AT3G22270-like protein                                62.8    6e-09   Capsella grandiflora
gb|AEN81985.1|  AT3G22270-like protein                                62.8    6e-09   Capsella grandiflora
gb|AEN81987.1|  AT3G22270-like protein                                62.8    6e-09   Capsella grandiflora
gb|AEN81990.1|  AT3G22270-like protein                                62.8    6e-09   Capsella rubella
ref|XP_006300753.1|  hypothetical protein CARUB_v10019819mg           65.1    8e-09   
emb|CDX79293.1|  BnaC06g20100D                                        63.9    2e-08   
ref|XP_009104546.1|  PREDICTED: protein PAT1 homolog 1-like           63.9    2e-08   Brassica rapa
ref|NP_565199.1|  uncharacterized protein                             63.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68009.1|  BnaA07g20490D                                        63.9    2e-08   
emb|CDY23806.1|  BnaA01g21570D                                        63.9    2e-08   Brassica napus [oilseed rape]
gb|KDO64328.1|  hypothetical protein CISIN_1g0038252mg                62.4    6e-08   Citrus sinensis [apfelsine]
ref|XP_006481341.1|  PREDICTED: uncharacterized protein LOC102618...  62.4    6e-08   Citrus sinensis [apfelsine]
ref|XP_006481340.1|  PREDICTED: uncharacterized protein LOC102618...  62.4    6e-08   Citrus sinensis [apfelsine]
ref|XP_006429752.1|  hypothetical protein CICLE_v10013436mg           62.4    6e-08   
gb|KDO64329.1|  hypothetical protein CISIN_1g0038252mg                62.4    6e-08   Citrus sinensis [apfelsine]
gb|KDO64330.1|  hypothetical protein CISIN_1g0038252mg                62.4    7e-08   Citrus sinensis [apfelsine]
ref|XP_010429781.1|  PREDICTED: protein PAT1 homolog 1-like           62.0    9e-08   Camelina sativa [gold-of-pleasure]
emb|CDX88505.1|  BnaC06g39490D                                        61.6    1e-07   
ref|XP_009106629.1|  PREDICTED: protein PAT1 homolog 1                61.2    2e-07   Brassica rapa
emb|CDX87408.1|  BnaA07g34650D                                        61.2    2e-07   
ref|XP_006416798.1|  hypothetical protein EUTSA_v10006845mg           59.3    6e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010419368.1|  PREDICTED: protein PAT1 homolog 1-like           58.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006389922.1|  hypothetical protein EUTSA_v10018148mg           58.5    1e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009406733.1|  PREDICTED: uncharacterized protein LOC103989...  57.4    3e-06   
emb|CDY54867.1|  BnaC01g22630D                                        57.0    5e-06   Brassica napus [oilseed rape]
ref|XP_008344205.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.8    1e-05   
ref|XP_006478034.1|  PREDICTED: uncharacterized protein LOC102611...  53.5    6e-05   Citrus sinensis [apfelsine]
ref|XP_006478033.1|  PREDICTED: uncharacterized protein LOC102611...  53.5    6e-05   Citrus sinensis [apfelsine]
gb|KDO40140.1|  hypothetical protein CISIN_1g003844mg                 53.5    6e-05   Citrus sinensis [apfelsine]
ref|XP_006441043.1|  hypothetical protein CICLE_v10018922mg           53.5    6e-05   Citrus clementina [clementine]
gb|KDO40142.1|  hypothetical protein CISIN_1g003844mg                 53.5    6e-05   Citrus sinensis [apfelsine]
gb|KDO40141.1|  hypothetical protein CISIN_1g003844mg                 52.8    9e-05   Citrus sinensis [apfelsine]



>ref|XP_008787377.1| PREDICTED: uncharacterized protein LOC103705447 [Phoenix dactylifera]
Length=347

 Score = 96.3 bits (238),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ +     +T +I  E ARAI+ EMPVELLRASLPHTNE QRKML++F Q S+P
Sbjct  267  KYDSIMQMLLMQAPNTSIIGSEAARAISREMPVELLRASLPHTNEHQRKMLLDFAQRSMP  326

Query  343  LAGFNSRGGSSRKINAESV  287
            + GF++ GG S  + +ESV
Sbjct  327  ITGFSAHGGGSGPVTSESV  345


 Score = 93.2 bits (230),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVL+RA+ LLT+PQAA+++SM N ALWQASFDAFF+LLTKYC+
Sbjct  209  LGSSAGDGASIIIKSVLDRATELLTEPQAASNYSMSNRALWQASFDAFFRLLTKYCL  265



>ref|XP_003545913.2| PREDICTED: uncharacterized protein LOC100787648 [Glycine max]
 gb|KHN27738.1| Protein PAT1 like 1 [Glycine soja]
Length=886

 Score = 90.9 bits (224),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ+ + Q+ +  D I P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q SI
Sbjct  804  KYHSIMQSMLIQSTSDVDDIGPDAAKSIGREMPVELLRASLPHTDERQRKLLLDFAQRSI  863

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  GGS   +N+E+V
Sbjct  864  PVVGFNSNTGGSGSHVNSETV  884


 Score = 82.0 bits (201),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS +GDGASLI  SVLERA+ LLTDP AA +F+M N + WQASFD FF LLTKYC+
Sbjct  746  IGSTSGDGASLILISVLERATELLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCM  802



>ref|XP_008383068.1| PREDICTED: uncharacterized protein LOC103445792 isoform X2 [Malus 
domestica]
Length=824

 Score = 90.5 bits (223),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP AA++++M N  LWQASFD FF LLTKYCV
Sbjct  684  LGSPAGDGASLILNSVLERATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCV  740


 Score = 82.0 bits (201),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++  Q   +  VI  + ARAI  EMPVELLRASLPHT+E QR++L++F Q S+
Sbjct  742  KYDTVMQSLLTQAPPNVTVIGSDAARAIGREMPVELLRASLPHTDEHQRQLLLDFTQRSM  801

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+   NSR GG+   +N+ESV
Sbjct  802  PIGASNSRDGGNGAHMNSESV  822



>ref|XP_010645008.1| PREDICTED: protein PAT1 homolog 1 isoform X3 [Vitis vinifera]
Length=778

 Score = 87.4 bits (215),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ++  Q  ++   +  + ARAI+ EMPVELLRASLPHTNE Q+K+L++F   S+
Sbjct  696  KYDSIMQSLLMQASSNMTAVGADAARAISREMPVELLRASLPHTNEHQKKLLLDFAHRSM  755

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS+ GGS   +N+ESV
Sbjct  756  PVMGFNSQGGGSGSHVNSESV  776


 Score = 83.6 bits (205),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVLERA+ +LTDP  A + +M N ALWQASFD FF LLTKYC+
Sbjct  638  LGSSAGDGASVILKSVLERATEILTDPHVAGNCNMNNRALWQASFDEFFGLLTKYCL  694



>ref|XP_010645006.1| PREDICTED: uncharacterized protein LOC100267869 isoform X1 [Vitis 
vinifera]
Length=828

 Score = 87.4 bits (215),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ++  Q  ++   +  + ARAI+ EMPVELLRASLPHTNE Q+K+L++F   S+
Sbjct  746  KYDSIMQSLLMQASSNMTAVGADAARAISREMPVELLRASLPHTNEHQKKLLLDFAHRSM  805

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS+ GGS   +N+ESV
Sbjct  806  PVMGFNSQGGGSGSHVNSESV  826


 Score = 83.6 bits (205),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVLERA+ +LTDP  A + +M N ALWQASFD FF LLTKYC+
Sbjct  688  LGSSAGDGASVILKSVLERATEILTDPHVAGNCNMNNRALWQASFDEFFGLLTKYCL  744



>ref|XP_010645007.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Vitis vinifera]
Length=781

 Score = 87.4 bits (215),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ++  Q  ++   +  + ARAI+ EMPVELLRASLPHTNE Q+K+L++F   S+
Sbjct  699  KYDSIMQSLLMQASSNMTAVGADAARAISREMPVELLRASLPHTNEHQKKLLLDFAHRSM  758

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS+ GGS   +N+ESV
Sbjct  759  PVMGFNSQGGGSGSHVNSESV  779


 Score = 83.6 bits (205),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVLERA+ +LTDP  A + +M N ALWQASFD FF LLTKYC+
Sbjct  641  LGSSAGDGASVILKSVLERATEILTDPHVAGNCNMNNRALWQASFDEFFGLLTKYCL  697



>ref|XP_004488834.1| PREDICTED: uncharacterized protein LOC101500903 [Cicer arietinum]
Length=879

 Score = 89.4 bits (220),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q+ T+ D I P+ A AI+ EMPVELLRASLPHT++ QRK+L++F Q S+
Sbjct  797  KYHSIMQSLLIQSTTNVDDIGPDAANAISKEMPVELLRASLPHTDDRQRKLLLDFAQRSV  856

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  GGS   +N+E+V
Sbjct  857  PVVGFNSNAGGSGGLVNSETV  877


 Score = 81.3 bits (199),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGASLI  SVLERA+ LLTDP AA +++M N + WQASFD FF LLTKYC+
Sbjct  739  VGSTAGDGASLILVSVLERAAELLTDPHAACNYNMGNRSFWQASFDEFFGLLTKYCM  795



>ref|XP_006585424.1| PREDICTED: uncharacterized protein LOC100812450 isoform X2 [Glycine 
max]
Length=938

 Score = 89.7 bits (221),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ+ + Q+ ++ D I P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q S+
Sbjct  856  KYHSIMQSMLIQSTSNVDDIGPDAAKSIGREMPVELLRASLPHTDEHQRKLLLDFAQRSV  915

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  GGS   +N+E+V
Sbjct  916  PVVGFNSNTGGSGGHVNSETV  936


 Score = 80.1 bits (196),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS +GDGASL+  SVLERA+ +LTDP AA +F+M N + WQASFD FF LLTKYC+
Sbjct  798  IGSTSGDGASLVLISVLERATEVLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCM  854



>ref|XP_003532940.1| PREDICTED: uncharacterized protein LOC100812450 isoform X1 [Glycine 
max]
Length=886

 Score = 89.7 bits (221),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ+ + Q+ ++ D I P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q S+
Sbjct  804  KYHSIMQSMLIQSTSNVDDIGPDAAKSIGREMPVELLRASLPHTDEHQRKLLLDFAQRSV  863

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  GGS   +N+E+V
Sbjct  864  PVVGFNSNTGGSGGHVNSETV  884


 Score = 80.1 bits (196),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS +GDGASL+  SVLERA+ +LTDP AA +F+M N + WQASFD FF LLTKYC+
Sbjct  746  IGSTSGDGASLVLISVLERATEVLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCM  802



>ref|XP_003545912.1| PREDICTED: protein PAT1 homolog 1-like [Glycine max]
Length=828

 Score = 84.7 bits (208),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D++MQ+ + Q   +   I  +VARAI+ EMPVELLRASLPHT++ Q+K L++F Q SI
Sbjct  746  KYDSVMQSFLIQGTPNMASIGSDVARAISKEMPVELLRASLPHTDDRQKKQLLDFAQRSI  805

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  GG    +N+ESV
Sbjct  806  PIVGFNSNSGGQGHHVNSESV  826


 Score = 84.3 bits (207),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI  SVLERA+ LLTDP AA+++++ N +LWQA+FD FF LLTKYCV
Sbjct  688  LGSSAGDGASLILVSVLERATELLTDPHAASNYNIANRSLWQATFDEFFGLLTKYCV  744



>ref|XP_011097653.1| PREDICTED: protein PAT1 homolog 1 [Sesamum indicum]
Length=817

 Score = 89.0 bits (219),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS+I KSVLERA+ LLTDP AA + S PN A WQASFDAFF LLTKYC
Sbjct  684  IGSPAGDGASVILKSVLERATELLTDPHAAGNCSPPNRAFWQASFDAFFGLLTKYC  739


 Score = 79.3 bits (194),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+++Q+      S   I  +VA+AI+ EMPVELLRASLPHT+E QRK+L+ F Q S+P
Sbjct  742  KYDSVVQSFLSQGPSEATIGADVAKAISKEMPVELLRASLPHTSEQQRKLLLEFAQRSMP  801

Query  343  LAGFNSRGGSSRKIN  299
            + GF  + G S ++N
Sbjct  802  VLGFGGQSGGSAQMN  816



>gb|KEH38343.1| topoisomerase II-associated protein PAT1 [Medicago truncatula]
Length=880

 Score = 84.0 bits (206),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   + D I  + A+AI+ EMPVELLRASLPHT++ QRK+L++F Q S+
Sbjct  798  KYHSIMQSLLLQNAPNVDDIGSDAAKAISKEMPVELLRASLPHTDDRQRKLLLDFAQRSV  857

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  GGS   +N+E+V
Sbjct  858  PVIGFNSNAGGSGGLVNSETV  878


 Score = 83.2 bits (204),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGASLI  SVLERA+ LLTDPQAA +++M N + WQASFD FF L+TKYC+
Sbjct  740  VGSTAGDGASLILVSVLERATELLTDPQAACNYNMGNRSFWQASFDEFFGLITKYCM  796



>ref|XP_007214538.1| hypothetical protein PRUPE_ppa002090mg [Prunus persica]
 gb|EMJ15737.1| hypothetical protein PRUPE_ppa002090mg [Prunus persica]
Length=718

 Score = 90.1 bits (222),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP AA+++++ N ALWQASFD FF LLTKYCV
Sbjct  578  LGSPAGDGASLILNSVLERATELLTDPHAASNYNVTNRALWQASFDEFFGLLTKYCV  634


 Score = 76.3 bits (186),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ+ + +   +  VI  + A + + EMPVELLRASLPHT+E QR+ML++F Q S+
Sbjct  636  KYDSIMQSRLMEAPPNVPVIGADTAISFSREMPVELLRASLPHTDEHQRQMLLDFTQRSM  695

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+   NSR GG+   +N+ESV
Sbjct  696  PIGASNSRDGGNGTHMNSESV  716



>ref|XP_002520595.1| hypothetical protein RCOM_0673440 [Ricinus communis]
 gb|EEF41828.1| hypothetical protein RCOM_0673440 [Ricinus communis]
Length=739

 Score = 89.0 bits (219),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSP+GDGAS+I KS+LERAS LL DPQ A S ++PN ALWQASFD FF LLTKYC++
Sbjct  600  LGSPSGDGASVILKSLLERASKLLNDPQTAASRAVPNFALWQASFDEFFDLLTKYCLI  657


 Score = 77.0 bits (188),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  547  TSYEILCCKFDNIMQAVAQTETST-DVISPEVARAINSEMPVELLRASLPHTNELQRKML  371
            T Y ++  K++ I+Q+V   ++S  + I  EV  A   EMPVELLRA LPHTNE Q ++L
Sbjct  652  TKYCLI--KYETILQSVYAKDSSCPEGIELEVRAATKREMPVELLRACLPHTNERQMELL  709

Query  370  MNFGQGSIPLAGFNSRGGSSRKINAESV  287
             +FGQ   P+ GFN+  GS+  +N+ESV
Sbjct  710  RHFGQQRSPITGFNAHSGSNNHMNSESV  737



>ref|XP_006585425.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Glycine max]
Length=682

 Score = 84.0 bits (206),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI  SVLERA+ LLTDP AA+++++ N +LWQA+FD FF LLTKYCV
Sbjct  542  LGSSAGDGASLILVSVLERATELLTDPHAASNYNIANRSLWQATFDEFFGLLTKYCV  598


 Score = 81.6 bits (200),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D++MQ+ + Q   +   I  +VARAI+ EMPVELLRASLPHT++ Q+K L++F Q SI
Sbjct  600  KYDSVMQSFLIQGTPNMASIGSDVARAISREMPVELLRASLPHTDDRQKKQLLDFAQRSI  659

Query  346  PLAGFNSRGGS-SRKINAESV  287
            P+ GFNS  G     +N+ESV
Sbjct  660  PVVGFNSNSGDQGHHVNSESV  680



>ref|XP_008226080.1| PREDICTED: protein PAT1 homolog 1 [Prunus mume]
Length=833

 Score = 90.1 bits (222),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP AA+++++ N ALWQASFD FF LLTKYCV
Sbjct  693  LGSPAGDGASLILNSVLERATELLTDPHAASNYNVTNRALWQASFDEFFGLLTKYCV  749


 Score = 74.7 bits (182),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ+ + +   +  VI  + A + + EMPVELLRASLPHT+E QR+ML++F Q S+
Sbjct  751  KYDSIMQSRLMEAPPNVPVIGADTAISFSREMPVELLRASLPHTDEHQRQMLLDFTQRSM  810

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+   N+R GG+   +N+ESV
Sbjct  811  PIGASNNRDGGNGTHMNSESV  831



>ref|XP_010109206.1| hypothetical protein L484_002129 [Morus notabilis]
 gb|EXC21328.1| hypothetical protein L484_002129 [Morus notabilis]
Length=816

 Score = 87.8 bits (216),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGASLI KSVLERA+ LLTDP AA++++M N ALWQASFD FF LLTKYC
Sbjct  676  LGSSAGDGASLILKSVLERATELLTDPNAASNYNMQNRALWQASFDEFFGLLTKYC  731


 Score = 75.9 bits (185),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ++  Q  T+T VI  + ARAI+ EMPVEL+RASLPHT+  QR++L++F Q S+
Sbjct  734  KYDSIMQSLLTQGPTNTAVIGADAARAISREMPVELVRASLPHTDVRQRQLLLDFTQRSM  793

Query  346  PLAGFNS-RGGSSRKINAESV  287
             L   N+  GG+  ++N+ESV
Sbjct  794  SLGASNTPPGGNDGRMNSESV  814



>gb|KJB42927.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=797

 Score = 81.6 bits (200),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K++ I Q++     + +VI  E   A+  EMP ELLR+SLPHTNE QRK+LM+F Q S+P
Sbjct  720  KYETIKQSIQNQSPTMEVIGSE---AMRQEMPCELLRSSLPHTNEAQRKLLMDFSQRSVP  776

Query  343  LAGFNSRGGSSRKINAESV  287
            + G NS  GS+ +IN+ESV
Sbjct  777  MNGANSHAGSTSQINSESV  795


 Score = 80.5 bits (197),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV
Sbjct  664  LGSPAGDGASVILKSVLERATQLLSHP--SGNCSMPNYAFWRASFDEFFTLLTKYCV  718



>gb|KHN27739.1| Protein PAT1 like 1 [Glycine soja]
Length=837

 Score = 84.3 bits (207),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI  SVLERA+ LLTDP AA+++++ N +LWQA+FD FF LLTKYCV
Sbjct  688  LGSSAGDGASLILVSVLERATELLTDPHAASNYNIANRSLWQATFDEFFGLLTKYCV  744


 Score = 77.8 bits (190),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D++MQ+ + Q   +   I  +VARAI+ EMPVELLRASLPHT++ Q+K L++F Q SI
Sbjct  746  KYDSVMQSFLIQGTPNMASIGSDVARAISREMPVELLRASLPHTDDRQKKQLLDFAQRSI  805

Query  346  PLAGFNSRGG  317
            P+ GFNS  G
Sbjct  806  PIVGFNSNSG  815



>ref|XP_009416760.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score = 82.0 bits (201),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGAS+I KSVL+RA+ LLTDP AA+++S+ +  LWQASFDAFF LLTKYC+
Sbjct  698  VGSSAGDGASIIVKSVLDRATDLLTDPYAASNYSVSSRTLWQASFDAFFGLLTKYCL  754


 Score = 79.7 bits (195),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+ MQ +     ST +   E  RAI+ EMP+ELL ASLPHTNE QRK+L++F Q S+P
Sbjct  756  KYDSTMQTLLMQAPSTAITGSEATRAISREMPIELLHASLPHTNENQRKVLLDFTQRSMP  815

Query  343  LAGFNSRGGSSRKINAESV  287
            +  F++ G  SR  ++ESV
Sbjct  816  VVHFSTHGVLSRAESSESV  834



>ref|XP_009419549.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=813

 Score = 83.2 bits (204),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+++IMQ+++    +  V   EV RAI+ EMPVELLRASLPHTNE QRK+L++F Q +IP
Sbjct  741  KYESIMQSLSMQSANAAVAGSEVTRAISREMPVELLRASLPHTNEHQRKLLLDFAQRTIP  800

Query  343  LAGFNSRGGS  314
              G N+ GGS
Sbjct  801  ATGQNAHGGS  810


 Score = 78.6 bits (192),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I K+VL+RA+ LLTD + A ++S+P+  LWQASF+AFF LLTKYC+
Sbjct  683  LGSSAGDGASIIIKAVLDRATQLLTDQKNAGNYSIPSCNLWQASFNAFFGLLTKYCL  739



>ref|XP_009419548.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=739

 Score = 83.2 bits (204),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+++IMQ+++    +  V   EV RAI+ EMPVELLRASLPHTNE QRK+L++F Q +IP
Sbjct  667  KYESIMQSLSMQSANAAVAGSEVTRAISREMPVELLRASLPHTNEHQRKLLLDFAQRTIP  726

Query  343  LAGFNSRGGS  314
              G N+ GGS
Sbjct  727  ATGQNAHGGS  736


 Score = 78.2 bits (191),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I K+VL+RA+ LLTD + A ++S+P+  LWQASF+AFF LLTKYC+
Sbjct  609  LGSSAGDGASIIIKAVLDRATQLLTDQKNAGNYSIPSCNLWQASFNAFFGLLTKYCL  665



>gb|KHG07107.1| Protein PAT1 [Gossypium arboreum]
Length=716

 Score = 82.0 bits (201),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K++ I Q++     + +VI  E   A+  EMP ELLR+SLPHTNE QRK+LM+F Q S+P
Sbjct  639  KYETIKQSIQNQSPTMEVIGSE---AMRQEMPCELLRSSLPHTNEAQRKLLMDFSQRSVP  695

Query  343  LAGFNSRGGSSRKINAESV  287
            + G NS  GS+ +IN+ESV
Sbjct  696  MNGANSHAGSTSQINSESV  714


 Score = 79.0 bits (193),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV
Sbjct  583  LGSPAGDGASVILKSVLERATQLLSYP--SGNCSMPNYAFWRASFDEFFTLLTKYCV  637



>gb|KHN16432.1| hypothetical protein glysoja_046875 [Glycine soja]
Length=823

 Score = 88.2 bits (217),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   +  VI  + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+
Sbjct  741  KYQSIMQSLLVQGMENVSVIGSDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQCSV  800

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  G SS  +N+E+V
Sbjct  801  PVVGFNSYTGSSSGHVNSETV  821


 Score = 72.8 bits (177),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS I  SVLERA+ LLTDP  A S+ + N + WQASFD FF LLT YC+
Sbjct  684  LGSTAGDGASRILVSVLERATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCM  739



>ref|XP_007149276.1| hypothetical protein PHAVU_005G0567001g, partial [Phaseolus vulgaris]
 gb|ESW21270.1| hypothetical protein PHAVU_005G0567001g, partial [Phaseolus vulgaris]
Length=220

 Score = 82.0 bits (201),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS +GDGASLI  SVLERA+ LLTDP AA +++M N + WQASFD FF LLTKYC+
Sbjct  81   IGSTSGDGASLILISVLERATELLTDPHAACNYNMGNRSFWQASFDEFFGLLTKYCM  137


 Score = 79.0 bits (193),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ+ + Q+ ++ D + P+ A+AI+ EMPVELLRASLPHT+E QRK+L++F Q SI
Sbjct  139  KYHSIMQSMLIQSTSNVDDVGPDAAKAISREMPVELLRASLPHTDERQRKLLLDFAQHSI  198

Query  346  PLAGFNSRGGSSRKINAESV  287
            P+ GFN+ GG+   +N+E+V
Sbjct  199  PVVGFNNTGGNGGHVNSETV  218



>ref|XP_006597999.1| PREDICTED: uncharacterized protein LOC100779096 isoform X3 [Glycine 
max]
Length=826

 Score = 87.4 bits (215),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   +  VI  + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+
Sbjct  744  KYQSIMQSLLVQGMENVSVIGSDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQRSV  803

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  G SS  +N+E+V
Sbjct  804  PVVGFNSYTGSSSGHVNSETV  824


 Score = 72.8 bits (177),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS I  SVLERA+ LLTDP  A S+ + N + WQASFD FF LLT YC+
Sbjct  687  LGSTAGDGASRILVSVLERATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCM  742



>ref|XP_006597997.1| PREDICTED: uncharacterized protein LOC100779096 isoform X1 [Glycine 
max]
Length=881

 Score = 87.4 bits (215),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   +  VI  + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+
Sbjct  799  KYQSIMQSLLVQGMENVSVIGSDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQRSV  858

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  G SS  +N+E+V
Sbjct  859  PVVGFNSYTGSSSGHVNSETV  879


 Score = 72.8 bits (177),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS I  SVLERA+ LLTDP  A S+ + N + WQASFD FF LLT YC+
Sbjct  742  LGSTAGDGASRILVSVLERATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCM  797



>ref|XP_006597998.1| PREDICTED: uncharacterized protein LOC100779096 isoform X2 [Glycine 
max]
Length=878

 Score = 87.4 bits (215),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   +  VI  + A+AI+ EMPVELLRASLPHTN+ QRK+L++FGQ S+
Sbjct  796  KYQSIMQSLLVQGMENVSVIGSDAAKAISREMPVELLRASLPHTNDHQRKLLLDFGQRSV  855

Query  346  PLAGFNSR-GGSSRKINAESV  287
            P+ GFNS  G SS  +N+E+V
Sbjct  856  PVVGFNSYTGSSSGHVNSETV  876


 Score = 72.8 bits (177),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS I  SVLERA+ LLTDP  A S+ + N + WQASFD FF LLT YC+
Sbjct  739  LGSTAGDGASRILVSVLERATELLTDPHGAGSY-VGNRSFWQASFDEFFGLLTMYCM  794



>emb|CDP13609.1| unnamed protein product [Coffea canephora]
Length=817

 Score = 89.4 bits (220),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGASLI KSVLERA+ LL DP+A+ + SMPN A WQASFDAFF LLTKYC
Sbjct  690  IGSPAGDGASLILKSVLERATDLLRDPRASGNCSMPNRAFWQASFDAFFGLLTKYC  745


 Score = 70.9 bits (172),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D IMQ+ ++QT      +S + A+AI+ EMPVELLRASLPHT+E QRK+L++F Q S+
Sbjct  748  KYDTIMQSFLSQTLPDMSNVSSDAAKAISKEMPVELLRASLPHTSEQQRKLLLDFAQQSM  807

Query  346  PL  341
            PL
Sbjct  808  PL  809



>ref|XP_004251956.1| PREDICTED: protein PAT1 homolog 1 [Solanum lycopersicum]
Length=817

 Score = 88.6 bits (218),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++ KS+LERA+ LL DP AA   SMPN A WQASFDAFF LLTKYC
Sbjct  685  VGSPAGDGASVVLKSILERATELLRDPHAAGKCSMPNRAFWQASFDAFFGLLTKYC  740


 Score = 69.7 bits (169),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ  + Q      V   + A+AI+ EMPVELLRASLPHT+E QRK+L+ F   S+
Sbjct  743  KYDTVMQCFLTQGPPDVAVSGSDAAKAISREMPVELLRASLPHTSEQQRKVLLEFAHRSM  802

Query  346  PLAGFNSRGGSS  311
            P+ G  S+ G+S
Sbjct  803  PVLGVGSQSGAS  814



>dbj|BAJ88890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score = 80.5 bits (197),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD  A +S++  N A WQASFDAFF LLTKYC+
Sbjct  673  LGSSAGDGASLIIKSVLDRATELLTDQHAVSSYTSSNRAPWQASFDAFFGLLTKYCL  729


 Score = 77.0 bits (188),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+++I+Q + + + S  VI  E ++A + EMPVELLRASLPHTNE QR+ML++F Q + P
Sbjct  731  KYESILQ-MFRMQASGSVIGSEASQATSREMPVELLRASLPHTNEQQRQMLLDFAQRTTP  789

Query  343  LAGFNSRGGSSRKINAESV  287
             + FN  G S   I +ESV
Sbjct  790  ASSFNPPGASGGHITSESV  808



>ref|XP_002308825.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
 gb|EEE92348.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
Length=789

 Score = 85.1 bits (209),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGA++I K +LERAS LL  PQA+ + +MPN ALWQASFD FF LLTKYC++
Sbjct  650  LGSPAGDGATVILKCLLERASKLLHGPQASANCAMPNFALWQASFDEFFDLLTKYCLI  707


 Score = 72.4 bits (176),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = -2

Query  547  TSYEILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKML  371
            T Y ++  K+D I+ +V A+T  ST+ I  EV  A   EMPVELLRA LPHTNE Q ++L
Sbjct  702  TKYCLI--KYDTILHSVYAKTPPSTEGIDLEVRAATKQEMPVELLRACLPHTNERQMELL  759

Query  370  MNFGQGSIPLAGFNSRGGSSRKINAESV  287
             +FGQ      G ++  G+S  IN+ESV
Sbjct  760  RHFGQQRNASTGLSAHPGNSGHINSESV  787



>ref|XP_006373646.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
 gb|ERP51443.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
Length=788

 Score = 83.6 bits (205),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGA++I K +LERAS LL  PQA+++  MPN ALWQASFD FF LL KYC++
Sbjct  649  LGSPAGDGATVILKCLLERASKLLHGPQASSNCGMPNFALWQASFDEFFDLLMKYCLI  706


 Score = 73.6 bits (179),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D I+Q+V A+T  S + I  EV  A   EMPVELLRA LPHTNE Q ++L +FGQ   
Sbjct  707  KYDTILQSVYAKTPPSAEGIDSEVRAATKREMPVELLRACLPHTNERQMELLRHFGQQRN  766

Query  346  PLAGFNSRGGSSRKINAESV  287
             + G ++  G+S  IN+ESV
Sbjct  767  TITGLSAHPGNSGHINSESV  786



>ref|XP_011008549.1| PREDICTED: uncharacterized protein LOC105113895 [Populus euphratica]
Length=788

 Score = 83.6 bits (205),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGA++I K +LERAS LL  PQA+++  MPN ALWQASFD FF LL KYC++
Sbjct  649  LGSPAGDGATVILKCLLERASKLLHGPQASSNCGMPNFALWQASFDEFFSLLMKYCLI  706


 Score = 73.2 bits (178),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D I Q+V A+T  S + I  EV  A   EMPVELLRA LPHTNE Q + L +FGQ   
Sbjct  707  KYDTIWQSVYAKTPPSAEGIDSEVRAATKREMPVELLRACLPHTNERQMERLRHFGQQRN  766

Query  346  PLAGFNSRGGSSRKINAESV  287
             + G N+  G+S  +N+ESV
Sbjct  767  TITGLNAHPGNSGHVNSESV  786



>ref|XP_004514400.1| PREDICTED: uncharacterized protein LOC101512706 [Cicer arietinum]
Length=880

 Score = 79.0 bits (193),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGD ASLI  SVLERA+ LLTDPQA  S +M N + WQASFD FF LLTKYC+
Sbjct  740  LGSSAGDAASLILVSVLERATELLTDPQAPCSNNMGNRSFWQASFDEFFGLLTKYCM  796


 Score = 77.4 bits (189),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   +   I  + A+A++ EMPVELLRASLPHT++ QRK+L++F Q S 
Sbjct  798  KYHSIMQSLLMQGTQNVAAIGSDAAKAVSKEMPVELLRASLPHTDDPQRKLLLDFAQRSA  857

Query  346  PLAGFNSRGGSSRK-INAESV  287
            P+ GFNS  GSS   +N+E+V
Sbjct  858  PVIGFNSHAGSSNSHVNSETV  878



>ref|XP_006388794.1| hypothetical protein POPTR_0098s00230g [Populus trichocarpa]
 gb|ERP47708.1| hypothetical protein POPTR_0098s00230g [Populus trichocarpa]
Length=655

 Score = 83.6 bits (205),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGA++I K +LERAS LL  PQA+++  MPN ALWQASFD FF LL KYC++
Sbjct  516  LGSPAGDGATVILKCLLERASKLLHGPQASSNCGMPNFALWQASFDEFFDLLMKYCLI  573


 Score = 72.4 bits (176),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D I+Q+V A+T  S + I  EV  A   EMPVE LRA LPHTNE Q ++L +FGQ   
Sbjct  574  KYDTILQSVYAKTPPSAEGIDSEVRAATKREMPVEFLRACLPHTNERQMELLRHFGQQRN  633

Query  346  PLAGFNSRGGSSRKINAESV  287
             + G ++  G+S  IN+ESV
Sbjct  634  TITGLSAHPGNSGHINSESV  653



>ref|XP_009361780.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=821

 Score = 87.0 bits (214),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP A ++ +M N  LWQASFD FF LLTKYCV
Sbjct  681  LGSPAGDGASLILNSVLERATELLTDPHAVSNCNMTNRQLWQASFDEFFGLLTKYCV  737


 Score = 68.6 bits (166),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++  Q   +  +I  + ARAI  EMPVELLRASLPHT+E QR++L++F Q S+
Sbjct  739  KYDTVMQSLLMQAPPNVAIIGSDAARAIGREMPVELLRASLPHTDEHQRQLLLDFTQRSM  798

Query  346  PL  341
            P+
Sbjct  799  PI  800



>ref|XP_011036076.1| PREDICTED: protein PAT1 homolog 1-like [Populus euphratica]
Length=789

 Score = 84.7 bits (208),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGA++I K +LERAS LL  PQA+ + +MPN ALWQASFD FF LLTKYC++
Sbjct  650  LGSPAGDGATVILKCLLERASKLLHGPQASANCAMPNFALWQASFDEFFDLLTKYCLI  707


 Score = 70.5 bits (171),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = -2

Query  547  TSYEILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKML  371
            T Y ++  K+D I+ +V A+T  ST+ I  EV  A   EMPVELLRA LPHTN+ Q ++L
Sbjct  702  TKYCLI--KYDTILHSVYAKTPPSTEGIDLEVRAATKQEMPVELLRACLPHTNDRQMELL  759

Query  370  MNFGQGSIPLAGFNSRGGSSRKINAESV  287
             +FGQ      G ++  G+S  IN+ESV
Sbjct  760  RHFGQQRKTSTGLSAHPGNSGLINSESV  787



>ref|XP_011004464.1| PREDICTED: uncharacterized protein LOC105110947 [Populus euphratica]
Length=789

 Score = 84.7 bits (208),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGA++I K +LERAS LL  PQA+ + +MPN ALWQASFD FF LLTKYC++
Sbjct  650  LGSPAGDGATVILKCLLERASKLLHGPQASANCAMPNFALWQASFDEFFDLLTKYCLI  707


 Score = 70.1 bits (170),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = -2

Query  547  TSYEILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKML  371
            T Y ++  K+D I+ +V A+T  ST+ I  EV  A   EMPVELLRA LPHTN+ Q ++L
Sbjct  702  TKYCLI--KYDTILHSVYAKTPPSTEGIDLEVRAATKQEMPVELLRACLPHTNDRQMELL  759

Query  370  MNFGQGSIPLAGFNSRGGSSRKINAESV  287
             +FGQ      G ++  G+S  IN+ESV
Sbjct  760  RHFGQQRKTSTGLSAYPGNSGLINSESV  787



>ref|XP_007133386.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
 gb|ESW05380.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
Length=882

 Score = 81.6 bits (200),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ++  Q   +  VI  + A+AI+ EMPVELLR SLPHTN+ QRK+L++F Q S+
Sbjct  800  KYQSIMQSLLVQGTPNVSVIGSDAAKAISREMPVELLRVSLPHTNDHQRKLLLDFAQRSV  859

Query  346  PLAGFNSRGGSS-RKINAESV  287
            P+ GFN+  GSS   +N+E+V
Sbjct  860  PVVGFNNYTGSSGGHVNSETV  880


 Score = 72.8 bits (177),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI  SVLERA+ LLTDP    S+ + N + WQASFD FF LLT YC+
Sbjct  743  LGSTAGDGASLILVSVLERATELLTDPHGGCSY-IANRSFWQASFDEFFGLLTMYCM  798



>gb|EYU33763.1| hypothetical protein MIMGU_mgv1a002553mg [Erythranthe guttata]
Length=660

 Score = 79.7 bits (195),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++ KSVL+RA+ LLTDP AA++ S  N   WQASFD FF LLTKYC
Sbjct  534  IGSPAGDGASVVLKSVLDRATELLTDPVAASNCSSSNRVFWQASFDEFFGLLTKYC  589


 Score = 72.4 bits (176),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+++Q+ ++Q  T    I+ +VA+AI  EMPVELLRASLPHTNE QRK+L+ F Q S+
Sbjct  592  KYDSVVQSFISQGSTDVASIAADVAKAITREMPVELLRASLPHTNEQQRKVLLEFAQRSM  651

Query  346  PLAG  335
            P+ G
Sbjct  652  PVLG  655



>ref|XP_009405382.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=756

 Score = 80.1 bits (196),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+V     +  +  PEV  AI  EMPVELLRASLPHTN+ QRK+L++F Q +IP
Sbjct  684  KYDSIMQSVPLQAPNAAIAGPEVTGAIRREMPVELLRASLPHTNDHQRKLLLDFAQRTIP  743

Query  343  LAGFNSRGG  317
             A  N+ GG
Sbjct  744  AAEHNADGG  752


 Score = 71.6 bits (174),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGD A++I KS+L++A+ LLTD   A + S+P+  +WQASFDAFF LLTKYC+
Sbjct  626  LGSSAGDCATVIIKSLLDKATELLTDRNTATNHSIPSRNMWQASFDAFFGLLTKYCL  682



>ref|XP_009405381.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=801

 Score = 80.1 bits (196),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+V     +  +  PEV  AI  EMPVELLRASLPHTN+ QRK+L++F Q +IP
Sbjct  729  KYDSIMQSVPLQAPNAAIAGPEVTGAIRREMPVELLRASLPHTNDHQRKLLLDFAQRTIP  788

Query  343  LAGFNSRGG  317
             A  N+ GG
Sbjct  789  AAEHNADGG  797


 Score = 72.0 bits (175),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGD A++I KS+L++A+ LLTD   A + S+P+  +WQASFDAFF LLTKYC+
Sbjct  671  LGSSAGDCATVIIKSLLDKATELLTDRNTATNHSIPSRNMWQASFDAFFGLLTKYCL  727



>ref|XP_006344917.1| PREDICTED: uncharacterized protein LOC102604826 isoform X1 [Solanum 
tuberosum]
Length=816

 Score = 88.2 bits (217),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++ KS+LERA+ LL DP AA   SMPN A WQASFDAFF LLTKYC
Sbjct  684  VGSPAGDGASVVLKSILERATELLRDPHAAGKCSMPNRAFWQASFDAFFGLLTKYC  739


 Score = 63.2 bits (152),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ  + Q      V   + A+AI+ EMPVELLRASLPHT+E QRK+L+ F   S+
Sbjct  742  KYDTVMQCFLTQGPPDVAVSGSDAAKAISREMPVELLRASLPHTSEQQRKVLLEFAHRSM  801

Query  346  PL  341
            P+
Sbjct  802  PV  803



>ref|XP_006344918.1| PREDICTED: uncharacterized protein LOC102604826 isoform X2 [Solanum 
tuberosum]
Length=815

 Score = 88.2 bits (217),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++ KS+LERA+ LL DP AA   SMPN A WQASFDAFF LLTKYC
Sbjct  683  VGSPAGDGASVVLKSILERATELLRDPHAAGKCSMPNRAFWQASFDAFFGLLTKYC  738


 Score = 63.2 bits (152),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ  + Q      V   + A+AI+ EMPVELLRASLPHT+E QRK+L+ F   S+
Sbjct  741  KYDTVMQCFLTQGPPDVAVSGSDAAKAISREMPVELLRASLPHTSEQQRKVLLEFAHRSM  800

Query  346  PL  341
            P+
Sbjct  801  PV  802



>ref|XP_009767161.1| PREDICTED: uncharacterized protein LOC104218381 [Nicotiana sylvestris]
Length=800

 Score = 85.1 bits (209),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++ KS+LERA+ +L DP AA   SMPN + WQASFDAFF LLTKYC
Sbjct  671  VGSPAGDGASIVLKSLLERATEILRDPHAAAQCSMPNRSFWQASFDAFFGLLTKYC  726


 Score = 66.2 bits (160),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ    Q      V   + A+AI+ EMPVELLRASLPHT+E Q+K+L++F   S+
Sbjct  729  KYDIVMQCFFTQAPPGVAVSGSDAAKAISREMPVELLRASLPHTSEQQKKVLLDFAHRSM  788

Query  346  PLAGFNSRGGSS  311
            P+ G  S+ G +
Sbjct  789  PVLGVGSQSGGT  800



>gb|EMT17005.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=1181

 Score = 79.3 bits (194),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGA+LI KSVL+RA+ LL DP +A ++S    +LWQASFDAFF LLTKYC
Sbjct  676  LGSSAGDGAALIIKSVLDRATELLADPHSAANYSRSTRSLWQASFDAFFGLLTKYC  731


 Score = 72.0 bits (175),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+ +I+Q  +  + S  +  PE ++A++ EMPVELLRASLPHT+E QR+ML++F + S+P
Sbjct  734  KYGSILQRFSM-QGSNSMAGPEASKAVSREMPVELLRASLPHTSEEQRQMLLDFARKSMP  792

Query  343  LAGFN---SRGGSS  311
            + G+N   +RGG S
Sbjct  793  VIGYNHSGARGGHS  806



>ref|XP_009604527.1| PREDICTED: uncharacterized protein LOC104099288 [Nicotiana tomentosiformis]
Length=800

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++ KS+LERA+ +L DP AA   S+PN + WQASFDAFF LLTKYC
Sbjct  671  VGSPAGDGASIVLKSLLERATEILRDPHAAAQCSIPNRSFWQASFDAFFGLLTKYC  726


 Score = 67.4 bits (163),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ    Q      V   + A+AI+ EMPVELLRASLPHT+E Q+K+L++F   S+
Sbjct  729  KYDTVMQCFFTQAPPGVAVSGSDAAKAISREMPVELLRASLPHTSEQQKKVLLDFAHRSM  788

Query  346  PLAGFNSRGGSS  311
            P+ G  S+ G +
Sbjct  789  PVLGVGSQSGGT  800



>gb|KHN26819.1| Protein PAT1 like 1 [Glycine soja]
Length=981

 Score = 80.1 bits (196),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS +GDGASL+  SVLERA+ +LTDP AA +F+M N + WQASFD FF LLTKYC+
Sbjct  814  IGSTSGDGASLVLISVLERATEVLTDPHAACNFNMGNRSFWQASFDEFFGLLTKYCM  870


 Score = 70.1 bits (170),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = -2

Query  523  KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+ +IMQ+ + Q+ ++ D I P+ A++I  EMPVELLRASLPHT+E QRK+L++F Q S+
Sbjct  872  KYHSIMQSMLIQSTSNVDDIGPDAAKSIGREMPVELLRASLPHTDEHQRKLLLDFAQRSV  931

Query  346  PL  341
            P+
Sbjct  932  PV  933



>gb|KDP44628.1| hypothetical protein JCGZ_22047 [Jatropha curcas]
Length=737

 Score = 85.1 bits (209),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGDGAS+I KS+LERA+ LL DPQAA + S+ N ALWQASF+ FF LLTKYC++
Sbjct  598  LGSPAGDGASIILKSLLERANKLLIDPQAAANCSVTNFALWQASFNEFFDLLTKYCLI  655


 Score = 63.2 bits (152),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = -2

Query  547  TSYEILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKML  371
            T Y ++  K+D I+Q V A    + +    EV  A   EMPVELLRA LPHT+E Q ++L
Sbjct  650  TKYCLI--KYDTILQTVYANNPPNAEGNDLEVRAATKREMPVELLRACLPHTDERQMELL  707

Query  370  MNFGQGSIPLAGFNSRGGSSRKINAESV  287
             +FGQ    + G N+  G+S ++N+E V
Sbjct  708  RHFGQQRNSVTGLNAHSGNSGQMNSELV  735



>gb|EPS66560.1| hypothetical protein M569_08215, partial [Genlisea aurea]
Length=772

 Score = 75.9 bits (185),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 6/81 (7%)
 Frame = -2

Query  526  CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            CK+D+ +  V++   S D +  E AR +  EMPVELL AS+PHT+E Q+K+L+NF Q S+
Sbjct  697  CKYDSAVHLVSRRMASGDAL--EAARTVGREMPVELLCASVPHTDESQKKLLLNFSQRSV  754

Query  346  PLAGFNSRGGSSRKINAESVS  284
            PL+GFN  G    +I+ ESV+
Sbjct  755  PLSGFNVHG----RIDPESVA  771


 Score = 70.5 bits (171),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLT-DPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVL+RA+YL + DPQ       P  ALWQASFDAFF LLTKYCV
Sbjct  640  LGSVAGDGASVILKSVLDRATYLRSSDPQFFGGIP-PYLALWQASFDAFFSLLTKYCV  696



>gb|ACL52964.1| unknown [Zea mays]
Length=286

 Score = 81.6 bits (200),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGD AS+I K VL+RA+ LLTD   A+++SM N +LWQASFDAFF LLT+YC+
Sbjct  167  LGSPAGDWASVIIKYVLDRATVLLTDHHVASNYSMRNRSLWQASFDAFFGLLTQYCM  223


 Score = 64.3 bits (155),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 8/69 (12%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            KFD ++         T  + P  A  I  EMPVELLRASLPHTNE QRK L++F Q ++P
Sbjct  225  KFDRVVH--------TAQLQPAAATVITREMPVELLRASLPHTNEAQRKQLLSFAQRTVP  276

Query  343  LAGFNSRGG  317
            +   +S G 
Sbjct  277  VGTHSSHGS  285



>ref|XP_008649853.1| PREDICTED: uncharacterized protein LOC103630586 [Zea mays]
 gb|AFW78649.1| hypothetical protein ZEAMMB73_732523 [Zea mays]
Length=797

 Score = 76.3 bits (186),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS +GDGASLI KSVL+RA+ LL DP +A ++S    +LW ASFDAFF LLTKYC
Sbjct  661  LGSASGDGASLIIKSVLDRATELLADPHSAANYSRSARSLWHASFDAFFGLLTKYC  716


 Score = 65.1 bits (157),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 8/82 (10%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+++I+Q  A  + S  +  PE  +A++ EMPVELLRASLPHTNE  R+ L++F + S  
Sbjct  719  KYESIVQRFA-MQGSNSMGGPETTKAVSREMPVELLRASLPHTNEQHRQTLLDFARKSTH  777

Query  343  LAGFN---SRGGSSRKINAESV  287
            L GF+   +RG     +N+ESV
Sbjct  778  LPGFSPTANRG----LVNSESV  795



>ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
 ref|XP_009594236.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=822

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 75/102 (74%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+D+IMQ++  Q+++  ++ISPE ARA++ EMPVELLRAS
Sbjct  721  ALWQASFDAFFGLLTKYCLSKYDSIMQSILTQSQSDAEMISPEAARAVSREMPVELLRAS  780

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHT+E QRK+L+NF Q S+P+ GFN+ GGSS  IN ESVSC
Sbjct  781  LPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPESVSC  822


 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA++LLTD QAANSFSMPNPALWQASFDAFF LLTKYC+
Sbjct  683  LGSPAGDGASIILKSVLERATHLLTDSQAANSFSMPNPALWQASFDAFFGLLTKYCL  739



>ref|XP_009757677.1| PREDICTED: uncharacterized protein LOC104210470 [Nicotiana sylvestris]
Length=814

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+D+IMQ++ AQT ++T++I  E ARA++ EMPVELLRA 
Sbjct  713  ALWQASFDAFFGLLTKYCLSKYDSIMQSIHAQTPSNTEMIGSEAARAVSREMPVELLRAG  772

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHTNE QRK+L NF Q S+P+ GFN+ GGSS +IN ESVSC
Sbjct  773  LPHTNEQQRKLLFNFAQRSMPVTGFNAHGGSSEQINPESVSC  814


 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGA++I KSVL+RA+YLLTDPQ   SFSMPNPALWQASFDAFF LLTKYC+   
Sbjct  675  LGSPAGDGATVILKSVLDRATYLLTDPQVGGSFSMPNPALWQASFDAFFGLLTKYCLSKY  734

Query  516  II*CKQLHRQKQAQT*LV  463
                + +H Q  + T ++
Sbjct  735  DSIMQSIHAQTPSNTEMI  752



>ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
 ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
Length=814

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+ +IMQ++ AQ+++  ++I PE ARA++ EMPVELLRAS
Sbjct  713  ALWQASFDAFFGLLTKYCLSKYGSIMQSILAQSQSDAEIIGPEAARAVSREMPVELLRAS  772

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHT+E QRK+L+NF Q S+P+ GFN+ GGSS  IN ESVSC
Sbjct  773  LPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPESVSC  814


 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA++LLT+ QAANSFSMPNPALWQASFDAFF LLTKYC+
Sbjct  675  LGSPAGDGASIILKSVLERATHLLTNSQAANSFSMPNPALWQASFDAFFGLLTKYCL  731



>ref|XP_009602223.1| PREDICTED: uncharacterized protein LOC104097371 [Nicotiana tomentosiformis]
Length=814

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+D+IMQ++ AQT ++T++I  E ARA++ EMPVELLRA 
Sbjct  713  ALWQASFDAFFGLLTKYCLSKYDSIMQSILAQTPSNTEMIGSEAARAVSREMPVELLRAG  772

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHTNE QRK+L NF Q S+P+ GFN+ GG+S +IN ESVSC
Sbjct  773  LPHTNEQQRKLLFNFAQRSMPVTGFNAHGGNSGQINPESVSC  814


 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGA++I KSVL+RA+YLLTDPQA  SFSMPNPALWQASFDAFF LLTKYC+
Sbjct  675  LGSPAGDGATVILKSVLDRATYLLTDPQAGGSFSMPNPALWQASFDAFFGLLTKYCL  731



>ref|NP_001169926.1| uncharacterized protein LOC100383823 [Zea mays]
 gb|ACN35277.1| unknown [Zea mays]
Length=574

 Score = 75.1 bits (183),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGA+++ K+VL+RA+ LLT+  AA  +  PN ALWQASF+AFF LLTKYC+
Sbjct  456  LGHAAGDGATVVIKAVLDRATELLTEQPAAPDYGAPNRALWQASFNAFFGLLTKYCM  512


 Score = 60.5 bits (145),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 7/68 (10%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            KFD+++  + +       +    A AI  E+PVELLRASLPHT+E QR++L+ F Q ++P
Sbjct  514  KFDSMVHTMHK-------LGAAAATAIRKELPVELLRASLPHTDEQQRRLLLEFAQRTVP  566

Query  343  LAGFNSRG  320
            ++G  S G
Sbjct  567  VSGHGSDG  574



>ref|XP_006351984.1| PREDICTED: protein PAT1 homolog 1-like [Solanum tuberosum]
Length=816

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA+YLLTDPQA +SFSMPNPALWQASFDAFF LLTKYC+
Sbjct  677  LGSPAGDGASVILKSVLERATYLLTDPQAVSSFSMPNPALWQASFDAFFGLLTKYCL  733


 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 9/101 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+IMQ+ V+  +++T++I  E ARA++ EMPVELLRASL
Sbjct  716  LWQASFDAFFGLLTKYCLSKYDSIMQSLVSPAQSNTELIGSEAARAVSREMPVELLRASL  775

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            PHTNE QRK+L+NF Q S+P+ GFN+ G SS +IN ESVSC
Sbjct  776  PHTNEHQRKLLLNFAQRSMPVTGFNAHGESSGQINPESVSC  816



>emb|CAD80089.1| hypothetical protein [Momordica charantia]
Length=90

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K++ I+Q++ +QT +STD+I  E ARAI  EMPVELLRASLPHTNE QRK+LM+F Q S+
Sbjct  11   KYETIVQSLFSQTPSSTDIIESEAARAIGREMPVELLRASLPHTNEPQRKLLMDFAQRSM  70

Query  346  PLAGFNSRGGSSRKINA  296
            P++GF++ GGSS ++N+
Sbjct  71   PVSGFSAHGGSSGQMNS  87



>ref|XP_006354416.1| PREDICTED: uncharacterized protein LOC102594467 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354417.1| PREDICTED: uncharacterized protein LOC102594467 isoform X2 [Solanum 
tuberosum]
Length=821

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA++LLTD QAANSFSMPNPALWQASFDAFF LLTKYC+
Sbjct  682  LGSPAGDGASIILKSVLERATHLLTDSQAANSFSMPNPALWQASFDAFFGLLTKYCL  738


 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+D+IMQ++ AQ++   ++I  + ARA++ EMPVELLRAS
Sbjct  720  ALWQASFDAFFGLLTKYCLSKYDSIMQSILAQSQPDAEMIGSDAARAVSREMPVELLRAS  779

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHTN+ Q+K+L+NF Q S+P+ GFNS GGSS  I+ ESVSC
Sbjct  780  LPHTNDHQKKLLLNFAQRSMPVTGFNSHGGSSGHIDPESVSC  821



>gb|KHG11535.1| Protein PAT1 [Gossypium arboreum]
Length=579

 Score = 83.6 bits (205),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS I KSVL+RA+ L+TD +AA +++M N +LW+ASFD FF LLTKYC+
Sbjct  457  LGSPAGDGASFILKSVLDRATKLMTDSRAAGNYNMTNLSLWKASFDEFFNLLTKYCI  513


 Score = 48.9 bits (115),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQ  356
            K+D +MQ++  Q + +  +   + A+AI  EMPV+LL A LPH N+ Q+K L++  Q
Sbjct  515  KYDTVMQSLRMQAKPNMAIDESDSAKAIKREMPVDLLHACLPHLNDQQKKQLLDLSQ  571



>ref|XP_007022269.1| Topoisomerase II-associated protein PAT1, putative [Theobroma 
cacao]
 gb|EOY13794.1| Topoisomerase II-associated protein PAT1, putative [Theobroma 
cacao]
Length=841

 Score = 82.0 bits (201),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSPAGDGASLI KSVL+RA+ L+ D +AA +++M N +LW+ASFD FF LLTKYCV
Sbjct  721  VGSPAGDGASLILKSVLDRATKLMIDFRAAGNYNMTNQSLWKASFDEFFNLLTKYCV  777


 Score = 50.1 bits (118),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++  Q +    +   +  RAI  EMPV+LL A LPH N+ Q+K++ +  Q S+
Sbjct  779  KYDTVMQSLRLQVKPDMAIDESDATRAIKREMPVDLLHACLPHINDQQKKLIWDLSQRSV  838



>ref|XP_007022271.1| Uncharacterized protein TCM_032442 [Theobroma cacao]
 gb|EOY13796.1| Uncharacterized protein TCM_032442 [Theobroma cacao]
Length=512

 Score = 83.2 bits (204),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSPAGDGASLI KSVL+RA+ L+ D +AA++++M N +LW+ASFD FF LLTKYCV
Sbjct  392  VGSPAGDGASLILKSVLDRATKLMIDFRAADNYNMTNQSLWKASFDEFFNLLTKYCV  448


 Score = 48.1 bits (113),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            KFD +MQ++  Q + +  +   +  RA   EMPV+LL A LPH N  Q+K++ +  Q S+
Sbjct  450  KFDTVMQSLRMQVKPNMAIGKSDATRAFKREMPVDLLHACLPHINAQQKKLIWDLSQRSM  509



>ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris]
Length=817

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLE+A++LLTDPQA +SFSMPNPALWQASFDAFF LLTKYC+
Sbjct  678  LGSPAGDGASIILKSVLEKATHLLTDPQAVSSFSMPNPALWQASFDAFFGLLTKYCL  734


 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------C-CKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+D+IMQ++  QT+++T+    E ARA++ EMPVELLRAS
Sbjct  716  ALWQASFDAFFGLLTKYCLSKYDSIMQSILPQTQSNTETFDAEAARAVSREMPVELLRAS  775

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHTNE QRK+L+NF Q S+P+ G N+ GGS+ +I+ ESVSC
Sbjct  776  LPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPESVSC  817



>ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=817

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLE+A++LLTDPQA +SFSMPNPALWQASFDAFF LLTKYC+
Sbjct  678  LGSPAGDGASIILKSVLEKATHLLTDPQAVSSFSMPNPALWQASFDAFFGLLTKYCL  734


 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 9/102 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++         C  K+D+IMQ++  QT ++T+    E ARA++ EMPVELLRAS
Sbjct  716  ALWQASFDAFFGLLTKYCLSKYDSIMQSILPQTPSNTETFDAEAARAVSREMPVELLRAS  775

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            LPHTNE QRK+L+NF Q S+P+ G N+ GGS+ +I+ ESVSC
Sbjct  776  LPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPESVSC  817



>ref|XP_008451848.1| PREDICTED: uncharacterized protein LOC103493011 [Cucumis melo]
Length=808

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 74/99 (75%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++ +QT +STDVI  E ARAI+ EMPVELLRASL
Sbjct  708  LWQASFDEFFSLLTKYCVSKYETIVQSLFSQTPSSTDVIGSEAARAISREMPVELLRASL  767

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK+LM+F Q S+P++GF++ GGSS ++N+ESV
Sbjct  768  PHTNEPQRKLLMDFAQRSMPVSGFSAHGGSSGQMNSESV  806


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS++ KS+LERA+ LLTDP AA++ SMPN ALWQASFD FF LLTKYCV
Sbjct  669  LGSSAGDGASIVLKSILERATELLTDPHAASNCSMPNRALWQASFDEFFSLLTKYCV  725



>gb|KJB12762.1| hypothetical protein B456_002G0355002, partial [Gossypium raimondii]
Length=373

 Score = 81.3 bits (199),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS I KSVL+RA+ L+TD +AA +++  N +LW+ASFD FF LLTKYC+
Sbjct  251  LGSPAGDGASFILKSVLDRATKLMTDSRAAGNYNTTNLSLWKASFDEFFNLLTKYCI  307


 Score = 48.9 bits (115),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQ  356
            K+D +MQ++  Q + +  +   + A+AI  EMPV+LL A LPH N+ Q+K L++  Q
Sbjct  309  KYDTVMQSLRMQAKPNMAIDESDSAKAIKREMPVDLLHACLPHLNDQQKKQLLDLSQ  365



>ref|XP_010313689.1| PREDICTED: uncharacterized protein LOC101260608 isoform X1 [Solanum 
lycopersicum]
Length=818

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 9/101 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+IMQ++ +  +++T++I  E ARA++ EMPVELLRASL
Sbjct  718  LWQASFDAFFGLLTKYCLSKYDSIMQSLMSPAQSNTELIGSEAARAVSREMPVELLRASL  777

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            PHTNE QRK+L+NF Q S+P+ GFN+ G SS +IN ESVSC
Sbjct  778  PHTNEHQRKLLLNFAQRSMPVTGFNAHGVSSGQINPESVSC  818


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA++LLTDPQ  +  SMPNPALWQASFDAFF LLTKYC+   
Sbjct  679  LGSPAGDGASVILKSVLERATHLLTDPQTVSGLSMPNPALWQASFDAFFGLLTKYCLSKY  738

Query  516  II*CKQLHRQKQAQT*LV  463
                + L    Q+ T L+
Sbjct  739  DSIMQSLMSPAQSNTELI  756



>ref|XP_004251557.1| PREDICTED: uncharacterized protein LOC101260608 isoform X2 [Solanum 
lycopersicum]
Length=817

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 9/101 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+IMQ++ +  +++T++I  E ARA++ EMPVELLRASL
Sbjct  717  LWQASFDAFFGLLTKYCLSKYDSIMQSLMSPAQSNTELIGSEAARAVSREMPVELLRASL  776

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            PHTNE QRK+L+NF Q S+P+ GFN+ G SS +IN ESVSC
Sbjct  777  PHTNEHQRKLLLNFAQRSMPVTGFNAHGVSSGQINPESVSC  817


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA++LLTDPQ  +  SMPNPALWQASFDAFF LLTKYC+   
Sbjct  678  LGSPAGDGASVILKSVLERATHLLTDPQTVSGLSMPNPALWQASFDAFFGLLTKYCLSKY  737

Query  516  II*CKQLHRQKQAQT*LV  463
                + L    Q+ T L+
Sbjct  738  DSIMQSLMSPAQSNTELI  755



>ref|XP_008809752.1| PREDICTED: uncharacterized protein LOC103721355 [Phoenix dactylifera]
Length=200

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = -2

Query  553  FQTSYEILC----CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNEL  386
            F  S+ +L      K+D+IMQ +     +T +I  E ARAI+ EMPVELLRASLPHTNE 
Sbjct  106  FDASFRLLTKYCLSKYDSIMQMLLMQAPNTSIIGSEAARAISREMPVELLRASLPHTNEH  165

Query  385  QRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            QRKML++F Q S+P+ GF++ GG S  + +ESV
Sbjct  166  QRKMLLDFAQRSMPITGFSAHGGGSGPVTSESV  198


 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVL+RA+ LLTDPQAA+++SM N ALWQASFDA F+LLTKYC+
Sbjct  62   LGSSAGDGASIIIKSVLDRATELLTDPQAASNYSMSNRALWQASFDASFRLLTKYCL  118



>ref|XP_002513418.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48821.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score = 71.2 bits (173),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ LL + Q A+++++ N ALW+ASFD FF LL KYC+
Sbjct  686  LGSSAGNGASLILMSVLERAAELLGELQDASNYNVTNRALWKASFDEFFVLLVKYCI  742


 Score = 58.2 bits (139),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 15/79 (19%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+  Q          + A AI  E+P+ELLR S+PHTN+ Q+KML +  Q S  
Sbjct  744  KYDSIMQSPIQ----------DPAEAIKRELPMELLRVSVPHTNDYQKKMLYDLSQRS--  791

Query  343  LAGFNSRGGSSRKINAESV  287
            L G NS GG    +N+E+V
Sbjct  792  LVGQNSNGG---HMNSEAV  807



>ref|XP_004165263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228647, 
partial [Cucumis sativus]
Length=742

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 74/99 (75%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++ +QT +STDVI  E ARAI+ EMPVELLRASL
Sbjct  642  LWQASFDEFFSLLTKYCVSKYETIVQSLFSQTPSSTDVIGSEAARAISREMPVELLRASL  701

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK+LM+F Q S+P++GF++ GGSS ++++ESV
Sbjct  702  PHTNEPQRKLLMDFAQRSMPVSGFSAHGGSSGQMSSESV  740


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS++ KS+LERA+ LLTDP AA++ SMPN ALWQASFD FF LLTKYCV
Sbjct  603  LGSSAGDGASIVLKSILERATELLTDPHAASNCSMPNRALWQASFDEFFSLLTKYCV  659



>gb|ABR25724.1| unknown [Oryza sativa Indica Group]
Length=119

 Score = 73.2 bits (178),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+++I Q     ++   V   EV++A + EMPVELLRASLPHTN+ QR++L++F Q ++P
Sbjct  40   KYESIKQMFVM-QSPCSVTGSEVSKATSREMPVELLRASLPHTNDQQRQLLLDFAQRTMP  98

Query  343  LAGFNSRGGSSRKINAESV  287
            + G N  G +   I +ESV
Sbjct  99   VTGINPTGANGGYITSESV  117


 Score = 55.5 bits (132),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  639  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            A+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  1    ATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCL  38



>ref|XP_004147742.1| PREDICTED: uncharacterized protein LOC101213130 [Cucumis sativus]
 gb|KGN53503.1| hypothetical protein Csa_4G062390 [Cucumis sativus]
Length=808

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 74/99 (75%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++ +QT +STDVI  E ARAI+ EMPVELLRASL
Sbjct  708  LWQASFDEFFSLLTKYCVSKYETIVQSLFSQTPSSTDVIGSEAARAISREMPVELLRASL  767

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK+LM+F Q S+P++GF++ GGSS ++++ESV
Sbjct  768  PHTNEPQRKLLMDFAQRSMPVSGFSAHGGSSGQMSSESV  806


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS++ KS+LERA+ LLTDP AA++ SMPN ALWQASFD FF LLTKYCV
Sbjct  669  LGSSAGDGASIVLKSILERATELLTDPHAASNCSMPNRALWQASFDEFFSLLTKYCV  725



>ref|XP_002317021.2| hypothetical protein POPTR_0011s14710g [Populus trichocarpa]
 gb|EEE97633.2| hypothetical protein POPTR_0011s14710g [Populus trichocarpa]
Length=736

 Score = 69.7 bits (169),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ L  DP  A ++++ + ALW+ASFD FF LL K+C+
Sbjct  611  LGSSAGNGASLILMSVLERAAELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCI  667


 Score = 57.8 bits (138),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 13/79 (16%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+++ ++          A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+ 
Sbjct  669  KYDSIMQSLSDSDP---------AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL-  718

Query  343  LAGFNSRGGSSRKINAESV  287
                   GG+   IN+++V
Sbjct  719  ---VGQDGGNGGHINSQAV  734



>gb|KDP25122.1| hypothetical protein JCGZ_22657 [Jatropha curcas]
Length=805

 Score = 75.1 bits (183),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG+ AG+GASLI  SVLERA+ LL + Q AN+++M N ALW+ASFD FF LL KYC+
Sbjct  682  LGNSAGNGASLILMSVLERATELLIELQDANNYNMTNRALWKASFDEFFGLLIKYCI  738


 Score = 52.4 bits (124),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 15/79 (19%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+             + A AI  E+P+ELLRAS+PH N+ Q+K+L +  Q S+ 
Sbjct  740  KYDSIMQSSLS----------DPAEAIKRELPMELLRASVPHVNDYQKKLLYDLSQRSL-  788

Query  343  LAGFNSRGGSSRKINAESV  287
                 S+ G+   +N+ESV
Sbjct  789  ----ASQDGNGGHMNSESV  803



>gb|KHG10037.1| Protein PAT1 [Gossypium arboreum]
Length=782

 Score = 76.6 bits (187),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG+P+GD ASLI KSVL+RA+ L+ D +AA +++M N +LW+ASFD FF LLTKYC+
Sbjct  660  LGNPSGDWASLILKSVLDRATKLMIDFRAAGNYNMANQSLWKASFDEFFNLLTKYCI  716


 Score = 50.8 bits (120),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++  Q + +  +   +V +AI  EMPV+LL A LPH N+ Q+K++ +  Q S+
Sbjct  718  KYDTVMQSLCMQVKPNMAINESDVTKAIKREMPVDLLHACLPHINDQQKKLIFDLSQRSL  777



>ref|XP_011030729.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Populus euphratica]
Length=794

 Score = 70.5 bits (171),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ L  DP  A ++++ + ALW+ASFD FF LL K+C+
Sbjct  669  LGSSAGNGASLILMSVLERATELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCI  725


 Score = 56.2 bits (134),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 13/79 (16%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+ + ++          A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+ 
Sbjct  727  KYDSIMQSQSDSDP---------AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL-  776

Query  343  LAGFNSRGGSSRKINAESV  287
                   GG+   IN+++V
Sbjct  777  ---VGQDGGNGGHINSQAV  792



>ref|XP_011030730.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Populus euphratica]
Length=793

 Score = 70.5 bits (171),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ L  DP  A ++++ + ALW+ASFD FF LL K+C+
Sbjct  668  LGSSAGNGASLILMSVLERATELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCI  724


 Score = 56.2 bits (134),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 13/79 (16%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+ + ++          A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+ 
Sbjct  726  KYDSIMQSQSDSDP---------AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL-  775

Query  343  LAGFNSRGGSSRKINAESV  287
                   GG+   IN+++V
Sbjct  776  ---VGQDGGNGGHINSQAV  791



>ref|XP_011030731.1| PREDICTED: protein PAT1 homolog 1 isoform X3 [Populus euphratica]
Length=791

 Score = 70.5 bits (171),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ L  DP  A ++++ + ALW+ASFD FF LL K+C+
Sbjct  666  LGSSAGNGASLILMSVLERATELSNDPHDATNYNVTDQALWKASFDEFFGLLIKHCI  722


 Score = 56.2 bits (134),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 13/79 (16%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D+IMQ+ + ++          A AI  E+P+ELLRAS+PHTN+ Q+K+L +  Q S+ 
Sbjct  724  KYDSIMQSQSDSDP---------AEAIKRELPMELLRASVPHTNDYQKKLLYDLSQRSL-  773

Query  343  LAGFNSRGGSSRKINAESV  287
                   GG+   IN+++V
Sbjct  774  ---VGQDGGNGGHINSQAV  789



>ref|XP_010112872.1| hypothetical protein L484_017708 [Morus notabilis]
 gb|EXC35007.1| hypothetical protein L484_017708 [Morus notabilis]
Length=812

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 72/100 (72%), Gaps = 9/100 (9%)
 Frame = -2

Query  559  CLFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRAS  407
             L+Q S++            K++ I+Q++ AQT+ ST+VI PE A+AI+ EMPVELLRAS
Sbjct  711  ALWQASFDEFFGLLTKYCLSKYETIVQSIYAQTQPSTEVIGPEAAKAIHREMPVELLRAS  770

Query  406  LPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            LPHT+E QRK+L +F Q S+P++G N+RG S  ++N+ESV
Sbjct  771  LPHTDEHQRKLLSDFAQRSMPISGINTRGSSGGQLNSESV  810


 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGA++I KSVLERA+ LLTDP AA + SMPN ALWQASFD FF LLTKYC+   
Sbjct  673  LGSPAGDGATVILKSVLERATELLTDPHAAGNCSMPNRALWQASFDEFFGLLTKYCLSKY  732

Query  516  II*CKQLHRQKQAQT*LVQR*QGP*TVKCL  427
                + ++ Q Q  T ++    GP   K +
Sbjct  733  ETIVQSIYAQTQPSTEVI----GPEAAKAI  758



>gb|KHG07822.1| Protein PAT1 [Gossypium arboreum]
Length=785

 Score = 77.8 bits (190),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS I K VL+RA+ L+TD +A   +++ N +LW+ASFD FF LLTKYCV
Sbjct  663  LGSPAGDGASFILKCVLDRATKLVTDFKAGGDYNISNQSLWKASFDEFFNLLTKYCV  719


 Score = 48.9 bits (115),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++  Q + +  +   +  +AI  EMPV+LL A LPH NE Q+K++ +  Q S+
Sbjct  721  KYDTVMQSLRMQVKPNMVIDEADATKAIKREMPVDLLHACLPHINEQQKKLIWDLSQRSM  780



>ref|XP_011085449.1| PREDICTED: protein PAT1 homolog 1-like [Sesamum indicum]
Length=812

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSPAGDGAS+I KSVLERA++LL DPQ+ ++FS+PNPALWQASFDAFF LLTKYCV
Sbjct  673  VGSPAGDGASVILKSVLERATHLLRDPQSTSNFSIPNPALWQASFDAFFGLLTKYCV  729


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 69/99 (70%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+++I+Q+ + Q   + +V+  E ARA++ EMPVELLRAS+
Sbjct  712  LWQASFDAFFGLLTKYCVSKYESIVQSLIVQNPQNAEVVGSEAARAVSREMPVELLRASI  771

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E Q+K+L+NF Q S+P+ GFNS GG+S + N ESV
Sbjct  772  PHTDESQKKLLLNFAQRSMPVTGFNSHGGNSGQANPESV  810



>gb|KJB82133.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=785

 Score = 76.3 bits (186),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS I K VL+RA+ L+TD +A   +++ N +LW+ASFD FF LLTKYCV
Sbjct  663  LGSPTGDGASFILKCVLDRATKLVTDFKAGGDYNISNQSLWKASFDEFFNLLTKYCV  719


 Score = 49.7 bits (117),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVIS-PEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++   +    VI   +  +AI  EMPV+LL A LPH NE Q+K++ +  Q S+
Sbjct  721  KYDTVMQSLRMQDKPNMVIDEADATKAIKREMPVDLLHACLPHINEQQKKLIWDLSQRSM  780



>gb|KJB26984.1| hypothetical protein B456_004G270000 [Gossypium raimondii]
Length=764

 Score = 74.7 bits (182),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG+P+GD ASLI KSVL+RA+ L+ D +AA +++M N +LW+ASF+ FF LLTKYC+
Sbjct  642  LGNPSGDWASLILKSVLDRATKLMIDFRAAGNYNMANQSLWKASFNEFFNLLTKYCI  698


 Score = 51.2 bits (121),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D +MQ++  Q + +  +   +V +AI  EMPV+LL A LPH N+ Q+K++++  Q S+
Sbjct  700  KYDTVMQSLRMQVKPNVAIDESDVTKAIKREMPVDLLHACLPHINDQQKKLILDLSQRSL  759



>ref|XP_004239250.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321026.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321027.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321028.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
Length=820

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLE A++LLTD +AA+SFSMPNPALWQASFDAFF LLTKYC+
Sbjct  681  LGSPAGDGASIILKSVLEGATHLLTDSKAASSFSMPNPALWQASFDAFFGLLTKYCL  737


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 9/101 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+IMQ++ AQ++   ++I  E ARA++ EMPVELLRASL
Sbjct  720  LWQASFDAFFGLLTKYCLSKYDSIMQSILAQSQPDAEIIGAEAARAVSREMPVELLRASL  779

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVSC  281
            PHTN+ Q+K+L+NF Q S+P+ GF+S GGSS  I+ ESVSC
Sbjct  780  PHTNDHQKKLLLNFAQRSMPVTGFSSHGGSSGHIDPESVSC  820



>emb|CDP16041.1| unnamed protein product [Coffea canephora]
Length=958

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q++  Q +   ++  PE ARA++ EMPVELLRASL
Sbjct  738  LWQASFDAFFGLLTKYCLSKYDSIVQSIFNQNQPDAEMNVPEAARAVSREMPVELLRASL  797

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L+NF Q S+PL GFN+ GGSS +IN ESV
Sbjct  798  PHTDERQRKLLLNFAQRSMPLTGFNAHGGSSGQINPESV  836


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I K+VLERA++LLT+ +AA ++S+PNPALWQASFDAFF LLTKYC+
Sbjct  699  LGSAAGDGASIILKAVLERATHLLTESKAAGNYSIPNPALWQASFDAFFGLLTKYCL  755



>gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata]
Length=816

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q++ AQ   + + I  E ARA++ EMPVELLRASL
Sbjct  716  LWQASFDAFFGLLTKYCVSKYDSIVQSIIAQNAPNAESIDSEAARAVSREMPVELLRASL  775

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E Q+K+L+NF Q S+P+ GFN+ GGSS +IN ESV
Sbjct  776  PHTDESQKKLLLNFAQRSMPVTGFNAHGGSSGQINPESV  814


 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSPAGDGAS+I KSVLERA+ LL DP   ++FS+PNPALWQASFDAFF LLTKYCV
Sbjct  677  VGSPAGDGASVILKSVLERATVLLRDPPFGSNFSIPNPALWQASFDAFFGLLTKYCV  733



>ref|XP_011100381.1| PREDICTED: uncharacterized protein LOC105178578 [Sesamum indicum]
Length=815

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSPA DGAS+I KSVLERA+YLL DPQ +++FS+PNP LWQASFDAFF LLTKYCV
Sbjct  676  VGSPARDGASVILKSVLERATYLLRDPQFSSNFSIPNPTLWQASFDAFFGLLTKYCV  732


 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 70/99 (71%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q+ +AQ   +T+ I  E ARA++ E+PVELLRASL
Sbjct  715  LWQASFDAFFGLLTKYCVSKYDSIVQSLIAQNVPNTEAIGSEAARAVSREIPVELLRASL  774

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E Q+K+L+NF Q S+P+ GFN+  GSS +IN ESV
Sbjct  775  PHTDESQKKLLLNFAQRSMPVTGFNAHSGSSAQINPESV  813



>gb|KDP25124.1| hypothetical protein JCGZ_22659 [Jatropha curcas]
Length=779

 Score = 68.9 bits (167),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGS AG+GASL+   VL+RA+ LL   Q A+++++ N ALW+ASFD FF LL KYC+  L
Sbjct  668  LGSSAGNGASLVLMCVLDRATELLNKLQDASNYNLTNRALWKASFDEFFSLLVKYCINKL  727


 Score = 51.6 bits (122),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 11/53 (21%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMN  365
            K D+IMQ+           SP+ A AI  E+P+ELLRAS+PHTN+ Q+KM+ +
Sbjct  726  KLDSIMQS-----------SPDSAEAIKRELPLELLRASIPHTNDYQKKMIYD  767



>ref|XP_010923783.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923784.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923785.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
Length=814

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -2

Query  559  CLFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S++         C  K+D+IMQ +     +T +I  E ARAI+ EMPVELLRASL
Sbjct  714  ALWQASFDAFFGLLTKYCLSKYDSIMQMLLMQAPNTSIIGSEAARAISREMPVELLRASL  773

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QR+ML++F Q S+P+ GF++ GG S  + +ESV
Sbjct  774  PHTNEHQRQMLLDFAQRSMPVTGFSAHGGGSGPVTSESV  812


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVL+ A+ LLT   AA+++SM N ALWQASFDAFF LLTKYC+
Sbjct  676  LGSSAGDGASIIIKSVLDLATELLTGSHAASNYSMSNRALWQASFDAFFGLLTKYCL  732



>gb|ACF84116.1| unknown [Zea mays]
Length=199

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASL+ KSVL+RA+ LLTD  AA S+++PN ALWQASFDAFF LLTKYCV
Sbjct  62   LGSSAGDGASLVIKSVLDRATELLTDRHAAASYTVPNRALWQASFDAFFGLLTKYCV  118


 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  KF++I Q    T+T +  I PE ++A + EMPVELLRASLP
Sbjct  101  LWQASFDAFFGLLTKYCVSKFESIQQMFV-TQTPSSGIGPEASKATSKEMPVELLRASLP  159

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QR+ L++F Q S+P+ GFN  G     I +ESV
Sbjct  160  HTNEQQRQRLLDFAQRSMPVTGFNPSGARGGHITSESV  197



>gb|AAM61209.1| unknown [Arabidopsis thaliana]
Length=148

 Score = 64.3 bits (155),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS+L+RAS L+     AN+F+    ALW+ASF+ FF +L +YC+
Sbjct  25   LGSPVGDGASTVLKSILDRASELIR----ANNFNNAGIALWRASFNEFFNMLMRYCI  77


 Score = 55.1 bits (131),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ++         IS E A+AI  EMP+ELLR+S PH +E Q+++LM F + S+
Sbjct  79   KYDSIMQSLQLPPHFATEISEEAAKAIVREMPIELLRSSFPHIDEQQKRILMEFLKRSM  137



>ref|XP_010036063.1| PREDICTED: protein PAT1 homolog 1-like [Eucalyptus grandis]
 gb|KCW47590.1| hypothetical protein EUGRSUZ_K01336 [Eucalyptus grandis]
Length=806

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSY--------EILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S+        +    K++ I Q++ AQT+ S+++I  E  RAIN EMPVELLRASL
Sbjct  706  LWQASFNEFFALLTKYCLTKYETIAQSILAQTQVSSEIIGTEATRAINREMPVELLRASL  765

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L++F Q S+P+  FN+R G S + N+ESV
Sbjct  766  PHTDENQRKLLLDFAQRSMPINAFNARMGGSSQTNSESV  804


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGS AGDGAS+I KSVLERA+ LLT   A NS SMPN ALWQASF+ FF LLTKYC+ 
Sbjct  667  LGSAAGDGASVILKSVLERATDLLTGLHAPNSCSMPNRALWQASFNEFFALLTKYCLT  724



>dbj|BAD94175.1| hypothetical protein [Arabidopsis thaliana]
Length=376

 Score = 63.5 bits (153),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS+L+RAS L+     AN+F+    ALW+ASF  FF +L +YC+
Sbjct  253  LGSPVGDGASTVLKSILDRASELIR----ANNFNNAGIALWRASFKEFFNMLMRYCI  305


 Score = 55.5 bits (132),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D+IMQ++         IS E A+AI  EMP+ELLR+S PH +E Q+++LM F + S+
Sbjct  307  KYDSIMQSLQLPPHFATEISEEAAKAIVREMPIELLRSSFPHIDEQQKRILMEFLKRSM  365



>gb|AAC17049.1| Similar to hypothetical protein product gb|Z97337 from A. thaliana. 
EST gb|H76597 comes from this gene [Arabidopsis thaliana]
Length=841

 Score = 63.9 bits (154),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS+L+RAS L+     AN+F+    ALW+ASF+ FF +L +YC+
Sbjct  718  LGSPVGDGASTVLKSILDRASELIR----ANNFNNAGIALWRASFNEFFNMLMRYCI  770


 Score = 55.1 bits (131),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ++         IS E A+AI  EMP+ELLR+S PH +E Q+++LM F
Sbjct  772  KYDSIMQSLQLPPHFATEISEEAAKAIVREMPIELLRSSFPHIDEQQKRILMEF  825



>ref|XP_002264820.1| PREDICTED: protein PAT1 homolog 1-like [Vitis vinifera]
Length=812

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA+ LLTDP  A   SMPN ALWQASFD FF LLTKYC+   
Sbjct  674  LGSPAGDGASIILKSVLERATELLTDPHVAGKCSMPNRALWQASFDEFFSLLTKYCLSKY  733

Query  516  II*CKQLHRQKQAQT*LV  463
                + +  Q Q  T ++
Sbjct  734  ETIIQSIFSQTQPGTEII  751


 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 71/99 (72%), Gaps = 10/99 (10%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++ +QT+  T++IS E  RAI+ EMPVELLRASL
Sbjct  713  LWQASFDEFFSLLTKYCLSKYETIIQSIFSQTQPGTEIISSESTRAISREMPVELLRASL  772

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L++F Q S+P+ GFN+R GSS ++ +ESV
Sbjct  773  PHTDEHQRKLLLDFAQRSMPITGFNTR-GSSGQVTSESV  810



>emb|CAN68728.1| hypothetical protein VITISV_033604 [Vitis vinifera]
Length=867

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA+ LLTDP  A   SMPN ALWQASFD FF LLTKYC+   
Sbjct  729  LGSPAGDGASIILKSVLERATELLTDPHVAGKCSMPNRALWQASFDEFFSLLTKYCLSKY  788

Query  516  II*CKQLHRQKQAQT*LV  463
                + +  Q Q  T ++
Sbjct  789  ETIIQSIFSQTQPGTEII  806


 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 71/99 (72%), Gaps = 10/99 (10%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++ +QT+  T++IS E  RAI+ EMPVELLRASL
Sbjct  768  LWQASFDEFFSLLTKYCLSKYETIIQSIFSQTQPGTEIISSESTRAISREMPVELLRASL  827

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L++F Q S+P+ GFN+R GSS ++ +ESV
Sbjct  828  PHTDEHQRKLLLDFAQRSMPITGFNTR-GSSGQVTSESV  865



>ref|XP_010511200.1| PREDICTED: uncharacterized protein LOC104787331 [Camelina sativa]
Length=782

 Score = 63.2 bits (152),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +    PN  LW+ASFD FF LLTKYC
Sbjct  652  IGSSAGDGASVVLISLLERAAEVVVVPRVMHG--NPNDGLWRASFDEFFNLLTKYC  705


 Score = 54.7 bits (130),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN++QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  727  AIKREMPAELLRASLRHTNDVQRNYLLNFGRKPSAISESASHARGGG--QINSESV  780



>ref|XP_010539588.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Tarenaya hassleriana]
Length=822

 Score = 64.3 bits (155),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGD AS++ KS L+RA+ LL     AN+++  + ALW+ASFD FF LL K+CV
Sbjct  692  LGSPAGDAASIVLKSTLDRATELLR----ANNYNNSSMALWRASFDEFFNLLMKHCV  744


 Score = 53.1 bits (126),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D IMQA+     +++ +S   A+AI  EMP+ELLRAS PH +E Q+++LM F
Sbjct  746  KYDGIMQALNSQHFASE-MSEAAAQAIVREMPIELLRASFPHISEQQKRILMEF  798



>ref|XP_010539589.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Tarenaya hassleriana]
Length=820

 Score = 64.7 bits (156),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGD AS++ KS L+RA+ LL     AN+++  + ALW+ASFD FF LL K+CV
Sbjct  690  LGSPAGDAASIVLKSTLDRATELLR----ANNYNNSSMALWRASFDEFFNLLMKHCV  742


 Score = 53.1 bits (126),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D IMQA+     +++ +S   A+AI  EMP+ELLRAS PH +E Q+++LM F
Sbjct  744  KYDGIMQALNSQHFASE-MSEAAAQAIVREMPIELLRASFPHISEQQKRILMEF  796



>ref|XP_010532520.1| PREDICTED: uncharacterized protein LOC104808528 [Tarenaya hassleriana]
Length=785

 Score = 62.8 bits (151),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGASL+  S+LERA+ +L  P   ++    N  LW+ASFD FF LLTKYC
Sbjct  658  IGSPAGDGASLVLISLLERAAEVLV-PHVNHTNH--NDGLWRASFDEFFTLLTKYC  710


 Score = 54.7 bits (130),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K++ I    +Q + S D++      AI  EMP ELLRASL HT+E+QR  L+NFG+   P
Sbjct  713  KYETIR---SQNQGSADIME----LAIKREMPAELLRASLRHTSEVQRNYLLNFGRKPSP  765

Query  343  L--AGFNSRGGSSRKINAESV  287
            +  +  ++RGG   +IN+E+V
Sbjct  766  VGESSSHARGG---QINSETV  783



>ref|XP_004303935.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=806

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++  QT+ S++VI  E  +AI+ EMPVELLRASL
Sbjct  706  LWQASFDEFFGLLTKYCLSKYETILQSIFTQTQQSSEVIGSEATKAIHREMPVELLRASL  765

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK+L +F   S+P++G N+ GGS  ++N+ESV
Sbjct  766  PHTNENQRKLLSDFAHRSMPISGLNAHGGSGGQMNSESV  804


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGA++I KSVLERA+ LLTDP A  + S+ N ALWQASFD FF LLTKYC+
Sbjct  667  LGSPAGDGATIILKSVLERATVLLTDPHAVGNCSVSNRALWQASFDEFFGLLTKYCL  723



>ref|XP_008793553.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Phoenix dactylifera]
Length=688

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+I+Q +     +T +I  E ARA++ EMPVELLRASLP
Sbjct  589  LWQASFDAFFGLLTKYCGSKYDSILQMLHMQALNTSIIGSEAARAVSREMPVELLRASLP  648

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QRKML++F Q S P+ GF+  GG S  + +ESV
Sbjct  649  HTNEHQRKMLLDFAQRSKPVTGFSVHGGGSGPVTSESV  686


 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGS AGDGAS+I KSVL+RA+ +LT+P AA+++SM N ALWQASFDAFF LLTKYC    
Sbjct  550  LGSSAGDGASMILKSVLDRATDVLTEPHAASNYSMSNRALWQASFDAFFGLLTKYCGSKY  609

Query  516  II*CKQLHRQ  487
                + LH Q
Sbjct  610  DSILQMLHMQ  619



>ref|XP_008793552.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Phoenix dactylifera]
Length=815

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+I+Q +     +T +I  E ARA++ EMPVELLRASLP
Sbjct  716  LWQASFDAFFGLLTKYCGSKYDSILQMLHMQALNTSIIGSEAARAVSREMPVELLRASLP  775

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QRKML++F Q S P+ GF+  GG S  + +ESV
Sbjct  776  HTNEHQRKMLLDFAQRSKPVTGFSVHGGGSGPVTSESV  813


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGS AGDGAS+I KSVL+RA+ +LT+P AA+++SM N ALWQASFDAFF LLTKYC    
Sbjct  677  LGSSAGDGASMILKSVLDRATDVLTEPHAASNYSMSNRALWQASFDAFFGLLTKYCGSKY  736

Query  516  II*CKQLHRQ  487
                + LH Q
Sbjct  737  DSILQMLHMQ  746



>ref|XP_010466506.1| PREDICTED: uncharacterized protein LOC104746679 [Camelina sativa]
Length=782

 Score = 63.2 bits (152),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +    PN  LW+ASFD FF LLTKYC
Sbjct  652  IGSSAGDGASVVLISLLERAAEVVVVPRVMHG--NPNDGLWRASFDEFFNLLTKYC  705


 Score = 53.1 bits (126),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  727  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGGG--QINSESV  780



>ref|XP_002300546.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
 gb|EEE85351.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
Length=801

 Score = 70.5 bits (171),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ LL D   A+ ++  N ALW+ASFD FF LL KYC+
Sbjct  675  LGSSAGNGASLILLSVLERATELLNDLHDASDYNATNGALWKASFDEFFSLLIKYCI  731


 Score = 45.8 bits (107),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D IMQ        + +   + A +I  E+P+ELLRAS+P TN+ Q+K+L +  Q S+ 
Sbjct  733  KYDGIMQ--------SSLSDSDPAESIKRELPMELLRASVPLTNDYQKKLLYDLSQRSL-  783

Query  343  LAGFNSRGGSSRKINAESV  287
                   G +   IN+E V
Sbjct  784  ---VGQDGDNGGDINSEVV  799



>ref|XP_010488248.1| PREDICTED: uncharacterized protein LOC104766124 [Camelina sativa]
Length=784

 Score = 63.2 bits (152),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +    PN  LW+ASFD FF LLTKYC
Sbjct  654  IGSSAGDGASVVLISLLERAAEVVVVPRVMHG--NPNDGLWRASFDEFFNLLTKYC  707


 Score = 53.1 bits (126),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  729  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGGG--QINSESV  782



>ref|XP_006414611.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 ref|XP_006414612.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56064.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56065.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
Length=784

 Score = 61.2 bits (147),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++      N  S  N  LW+ASFD FF LLTKYC
Sbjct  656  IGSPSGDGASVVLVSLLERAAEVVVGVPRVNHGSS-NDGLWRASFDEFFSLLTKYC  710


 Score = 55.1 bits (131),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL--AGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTNE QR  L+NFG+ + P+  A   +RGG   +I++ESV
Sbjct  730  AIKREMPAELLRASLRHTNEDQRNFLLNFGRKASPVSEAATRARGG---QISSESV  782



>ref|XP_010907163.1| PREDICTED: uncharacterized protein LOC105033889 [Elaeis guineensis]
Length=821

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+I+Q +      T +I  E ARAI+ EMPVELLRASLP
Sbjct  722  LWQASFDAFFGLLTKYCLSKYDSILQMLLMQALDTSIIGSEAARAISREMPVELLRASLP  781

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QRKML++F Q S+P+ GF+  G  S  + +ESV
Sbjct  782  HTNEHQRKMLLDFAQRSMPVTGFSVHGSGSGPVTSESV  819


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVL+RA+ LLTDP A +++SM N ALWQASFDAFF LLTKYC+
Sbjct  683  LGSSAGDGASMILKSVLDRATDLLTDPHATSNYSMSNRALWQASFDAFFGLLTKYCL  739



>gb|KFK23118.1| hypothetical protein AALP_AAs49591U000400 [Arabis alpina]
Length=788

 Score = 61.2 bits (147),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 6/59 (10%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLT---DPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++    DP+   +    N  LW+ASFD FF LLTKYC
Sbjct  657  IGSPSGDGASVVLVSLLERAAEVIVVAMDPRVNGN---SNDGLWRASFDEFFSLLTKYC  712


 Score = 54.7 bits (130),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL--AGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+ + P+  +   +RGG   +IN+ESV
Sbjct  734  AIKREMPAELLRASLRHTNDDQRNFLLNFGRKASPISESTTRTRGG---QINSESV  786



>gb|EYU43158.1| hypothetical protein MIMGU_mgv1a023840mg, partial [Erythranthe 
guttata]
Length=674

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG PAGDGAS+I KSVLERA+ LL +PQ+A+S  +PNPALWQASFDAFF LL KYC 
Sbjct  556  LGIPAGDGASVILKSVLERATQLLREPQSASSLGIPNPALWQASFDAFFGLLMKYCT  612


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 54/79 (68%), Gaps = 9/79 (11%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+++I+Q++  Q   + +V+ PE  RA++ EMP+ELLRAS+
Sbjct  595  LWQASFDAFFGLLMKYCTSKYESIVQSLMNQNPENKEVVGPEAGRAVSREMPIELLRASI  654

Query  403  PHTNELQRKMLMNFGQGSI  347
            PHT++ Q+K+LMNF Q S+
Sbjct  655  PHTDDTQKKLLMNFAQRSM  673



>ref|XP_008383066.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Malus domestica]
Length=844

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP AA++++M N  LWQASFD FF LLTKYCV
Sbjct  704  LGSPAGDGASLILNSVLERATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCV  760


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D +MQ++  Q   +  VI  + ARAI  EMPVELLRASL
Sbjct  743  LWQASFDEFFGLLTKYCVNKYDTVMQSLLTQAPPNVTVIGSDAARAIGREMPVELLRASL  802

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  287
            PHT+E QR++L++F Q S+P+   NSR GG+   +N+ESV
Sbjct  803  PHTDEHQRQLLLDFTQRSMPIGASNSRDGGNGAHMNSESV  842



>ref|XP_002883351.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59610.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score = 62.0 bits (149),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  653  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  706


 Score = 53.1 bits (126),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG    +I  +  ++RGG   +IN+ESV
Sbjct  728  AIKREMPAELLRASLRHTNDDQRNYLLNFGHKPSAISESASHARGG---QINSESV  780



>ref|XP_009377953.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=817

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++  Q++ S +VI  E  RAI+ EMPVELLRASL
Sbjct  717  LWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSAEVIGSEATRAIHREMPVELLRASL  776

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F   S+P++G N+ GGS  ++N+ESV
Sbjct  777  PHTDEHQRKLLSDFAHRSMPISGLNAHGGSGGQMNSESV  815


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGA++I KSVLERA+ LL+DP AA S S+ N  LWQASFD FF LLTKYC+
Sbjct  678  LGSPAGDGATIILKSVLERATVLLSDPHAAGSCSISNRTLWQASFDEFFGLLTKYCL  734



>ref|XP_008342293.1| PREDICTED: protein PAT1 homolog 1-like [Malus domestica]
Length=803

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (68%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++  Q++ S +VI  E  RAI+ EMPVELLRASL
Sbjct  703  LWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSAEVIGSEATRAIHREMPVELLRASL  762

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F   S+P++G N+ GGS  ++N+ESV
Sbjct  763  PHTDEHQRKLLSDFSHRSMPISGLNAHGGSGGQMNSESV  801


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGA++I KSVLERA+ LL+DP AA S S+ N  LWQASFD FF LLTKYC+
Sbjct  664  LGSPAGDGATIILKSVLERATVLLSDPHAAGSCSISNRTLWQASFDEFFGLLTKYCL  720



>ref|XP_009345081.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=734

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP AA++++M N  LWQASFD FF LLTKYCV
Sbjct  594  LGSPAGDGASLILNSVLERATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCV  650


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D +MQ++  Q   +  VI  + ARAI  EMPVELLRASL
Sbjct  633  LWQASFDEFFGLLTKYCVNKYDTVMQSLLMQAPPNVAVIGSDAARAIGREMPVELLRASL  692

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  287
            PHT+E QR++LM+F Q S+P+   NS  GG+   +N+ESV
Sbjct  693  PHTDEHQRQLLMDFTQRSMPIGASNSHDGGNGAHMNSESV  732



>ref|XP_009345080.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=823

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI  SVLERA+ LLTDP AA++++M N  LWQASFD FF LLTKYCV
Sbjct  683  LGSPAGDGASLILNSVLERATELLTDPHAASNYNMTNRQLWQASFDEFFGLLTKYCV  739


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D +MQ++  Q   +  VI  + ARAI  EMPVELLRASL
Sbjct  722  LWQASFDEFFGLLTKYCVNKYDTVMQSLLMQAPPNVAVIGSDAARAIGREMPVELLRASL  781

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  287
            PHT+E QR++LM+F Q S+P+   NS  GG+   +N+ESV
Sbjct  782  PHTDEHQRQLLMDFTQRSMPIGASNSHDGGNGAHMNSESV  821



>ref|XP_010243918.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Nelumbo nucifera]
Length=825

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q++  Q   +T  I  E ARAI+ EMP+ELLR+SL
Sbjct  724  LWQASFDAFFTLLTKYCLSKYDSILQSLLMQAPPNTASIGSEAARAISREMPIELLRSSL  783

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRG-GSSRKINAESV  287
            PHTNE QRK+L++F Q S+P+ GFN+ G GS  +IN+ESV
Sbjct  784  PHTNEHQRKILLDFAQRSMPVTGFNAHGSGSGSQINSESV  823


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I K++LERA+ LLT+PQAA+++SM N ALWQASFDAFF LLTKYC+
Sbjct  685  LGSTAGDGASVILKAILERATELLTNPQAASNYSMQNRALWQASFDAFFTLLTKYCL  741



>ref|NP_188866.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AEE76616.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=782

 Score = 61.6 bits (148),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  653  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  706


 Score = 52.8 bits (125),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  728  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  780



>ref|XP_010243919.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Nelumbo nucifera]
Length=824

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q++  Q   +T  I  E ARAI+ EMP+ELLR+SL
Sbjct  723  LWQASFDAFFTLLTKYCLSKYDSILQSLLMQAPPNTASIGSEAARAISREMPIELLRSSL  782

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRG-GSSRKINAESV  287
            PHTNE QRK+L++F Q S+P+ GFN+ G GS  +IN+ESV
Sbjct  783  PHTNEHQRKILLDFAQRSMPVTGFNAHGSGSGSQINSESV  822


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I K++LERA+ LLT+PQAA+++SM N ALWQASFDAFF LLTKYC+
Sbjct  684  LGSTAGDGASVILKAILERATELLTNPQAASNYSMQNRALWQASFDAFFTLLTKYCL  740



>dbj|BAF00849.1| hypothetical protein [Arabidopsis thaliana]
Length=782

 Score = 61.6 bits (148),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  653  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  706


 Score = 52.8 bits (125),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  728  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  780



>ref|XP_006297023.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 ref|XP_006297024.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29921.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29922.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
Length=784

 Score = 61.6 bits (148),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  655  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  708


 Score = 52.8 bits (125),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  730  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  782



>dbj|BAB01945.1| unnamed protein product [Arabidopsis thaliana]
Length=703

 Score = 61.6 bits (148),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  574  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  627


 Score = 52.8 bits (125),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+ESV
Sbjct  649  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGG---QINSESV  701



>ref|XP_011014090.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=797

 Score = 70.5 bits (171),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ LL D   ++ +++ N ALW+ASFD FF LL KYC+
Sbjct  671  LGSSAGNGASLILLSVLERATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCI  727


 Score = 43.5 bits (101),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D IMQ        + +   + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+ 
Sbjct  729  KYDGIMQ--------SSLSDSDPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL-  779

Query  343  LAGFNSRGGSSRKINAESV  287
                    G+   IN+E V
Sbjct  780  ---VGQDDGNGGDINSEVV  795



>ref|XP_011014091.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=796

 Score = 70.5 bits (171),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ LL D   ++ +++ N ALW+ASFD FF LL KYC+
Sbjct  670  LGSSAGNGASLILLSVLERATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCI  726


 Score = 43.5 bits (101),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D IMQ        + +   + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+ 
Sbjct  728  KYDGIMQ--------SSLSDSDPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL-  778

Query  343  LAGFNSRGGSSRKINAESV  287
                    G+   IN+E V
Sbjct  779  ---VGQDDGNGGDINSEVV  794



>ref|NP_001140581.1| uncharacterized protein LOC100272651 [Zea mays]
 gb|ACN25795.1| unknown [Zea mays]
 gb|ACN33341.1| unknown [Zea mays]
 tpg|DAA57454.1| TPA: hypothetical protein ZEAMMB73_966891 [Zea mays]
Length=807

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASL+ KSVL+RA+ LLTD  AA S+++PN ALWQASFDAFF LLTKYCV
Sbjct  670  LGSSAGDGASLVIKSVLDRATELLTDRHAAASYTVPNRALWQASFDAFFGLLTKYCV  726


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S++         C  KF++I Q    T+T +  I PE ++A + EMPVELLRASL
Sbjct  708  ALWQASFDAFFGLLTKYCVSKFESIQQMFV-TQTPSSGIGPEASKATSKEMPVELLRASL  766

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QR+ L++F Q S+P+ GFN  G     I +ESV
Sbjct  767  PHTNEQQRQRLLDFAQRSMPVTGFNPSGARGGHITSESV  805



>ref|XP_011038109.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=798

 Score = 70.5 bits (171),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ LL D   ++ +++ N ALW+ASFD FF LL KYC+
Sbjct  672  LGSSAGNGASLILLSVLERATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCI  728


 Score = 43.5 bits (101),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D IMQ        + +   + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+ 
Sbjct  730  KYDGIMQ--------SSLSDSDPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL-  780

Query  343  LAGFNSRGGSSRKINAESV  287
                    G+   IN+E V
Sbjct  781  ---VGQDDGNGGDINSEVV  796



>ref|XP_008378353.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441447 
[Malus domestica]
Length=804

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGA++I KSVLERA+ LL+DP AA S S+ N ALWQASFD FF LLTKYC+   
Sbjct  665  LGSPAGDGATIILKSVLERATVLLSDPHAAGSCSISNRALWQASFDEFFGLLTKYCLSKY  724

Query  516  II*CKQLHRQKQAQT  472
                + +  Q Q  T
Sbjct  725  ETIVQSIFTQSQQST  739


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++  Q++ ST+ I  E  +AI+ EMPVELLRASL
Sbjct  704  LWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSTEAIGSEATKAIHREMPVELLRASL  763

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F   S+P++G N  GG+  ++N+ESV
Sbjct  764  PHTDERQRKLLSDFAHRSMPISGLNGHGGNGGQMNSESV  802



>ref|XP_011038110.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=797

 Score = 70.1 bits (170),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AG+GASLI  SVLERA+ LL D   ++ +++ N ALW+ASFD FF LL KYC+
Sbjct  671  LGSSAGNGASLILLSVLERATELLNDLHDSSDYNVTNGALWKASFDEFFSLLIKYCI  727


 Score = 43.5 bits (101),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D IMQ        + +   + A +I  E+P+ELLRA +P TN+ Q+K+L +  Q S+ 
Sbjct  729  KYDGIMQ--------SSLSDSDPAESIKRELPMELLRAIVPLTNDYQKKLLYDLSQRSL-  779

Query  343  LAGFNSRGGSSRKINAESV  287
                    G+   IN+E V
Sbjct  780  ---VGQDDGNGGDINSEVV  795



>ref|XP_002456407.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
 gb|EES01527.1| hypothetical protein SORBIDRAFT_03g035750 [Sorghum bicolor]
Length=810

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASL+ KSVL+RA+ LLTD  AA S+++PN ALWQASFDAFF LLTKYCV
Sbjct  673  LGSSAGDGASLVIKSVLDRATELLTDRHAAASYTVPNRALWQASFDAFFGLLTKYCV  729


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 59/99 (60%), Gaps = 9/99 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S++         C  KF++I Q       S+  I PE ++A + EMPVELLRASL
Sbjct  711  ALWQASFDAFFGLLTKYCVSKFESIQQMFVMQAPSSG-IGPEASKATSKEMPVELLRASL  769

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QR+ L++F Q S+P+ GFN  G     I +ESV
Sbjct  770  PHTNEQQRQRLLDFAQRSMPVTGFNPSGARGGHITSESV  808



>ref|XP_009375342.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=801

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGA++I KSVLERA+ LL+DP AA S S+ N ALWQASFD FF LLTKYC+   
Sbjct  662  LGSPAGDGATIILKSVLERATVLLSDPHAAGSCSISNRALWQASFDEFFGLLTKYCLSKY  721

Query  516  II*CKQLHRQKQAQT  472
                + +  Q Q  T
Sbjct  722  ETIVQSIFTQSQQST  736


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++  Q++ ST+ I  E  +AI+ EMPVELLRASL
Sbjct  701  LWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSTEAIGSEATKAIHREMPVELLRASL  760

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F   S+P++G N  GG+  ++N+ESV
Sbjct  761  PHTDERQRKLLSDFAHRSMPISGLNGHGGNGGQMNSESV  799



>ref|XP_009375341.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=804

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGA++I KSVLERA+ LL+DP AA S S+ N ALWQASFD FF LLTKYC+   
Sbjct  665  LGSPAGDGATIILKSVLERATVLLSDPHAAGSCSISNRALWQASFDEFFGLLTKYCLSKY  724

Query  516  II*CKQLHRQKQAQT  472
                + +  Q Q  T
Sbjct  725  ETIVQSIFTQSQQST  739


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q++  Q++ ST+ I  E  +AI+ EMPVELLRASL
Sbjct  704  LWQASFDEFFGLLTKYCLSKYETIVQSIFTQSQQSTEAIGSEATKAIHREMPVELLRASL  763

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F   S+P++G N  GG+  ++N+ESV
Sbjct  764  PHTDERQRKLLSDFAHRSMPISGLNGHGGNGGQMNSESV  802



>ref|XP_010926895.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Elaeis guineensis]
Length=794

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL------CC--KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D IMQ+     +S   I  +  RAI+ EMPVELLRASLP
Sbjct  695  LWQASFDAFFGLLTKYCENKYDTIMQSSHMQASSAGFIGSDAPRAISKEMPVELLRASLP  754

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HT+E QR +L++F Q S+P+ G+N+RGG +  I++ESV
Sbjct  755  HTDEHQRMLLLDFAQRSMPVIGYNARGGGNGPISSESV  792


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS+I KSVLE A+ LLTD  AA ++SM N ALWQASFDAFF LLTKYC
Sbjct  656  VGSSAGDGASIIIKSVLESATELLTDRHAATNYSMSNRALWQASFDAFFGLLTKYC  711



>ref|XP_010243929.1| PREDICTED: protein PAT1 homolog 1-like [Nelumbo nucifera]
Length=826

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS++ KSVL+RA+ LLT+PQAA++++M N ALWQASFDAFF LLTKYCV
Sbjct  686  LGSSAGDGASVLLKSVLDRATELLTNPQAASNYNMQNRALWQASFDAFFTLLTKYCV  742


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q++  Q   +T  I  E ARAI+ EMP+ELLRAS+
Sbjct  725  LWQASFDAFFTLLTKYCVSKYDSIVQSLLMQAPPNTASIGSEAARAISREMPIELLRASI  784

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRG-GSSRKINAESV  287
            PHTNE QRK+L++F Q S+P+ GFN+ G GS  ++N+ESV
Sbjct  785  PHTNEHQRKILLDFAQRSMPVTGFNTHGNGSGGQMNSESV  824



>emb|CDY37402.1| BnaC05g30280D [Brassica napus]
Length=785

 Score = 60.8 bits (146),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS +GDGAS++  S+LERA+ ++  P+A +  S  N  LW+ASF+ FF LLTKYC
Sbjct  656  IGSSSGDGASVVLISLLERAAEVVVVPRAVHGSS--NDGLWRASFNEFFNLLTKYC  709


 Score = 52.4 bits (124),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   ++  +  ++RGG   +IN+ESV
Sbjct  731  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAVSESASHARGG---QINSESV  783



>ref|XP_010926894.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Elaeis guineensis]
Length=822

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL------CC--KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D IMQ+     +S   I  +  RAI+ EMPVELLRASLP
Sbjct  723  LWQASFDAFFGLLTKYCENKYDTIMQSSHMQASSAGFIGSDAPRAISKEMPVELLRASLP  782

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HT+E QR +L++F Q S+P+ G+N+RGG +  I++ESV
Sbjct  783  HTDEHQRMLLLDFAQRSMPVIGYNARGGGNGPISSESV  820


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS+I KSVLE A+ LLTD  AA ++SM N ALWQASFDAFF LLTKYC
Sbjct  684  VGSSAGDGASIIIKSVLESATELLTDRHAATNYSMSNRALWQASFDAFFGLLTKYC  739



>ref|XP_010062704.1| PREDICTED: protein PAT1 homolog 1 [Eucalyptus grandis]
 gb|KCW69830.1| hypothetical protein EUGRSUZ_F03181 [Eucalyptus grandis]
Length=841

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGA+LI KSVLERA+ LLTDPQA  ++++ N  LWQASFD F+ LLTKYCV
Sbjct  700  LGSPAGDGATLILKSVLERATELLTDPQAGTNYTITNRQLWQASFDEFYVLLTKYCV  756


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = -2

Query  553  FQTSYEIL---CC-KFDNIMQAV--AQTETSTDVISPEVARAINSEMPVELLRASLPHTN  392
            F   Y +L   C  K+D+I+Q++      TS  VI  + A+AI+ EMPVELLRASLPHT+
Sbjct  744  FDEFYVLLTKYCVNKYDSIIQSLLLQAPMTSMPVIGADAAKAISREMPVELLRASLPHTD  803

Query  391  ELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  287
            E QRK+L++F Q S+P+ G NS  GG+  +I++ESV
Sbjct  804  EDQRKLLLDFAQRSMPVVGLNSHEGGNGGQISSESV  839



>gb|KFK39518.1| hypothetical protein AALP_AA3G254500 [Arabis alpina]
Length=781

 Score = 59.7 bits (143),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+   +    N  LW+ASFD FF LLTKYC
Sbjct  651  IGSSAGDGASVLLISLLERAAEVVVAPRV--NLGNSNDGLWRASFDEFFNLLTKYC  704


 Score = 53.1 bits (126),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = -2

Query  466  SPEVAR-AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINA  296
            +P+V   AI  EMP ELLRASL HTN+ QR  L+NFG+   +I  +  ++RGG   +IN+
Sbjct  719  APDVLELAIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAISESASHARGGG--QINS  776

Query  295  ESV  287
            ESV
Sbjct  777  ESV  779



>ref|XP_004970101.1| PREDICTED: uncharacterized protein LOC101761506 [Setaria italica]
Length=810

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD  AA S+++PN  LWQASFDAFF LLTKYCV
Sbjct  673  LGSSAGDGASLIIKSVLDRATELLTDHHAAASYTVPNRTLWQASFDAFFGLLTKYCV  729


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  KF++I Q     +  + VI PE ++A + EMPVELLRASLP
Sbjct  712  LWQASFDAFFGLLTKYCVSKFESIQQMFV-MQAPSPVIGPEASKATSKEMPVELLRASLP  770

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QR+ L++F Q S+P+ GFN +G     I +ESV
Sbjct  771  HTNEQQRQRLLDFAQRSMPVTGFNPQGARGGHITSESV  808



>ref|XP_002889231.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65490.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score = 63.9 bits (154),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS++ KS L+RAS L+     AN+F+    ALW+ASF+ FF +L +YC+
Sbjct  663  LGSPVGDGASMVLKSTLDRASELIR----ANNFNNTGMALWRASFNEFFNMLMRYCI  715


 Score = 48.5 bits (114),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQT---ETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ++      + +T+ IS   A+AI  EMP+ELLR+S PH +E Q+++LM F
Sbjct  717  KYDSIMQSLNSQLPPQFATE-ISDAAAQAIVREMPIELLRSSFPHIDEQQKRILMEF  772



>ref|XP_008229675.1| PREDICTED: protein PAT1 homolog 1-like [Prunus mume]
Length=808

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSP+GDGA++I KSVLERA+ +L+DP AA + S PN ALWQASFD FF LLTKYC+   
Sbjct  669  LGSPSGDGATIILKSVLERATEILSDPHAAGNCSRPNRALWQASFDEFFGLLTKYCLSKY  728

Query  516  II*CKQLHRQKQAQT*LV  463
                + +  Q Q  T ++
Sbjct  729  ETIVQTIFTQPQQSTEVI  746


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q +  Q + ST+VI  E  +AI+ EMPVELLRASL
Sbjct  708  LWQASFDEFFGLLTKYCLSKYETIVQTIFTQPQQSTEVIGSEATKAIHREMPVELLRASL  767

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F Q S+P+AG N+ GG   ++N+ESV
Sbjct  768  PHTDERQRKLLSDFAQRSMPIAGLNAHGGGGGQMNSESV  806



>ref|XP_007049006.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
 gb|EOX93163.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
Length=724

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K++ IMQ++  QT+ +T+VI  E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+
Sbjct  646  KYETIMQSMHTQTQPTTEVIGSE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSV  702

Query  346  PLAGFNSRGGSSRKINAESV  287
            P+ G NS  G++ +IN+ESV
Sbjct  703  PMNGSNSHAGNTSQINSESV  722


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV   
Sbjct  590  LGSPAGDGASVILKSVLERATQLLSHP--SGNCSMPNYAFWRASFDEFFALLTKYCVSKY  647

Query  516  II*CKQLHRQKQAQT*LV  463
                + +H Q Q  T ++
Sbjct  648  ETIMQSMHTQTQPTTEVI  665



>ref|XP_007049005.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
 gb|EOX93162.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
Length=798

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K++ IMQ++  QT+ +T+VI  E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+
Sbjct  720  KYETIMQSMHTQTQPTTEVIGSE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSV  776

Query  346  PLAGFNSRGGSSRKINAESV  287
            P+ G NS  G++ +IN+ESV
Sbjct  777  PMNGSNSHAGNTSQINSESV  796


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV   
Sbjct  664  LGSPAGDGASVILKSVLERATQLLSHP--SGNCSMPNYAFWRASFDEFFALLTKYCVSKY  721

Query  516  II*CKQLHRQKQAQT*LV  463
                + +H Q Q  T ++
Sbjct  722  ETIMQSMHTQTQPTTEVI  739



>ref|XP_004488835.1| PREDICTED: uncharacterized protein LOC101501230 isoform X1 [Cicer 
arietinum]
Length=827

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDG SLI  SVLERA+ LLTDP+AA+++++ N +LWQASFD FF LLTKYCV
Sbjct  689  LGSPAGDGTSLILVSVLERATELLTDPRAASNYNIANRSLWQASFDEFFGLLTKYCV  745


 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 70/100 (70%), Gaps = 12/100 (12%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+I+Q+ ++Q  ++  VI P+VARAI+ EMPVELLRASL
Sbjct  728  LWQASFDEFFGLLTKYCVNKYDSIIQSFLSQGTSNMAVIGPDVARAISREMPVELLRASL  787

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  287
            PHT++ Q+K+L++F Q S+   G+NS  GG+   +N++SV
Sbjct  788  PHTDDRQKKILLDFAQRSV--VGYNSNSGGNGHHVNSQSV  825



>ref|XP_007217055.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
 gb|EMJ18254.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
Length=886

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSP+GDGA++I KSVLERA+ +L+DP AA + S PN ALWQASFD FF LLTKYC+   
Sbjct  747  LGSPSGDGATIILKSVLERATEILSDPLAAGNCSRPNRALWQASFDEFFGLLTKYCLSKY  806

Query  516  II*CKQLHRQKQAQT*LV  463
                + +  Q Q  T ++
Sbjct  807  ETIVQTIFTQPQQSTEVI  824


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++            K++ I+Q +  Q + ST+VI  E  +AI+ EMPVELLRASL
Sbjct  786  LWQASFDEFFGLLTKYCLSKYETIVQTIFTQPQQSTEVIGSEATKAIHREMPVELLRASL  845

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT+E QRK+L +F Q S+P++G N+ GG   ++N+ESV
Sbjct  846  PHTDERQRKLLSDFAQRSMPISGLNAHGGGGGQMNSESV  884



>gb|KJB10632.1| hypothetical protein B456_001G212600 [Gossypium raimondii]
Length=796

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERAS LL+ P  + + SMPN  LW+ASFD FF LLTKYCV   
Sbjct  662  LGSPAGDGASVIIKSVLERASQLLSHP--SGNCSMPNYTLWRASFDEFFALLTKYCVSKY  719

Query  516  II*CKQLHRQKQAQT*LV  463
                + +H Q Q  T ++
Sbjct  720  ETIIQSIHNQTQPTTEVI  737


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K++ I+Q++  QT+ +T+VI  E   AI  EMP ELLRASLPHTNE Q+K+LM+F Q S+
Sbjct  718  KYETIIQSIHNQTQPTTEVIGSE---AIRREMPCELLRASLPHTNESQKKLLMDFSQRSV  774

Query  346  PLAGFNSRGGSSRKINAESV  287
            P+ G NS  GS+ +IN+E+V
Sbjct  775  PMNGSNSPAGSTSRINSETV  794



>ref|XP_002980379.1| hypothetical protein SELMODRAFT_112306 [Selaginella moellendorffii]
 gb|EFJ18639.1| hypothetical protein SELMODRAFT_112306 [Selaginella moellendorffii]
Length=472

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSP+GDGA++  ++VL+RA+ +LTD      + + N ++WQASFDAFF LL+KYC 
Sbjct  338  VGSPSGDGATVALQAVLDRATSILTDRNV--QYPLQNTSVWQASFDAFFGLLSKYCT  392


 Score = 45.4 bits (106),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  445  INSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            +  EMP+ELLR+SLPHTNE QRK L+   Q S+
Sbjct  421  MTREMPIELLRSSLPHTNENQRKRLLELAQRSL  453



>ref|XP_002962712.1| hypothetical protein SELMODRAFT_165728 [Selaginella moellendorffii]
 gb|EFJ36175.1| hypothetical protein SELMODRAFT_165728 [Selaginella moellendorffii]
Length=474

 Score = 65.1 bits (157),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GSP+GDGA++  ++VL+RA+ +LTD      + + N ++WQASFDAFF LL+KYC 
Sbjct  340  VGSPSGDGATVALQAVLDRATSILTDRNV--QYPLQNTSVWQASFDAFFGLLSKYCT  394


 Score = 45.4 bits (106),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  445  INSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            +  EMP+ELLR+SLPHTNE QRK L+   Q S+
Sbjct  423  MTREMPIELLRSSLPHTNENQRKRLLELAQRSL  455



>gb|KHG26425.1| Protein PAT1 [Gossypium arboreum]
Length=795

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERAS LL+ P  + + SMPN  LW+ASFD FF LLTKYCV   
Sbjct  661  LGSPAGDGASVIIKSVLERASQLLSHP--SGNCSMPNYTLWRASFDEFFALLTKYCVSKY  718

Query  516  II*CKQLHRQKQAQT*LV  463
                + +H Q Q  T ++
Sbjct  719  ETIIQSIHNQPQPTTEVI  736


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K++ I+Q++  Q + +T+VI  E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+
Sbjct  717  KYETIIQSIHNQPQPTTEVIGSE---AIRREMPCELLRASLPHTNESQRKLLMDFSQRSV  773

Query  346  PLAGFNSRGGSSRKINAESV  287
            P+ G NS  GS+ +IN+ESV
Sbjct  774  PMNGSNSPAGSTSRINSESV  793



>ref|XP_003569904.1| PREDICTED: uncharacterized protein LOC100838182 [Brachypodium 
distachyon]
Length=805

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI KSVL+RA+ LLTD  A +S++  N ALWQASFDAFF LLTKYC+
Sbjct  668  LGSPAGDGASLIIKSVLDRATELLTDHHAVSSYTPSNRALWQASFDAFFGLLTKYCL  724


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 58/98 (59%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I+Q     + S   I  E ++A + EMPVELLRASL 
Sbjct  707  LWQASFDAFFGLLTKYCLSKYESILQMFV-MQGSGSAIGSEASQATSREMPVELLRASLH  765

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QR+ML++F Q + P  GFN  G S   I +ESV
Sbjct  766  HTNEQQRQMLLDFAQRTTPATGFNPPGPSGGHITSESV  803



>ref|XP_006283147.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16045.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=792

 Score = 59.7 bits (143),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++         +  N  LW+ASFD FF LLTKYC
Sbjct  658  IGSPSGDGASVVLVSLLERAAEVVVVGVVPRVSNNSNDGLWRASFDEFFSLLTKYC  713


 Score = 49.7 bits (117),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            AI  EMP ELLRASL HTNE QR  L+NFG+ + P
Sbjct  735  AIKREMPAELLRASLRHTNEDQRNFLLNFGRRASP  769



>ref|XP_008775079.1| PREDICTED: protein PAT1 homolog 1-like [Phoenix dactylifera]
Length=808

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS+I KSVLERA+ LLTD  AA ++SM N ALWQASFDAFF LLTKYC
Sbjct  683  VGSSAGDGASIIIKSVLERATELLTDRHAATNYSMSNRALWQASFDAFFGLLTKYC  738


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = -2

Query  556  LFQTSYEIL------CC--KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D I Q++     +  +I P+  RAI+ EMPVELLRASLP
Sbjct  722  LWQASFDAFFGLLTKYCQNKYDTITQSLLMQAPNPAIIGPDATRAISREMPVELLRASLP  781

Query  400  HTNELQRKMLMNFGQGSIPLAGFNS  326
            HT+E QRK+L+ F Q S+P+ G+N+
Sbjct  782  HTDEHQRKLLLAFAQRSMPVTGYNA  806



>ref|XP_006283146.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16044.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=781

 Score = 59.7 bits (143),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++         +  N  LW+ASFD FF LLTKYC
Sbjct  647  IGSPSGDGASVVLVSLLERAAEVVVVGVVPRVSNNSNDGLWRASFDEFFSLLTKYC  702


 Score = 49.7 bits (117),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            AI  EMP ELLRASL HTNE QR  L+NFG+ + P
Sbjct  724  AIKREMPAELLRASLRHTNEDQRNFLLNFGRRASP  758



>emb|CAB10277.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78541.1| hypothetical protein [Arabidopsis thaliana]
Length=679

 Score = 61.6 bits (148),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTD--PQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS +GDGAS++  S+LERA+ ++    P   ++   PN  LW+ASFD FF LLTKYC
Sbjct  543  IGSSSGDGASVVLVSLLERAAEVIVAVVPPRVSNHGNPNDGLWRASFDEFFSLLTKYC  600


 Score = 47.8 bits (112),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSR--KINAESV  287
            AI  EMP ELLRASL HTNE QR  L+N G+ + P++   +   S+   +IN+E V
Sbjct  622  AIKREMPAELLRASLRHTNEDQRNFLLNVGRSASPVSESTTTRASASGGQINSEFV  677



>dbj|BAF01932.1| hypothetical protein [Arabidopsis thaliana]
Length=332

 Score = 61.6 bits (148),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTD--PQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS +GDGAS++  S+LERA+ ++    P   ++   PN  LW+ASFD FF LLTKYC
Sbjct  196  IGSSSGDGASVVLVSLLERAAEVIVAVVPPRVSNHGNPNDGLWRASFDEFFSLLTKYC  253


 Score = 47.8 bits (112),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSR--KINAESV  287
            AI  EMP ELLRASL HTNE QR  L+N G+ + P++   +   S+   +IN+E V
Sbjct  275  AIKREMPAELLRASLRHTNEDQRNFLLNVGRSASPVSESTTTRASASGGQINSEFV  330



>ref|XP_004162291.1| PREDICTED: uncharacterized protein LOC101226533 [Cucumis sativus]
Length=808

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGASLI KS LERA+ LLTDP AA ++++ + +LWQASFD FF +LTKYCV   
Sbjct  666  LGSPAGDGASLILKSCLERATLLLTDPNAACNYNLTHRSLWQASFDDFFDILTKYCVNKY  725

Query  516  II*CKQLHRQKQ  481
                + L R  Q
Sbjct  726  DTIMQSLVRHSQ  737


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 5/79 (6%)
 Frame = -2

Query  553  FQTSYEIL---CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNE  389
            F   ++IL   C  K+D IMQ+ V  ++ +    + E A A++ EMPVE+LRASLPHT+ 
Sbjct  710  FDDFFDILTKYCVNKYDTIMQSLVRHSQQNAAAAASEAAAAMSREMPVEVLRASLPHTDG  769

Query  388  LQRKMLMNFGQGSIPLAGF  332
             Q+KML+NF Q S+P+ GF
Sbjct  770  YQKKMLLNFAQRSMPVGGF  788



>ref|XP_004144681.1| PREDICTED: uncharacterized protein LOC101207256 [Cucumis sativus]
 gb|KGN54923.1| hypothetical protein Csa_4G604530 [Cucumis sativus]
Length=808

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGASLI KS LERA+ LLTDP AA ++++ + +LWQASFD FF +LTKYCV   
Sbjct  666  LGSPAGDGASLILKSCLERATLLLTDPNAACNYNLTHRSLWQASFDDFFDILTKYCVNKY  725

Query  516  II*CKQLHRQKQ  481
                + L R  Q
Sbjct  726  DTIMQSLVRHSQ  737


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 5/79 (6%)
 Frame = -2

Query  553  FQTSYEIL---CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASLPHTNE  389
            F   ++IL   C  K+D IMQ+ V  ++ +    + E A A++ EMPVE+LRASLPHT+ 
Sbjct  710  FDDFFDILTKYCVNKYDTIMQSLVRHSQQNAAAAASEAAAAMSREMPVEVLRASLPHTDG  769

Query  388  LQRKMLMNFGQGSIPLAGF  332
             Q+KML+NF Q S+P+ GF
Sbjct  770  YQKKMLLNFAQRSMPVGGF  788



>ref|XP_009406732.1| PREDICTED: uncharacterized protein LOC103989576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=811

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGAS+I KSVL+RA+ LLTDP AAN++++ +  LWQASFDAFF LLTKYC+
Sbjct  673  LGSSAGDGASIIIKSVLDRATDLLTDPHAANNYTVSSRTLWQASFDAFFGLLTKYCL  729


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+IMQ +     ST V+  E  RAI+ EMPVELL ASLP
Sbjct  712  LWQASFDAFFGLLTKYCLSKYDSIMQMLLMQAPSTAVVGSEATRAISREMPVELLHASLP  771

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QRK+L++F Q S+P+   ++ GG+SR  ++ESV
Sbjct  772  HTNDHQRKVLLDFAQRSMPVVRVSTHGGNSRPESSESV  809



>ref|NP_567452.2| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AAK59544.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83534.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=787

 Score = 61.6 bits (148),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTD--PQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS +GDGAS++  S+LERA+ ++    P   ++   PN  LW+ASFD FF LLTKYC
Sbjct  651  IGSSSGDGASVVLVSLLERAAEVIVAVVPPRVSNHGNPNDGLWRASFDEFFSLLTKYC  708


 Score = 47.8 bits (112),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLA  338
            AI  EMP ELLRASL HTNE QR  L+N G+ + P++
Sbjct  730  AIKREMPAELLRASLRHTNEDQRNFLLNVGRSASPVS  766



>ref|XP_010525174.1| PREDICTED: uncharacterized protein LOC104803017 [Tarenaya hassleriana]
Length=784

 Score = 57.0 bits (136),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP GDGASL+  S+ ERA+ +   P    +    N  LW+ASFD FF LLTKYC
Sbjct  657  IGSPVGDGASLVLISLFERAAEVQV-PHV--NHGNHNDGLWRASFDEFFTLLTKYC  709


 Score = 52.0 bits (123),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 15/88 (17%)
 Frame = -2

Query  550  QTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKML  371
            ++ YE + C          Q + + DV+      AI  EMP ELLRASL HT+E QR  L
Sbjct  710  RSKYETIRC----------QNQGNADVME----LAIKKEMPAELLRASLRHTSEEQRNSL  755

Query  370  MNFGQGSIPLAGFNSRGGSSRKINAESV  287
            ++FG+   P+    S G  S +IN+ESV
Sbjct  756  LSFGRKPSPIGESTSHGRGS-QINSESV  782



>ref|XP_008444289.1| PREDICTED: protein PAT1 homolog 1 [Cucumis melo]
Length=808

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGASLI KS LERA+ LLTDP AA ++++ + +LWQASFD FF +LTKYCV
Sbjct  666  LGSPAGDGASLILKSCLERATLLLTDPNAACNYNLTHRSLWQASFDDFFNILTKYCV  722


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 9/84 (11%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D IMQ+ V  +  +    + + A A++ EMPVE+LRASL
Sbjct  705  LWQASFDDFFNILTKYCVNKYDTIMQSLVRHSPQNAAAAASDAAAAMSREMPVEVLRASL  764

Query  403  PHTNELQRKMLMNFGQGSIPLAGF  332
            PHT+  Q+KML+NF Q S+P+ GF
Sbjct  765  PHTDGYQKKMLLNFAQRSMPVGGF  788



>gb|KEH38344.1| topoisomerase II-associated protein PAT1, putative [Medicago 
truncatula]
Length=825

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDG SLI  SVLERA+ +LTDP AA+++++ N +LWQASFD FF LLTKYCV
Sbjct  687  LGSPVGDGTSLILVSVLERATEVLTDPHAASNYNIRNRSLWQASFDEFFGLLTKYCV  743


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 69/100 (69%), Gaps = 12/100 (12%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D+IMQ+ +AQ  ++  VI P+VARAI+ EMPVELLRASL
Sbjct  726  LWQASFDEFFGLLTKYCVNKYDSIMQSFLAQGTSNMAVIGPDVARAISREMPVELLRASL  785

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSR-GGSSRKINAESV  287
            PHT++ Q+K+L++F Q S+   G++S  GG+    N++SV
Sbjct  786  PHTDDRQKKILLDFAQRSV--VGYSSNAGGNGHHANSQSV  823



>ref|XP_009399054.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=822

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGA+++ KS+L+RA+ LL+DPQAANS S+ N  LWQASFDAFF LLTKYC+
Sbjct  684  VGSSAGDGATVVVKSILDRATDLLSDPQAANSCSISNRTLWQASFDAFFGLLTKYCL  740


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 60/98 (61%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+I+Q +     +  V+  E  RAI+ EMPV+LLRASLP
Sbjct  723  LWQASFDAFFGLLTKYCLSKYDSILQMLLIQAPNDAVVGSEATRAISREMPVDLLRASLP  782

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HT+E Q K+L++F Q  +P+ GF++ G  S  +  ESV
Sbjct  783  HTDEHQHKVLLDFAQRLMPVTGFSAHGSDSGSVTYESV  820



>ref|XP_004294192.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=820

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGASL+  +VL+RA+ LLTDP AA++++M N ALWQASFD FF LLTKYCV
Sbjct  683  IGSSAGDGASLVLNAVLDRATELLTDPNAASNYNMTNRALWQASFDQFFGLLTKYCV  739


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (66%), Gaps = 11/99 (11%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+D IMQ++     T+  VI  + ARAI+ EMPVELLRASL
Sbjct  722  LWQASFDQFFGLLTKYCVNKYDTIMQSLLLHAPTNMAVIGSDAARAISREMPVELLRASL  781

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHT++ QR++L+NF Q S+P+ G N+  G+   IN+ESV
Sbjct  782  PHTDDHQRQLLLNFTQRSMPVGGSNNHDGA--HINSESV  818



>gb|KHM98853.1| hypothetical protein glysoja_022263 [Glycine soja]
Length=728

 Score = 69.3 bits (168),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  460  EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSS  311
            + ++AI+ EMPV+LLRASLPHTN+ QRK+L++F Q S+P+ GFNS  GSS
Sbjct  641  DASKAISREMPVKLLRASLPHTNDHQRKLLLDFAQRSVPVVGFNSYTGSS  690


 Score = 38.1 bits (87),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPAL  577
            LGS  GD AS I  SVLER + L TDP  A S+   + A+
Sbjct  607  LGSTPGDDASRIIVSVLERTTELFTDPHGAGSYEDASKAI  646



>gb|EAY75968.1| hypothetical protein OsI_03887 [Oryza sativa Indica Group]
Length=827

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  690  LGSSAGDGASLIIKSVLDRATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCL  746


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   V   EV++A + EMPVELLRASLP
Sbjct  729  LWQASFDAFFGLLTKYCLSKYESIKQMFV-MQSPCSVTGSEVSKATSREMPVELLRASLP  787

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  788  HTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  825



>dbj|BAJ90621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD  A +S++  N ALWQASFDAFF LLTKYC+
Sbjct  673  LGSSAGDGASLIIKSVLDRATELLTDQHAVSSYTSSNRALWQASFDAFFGLLTKYCL  729


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I+Q + + + S  VI  E ++A + EMPVELLRASLP
Sbjct  712  LWQASFDAFFGLLTKYCLSKYESILQ-MFRMQASGSVIGSEASQATSREMPVELLRASLP  770

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QR+ML++F Q + P + FN  G S   I +ESV
Sbjct  771  HTNEQQRQMLLDFAQRTTPASSFNPPGASGGHITSESV  808



>dbj|BAK00541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD  A +S++  N ALWQASFDAFF LLTKYC+
Sbjct  673  LGSSAGDGASLIIKSVLDRATELLTDQHAVSSYTSSNRALWQASFDAFFGLLTKYCL  729


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I+Q + + + S  VI  E ++A + EMPVELLRASLP
Sbjct  712  LWQASFDAFFGLLTKYCLSKYESILQ-MFRMQASGSVIGSEASQATSREMPVELLRASLP  770

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QR+ML++F Q + P + FN  G S   I +ESV
Sbjct  771  HTNEQQRQMLLDFAQRTTPASSFNPPGASGGHITSESV  808



>gb|EMS52590.1| hypothetical protein TRIUR3_20541 [Triticum urartu]
Length=809

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD +A +S++  N ALWQASFDAFF LLTKYC+
Sbjct  672  LGSSAGDGASLIIKSVLDRATELLTDQRAVSSYTPSNRALWQASFDAFFGLLTKYCL  728


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S++         C  K+++I+Q     + S  VI  E ++A + EMPVELLRASL
Sbjct  710  ALWQASFDAFFGLLTKYCLSKYESILQMFV-MQASGSVIGSEASQAPSREMPVELLRASL  768

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QR+ML++F Q + P + FN  G S   I++ESV
Sbjct  769  PHTNEQQRQMLLDFAQRTTPASSFNPPGASGGHISSESV  807



>emb|CDY50269.1| BnaAnng10330D [Brassica napus]
Length=768

 Score = 58.9 bits (141),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 9/56 (16%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++ +          N  LW+ASFD FF LLTKYC
Sbjct  644  IGSPSGDGASVVLVSLLERAAQVVKNS---------NDGLWRASFDEFFSLLTKYC  690


 Score = 47.8 bits (112),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 8/61 (13%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFG-QGSI  347
            K++ I     Q   + DV+  EVA  I  EMP ELLRASL HT+E QR  L+NFG +GS 
Sbjct  693  KYETIH---GQENAAADVL--EVA--IKREMPAELLRASLRHTSEDQRNFLLNFGRKGSS  745

Query  346  P  344
            P
Sbjct  746  P  746



>gb|EMT11670.1| Protein PAT1-1-like protein [Aegilops tauschii]
Length=809

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS AGDGASLI KSVL+RA+ LLTD +A +S++  N ALWQASFDAFF LLTKYC+
Sbjct  672  LGSSAGDGASLIIKSVLDRATELLTDQRAVSSYTPSNRALWQASFDAFFGLLTKYCL  728


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = -2

Query  559  CLFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S++         C  K+++I+Q     + S  VI  E ++A + EMPVELLRASL
Sbjct  710  ALWQASFDAFFGLLTKYCLSKYESILQMFV-MQASGSVIGSEASQATSREMPVELLRASL  768

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QR+ML++F Q + P + FN  G S   I++ESV
Sbjct  769  PHTNEQQRQMLLDFAQRTTPASSFNPTGASGGHISSESV  807



>ref|XP_009397355.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=844

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 63/98 (64%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+I+Q +     +  VI  + +RAI+ EMP++LLRASLP
Sbjct  745  LWQASFDAFFGLLTKYCWSKYDSILQMLLIQAPNDTVIGSDASRAISREMPIDLLRASLP  804

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QR++L++F Q S+P+ GF + G SS    +ESV
Sbjct  805  HTNEHQREVLLDFAQTSMPITGFRAHGSSSGPATSESV  842


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGA+++  SVL++A+ LLTDP +ANS S+ N +LWQASFDAFF LLTKYC
Sbjct  706  VGSSAGDGATILIISVLDQATNLLTDPHSANSCSISNRSLWQASFDAFFGLLTKYC  761



>ref|XP_009147964.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=768

 Score = 58.9 bits (141),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 9/56 (16%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++ +          N  LW+ASFD FF LLTKYC
Sbjct  644  IGSPSGDGASVVLVSLLERAAQVVKNS---------NDGLWRASFDEFFSLLTKYC  690


 Score = 47.0 bits (110),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFG-QGSIP  344
            AI  EMP ELLRASL HT+E QR  L+NFG +GS P
Sbjct  711  AIKREMPAELLRASLRHTSEDQRNFLLNFGRKGSSP  746



>ref|XP_009416762.1| PREDICTED: protein PAT1 homolog 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=742

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGAS+I KSVL+RA+ LLTDP AA+++S+ +  LWQASFDAFF LLTKYC+
Sbjct  604  VGSSAGDGASIIVKSVLDRATDLLTDPYAASNYSVSSRTLWQASFDAFFGLLTKYCL  660


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+ MQ +     ST +   E  RAI+ EMP+ELL ASLP
Sbjct  643  LWQASFDAFFGLLTKYCLSKYDSTMQTLLMQAPSTAITGSEATRAISREMPIELLHASLP  702

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QRK+L++F Q S+P+  F++ G  SR  ++ESV
Sbjct  703  HTNENQRKVLLDFTQRSMPVVHFSTHGVLSRAESSESV  740



>ref|XP_009416761.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=808

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            +GS AGDGAS+I KSVL+RA+ LLTDP AA+++S+ +  LWQASFDAFF LLTKYC+
Sbjct  670  VGSSAGDGASIIVKSVLDRATDLLTDPYAASNYSVSSRTLWQASFDAFFGLLTKYCL  726


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 8/98 (8%)
 Frame = -2

Query  556  LFQTSYEIL-------CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+D+ MQ +     ST +   E  RAI+ EMP+ELL ASLP
Sbjct  709  LWQASFDAFFGLLTKYCLSKYDSTMQTLLMQAPSTAITGSEATRAISREMPIELLHASLP  768

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE QRK+L++F Q S+P+  F++ G  SR  ++ESV
Sbjct  769  HTNENQRKVLLDFTQRSMPVVHFSTHGVLSRAESSESV  806



>ref|XP_002457098.1| hypothetical protein SORBIDRAFT_03g001160 [Sorghum bicolor]
 gb|EES02218.1| hypothetical protein SORBIDRAFT_03g001160 [Sorghum bicolor]
Length=592

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LG  AGDGA++I KSVL+RA+ LLT+  AA  +S PN ALWQASF+AFF LLTKYCV   
Sbjct  475  LGYAAGDGATVIIKSVLDRATDLLTEHPAAPDYSAPNRALWQASFNAFFGLLTKYCVSKF  534

Query  516  II*CKQLHRQKQAQT  472
                  +H+   A T
Sbjct  535  DSMVHTMHKHPAAAT  549


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 8/68 (12%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            KFD+++  + +         P  A  I+ E+PVELLRASLPHT+E QR++L+ F Q ++P
Sbjct  533  KFDSMVHTMHK--------HPAAATVIHKELPVELLRASLPHTDEQQRRLLLEFAQRTLP  584

Query  343  LAGFNSRG  320
            +AG +S G
Sbjct  585  VAGHSSDG  592



>ref|XP_006647188.1| PREDICTED: protein PAT1 homolog 1-like [Oryza brachyantha]
Length=827

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I KSVL+RA+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+
Sbjct  691  LGQAAGDGASVIIKSVLDRATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCM  747


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 57/99 (58%), Gaps = 16/99 (16%)
 Frame = -2

Query  559  CLFQTSY--------EILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S+        E    KFD+ + A+ QT+       P  A  I+ EMPVELLRASL
Sbjct  729  ALWQASFDAFFGLLTEYCMSKFDSAIHAL-QTQ-------PAAAAVISREMPVELLRASL  780

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK L++F Q ++P+   +S G  SR I +ES 
Sbjct  781  PHTNERQRKQLLSFAQRTVPVNNHSSHGSDSRPITSEST  819



>ref|XP_002513421.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48824.1| conserved hypothetical protein [Ricinus communis]
Length=777

 Score = 54.7 bits (130),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGS  G+ ASLI  SVL+RA+ LL   Q  ++ ++ N A W+ASFD FF L+  YC+
Sbjct  657  LGSSDGNEASLILISVLDRATELLKRFQDGSNHNVTNKAPWKASFDEFFGLVLNYCI  713


 Score = 50.4 bits (119),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 12/60 (20%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISP-EVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+D IMQ+           SP + A A   E+P+ELLRAS+PHTN+ Q+KML +  Q S+
Sbjct  715  KYDEIMQS-----------SPLDPAEATKRELPIELLRASVPHTNDYQKKMLFDLSQRSL  763



>ref|XP_004952292.1| PREDICTED: uncharacterized protein LOC101759904 [Setaria italica]
Length=820

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVV  523
            LGSPAGD AS+I KSVL+RA+ LLTD   A+++S+ N ALWQASFDAFF LLT+YC+ 
Sbjct  690  LGSPAGDWASVIIKSVLDRATVLLTDQHVASAYSVQNRALWQASFDAFFGLLTQYCMT  747


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 16/98 (16%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  KFD+++         T  + P  A  I+ EMPVELLRASLP
Sbjct  729  LWQASFDAFFGLLTQYCMTKFDSVVH--------TAQLQPAAAAVISREMPVELLRASLP  780

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN  QRK L++F Q ++P+   +S G  S  + ++SV
Sbjct  781  HTNADQRKQLLSFAQRTVPVGTHSSHGSGSGPMTSDSV  818



>ref|XP_010497980.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=573

 Score = 59.7 bits (143),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD +++I KS L+RAS LL+    AN+++     LW+ASFD FF LL K+C+
Sbjct  451  LGSPVGDESTIILKSALDRASELLS----ANNYNNAGMNLWRASFDEFFNLLMKHCI  503


 Score = 45.1 bits (105),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQT---ETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +        +T+ +S   A+AI  EMP+ELLRAS PH ++ Q+++LM F
Sbjct  505  KYDSIMQNLNSQLLPHFATE-MSDAAAQAIVREMPIELLRASFPHISDEQKRILMEF  560



>gb|KJB08599.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=792

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = -2

Query  523  KFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSI  347
            K+++I+Q++  Q+  +T+VI  E   AI  EMP ELLRASLPHTNE QRK+LM+F Q S+
Sbjct  714  KYESIIQSIHNQSLPTTEVIGSE---AIRREMPCELLRASLPHTNEAQRKLLMDFSQRSV  770

Query  346  PLAGFNSRGGSSRKINAESV  287
            P  G NS  GS+ +IN+ESV
Sbjct  771  PDNGSNSPAGSNSQINSESV  790


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA+ +LT P  + +F MP+   W+ASFD FF LLTKYCV   
Sbjct  658  LGSPAGDGASVILKSVLERATQVLTHP--SGNFPMPHYTFWRASFDEFFTLLTKYCVTKY  715

Query  516  II*CKQLHRQ  487
                + +H Q
Sbjct  716  ESIIQSIHNQ  725



>gb|EEC72953.1| hypothetical protein OsI_06835 [Oryza sativa Indica Group]
Length=830

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS I KSVL+RA+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+
Sbjct  694  LGHAAGDGASFIIKSVLDRATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCM  750


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 16/99 (16%)
 Frame = -2

Query  559  CLFQTSY--------EILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S+        E    KFD+++ A+ QT+       P VA  I+ EMPVELLRASL
Sbjct  732  ALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------PAVAAVISREMPVELLRASL  783

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK L++F Q ++P+   +S G ++  + +ES+
Sbjct  784  PHTNEYQRKQLLSFAQRTVPVNNHSSHGSNNGPMTSESI  822



>ref|NP_001172909.1| Os02g0295700 [Oryza sativa Japonica Group]
 dbj|BAD22185.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ22674.1| hypothetical protein OsJ_06343 [Oryza sativa Japonica Group]
 dbj|BAG91987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91638.1| Os02g0295700 [Oryza sativa Japonica Group]
Length=830

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS I KSVL+RA+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+
Sbjct  694  LGHAAGDGASFIIKSVLDRATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCM  750


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 16/99 (16%)
 Frame = -2

Query  559  CLFQTSY--------EILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S+        E    KFD+++ A+ QT+       P VA  I+ EMPVELLRASL
Sbjct  732  ALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------PAVAAVISREMPVELLRASL  783

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK L++F Q ++P+   +S G ++  + +ES+
Sbjct  784  PHTNEYQRKQLLSFSQRTVPVNNHSSHGSNNGPMTSESI  822



>gb|KJB08598.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=810

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LGSPAGDGAS+I KSVLERA+ +LT P  + +F MP+   W+ASFD FF LLTKYCV   
Sbjct  658  LGSPAGDGASVILKSVLERATQVLTHP--SGNFPMPHYTFWRASFDEFFTLLTKYCVTKY  715

Query  516  II*CKQLHRQ  487
                + +H Q
Sbjct  716  ESIIQSIHNQ  725


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 4/90 (4%)
 Frame = -2

Query  556  LFQTSYEILCCKFDNIMQAVA-QTETSTDVISPEVARAINSEMPVELLRASLPHTNELQR  380
             F    +    K+++I+Q++  Q+  +T+VI  E   AI  EMP ELLRASLPHTNE QR
Sbjct  703  FFTLLTKYCVTKYESIIQSIHNQSLPTTEVIGSE---AIRREMPCELLRASLPHTNEAQR  759

Query  379  KMLMNFGQGSIPLAGFNSRGGSSRKINAES  290
            K+LM+F Q S+P  G NS  GS+ +IN+ES
Sbjct  760  KLLMDFSQRSVPDNGSNSPAGSNSQINSES  789



>gb|EAZ23222.1| hypothetical protein OsJ_06910 [Oryza sativa Japonica Group]
Length=825

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S AGDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  688  LASSAGDGASLIIKSVLDRATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCL  744


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   VI  EV++A + EMPVELLRASLP
Sbjct  727  LWQASFDAFFGLLTKYCLSKYESIRQMFTM-QSPGSVIGSEVSKATSREMPVELLRASLP  785

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ GFN+ G +   I +ESV
Sbjct  786  HTNDQQRQLLLDFAQRTMPVTGFNASGANGGHITSESV  823



>gb|EAY86044.1| hypothetical protein OsI_07409 [Oryza sativa Indica Group]
Length=825

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S AGDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  688  LASSAGDGASLIIKSVLDRATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCL  744


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   VI  EV++A + EMPVELLRASLP
Sbjct  727  LWQASFDAFFGLLTKYCLSKYESIRQMFTM-QSPGSVIGSEVSKATSREMPVELLRASLP  785

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ GFN+ G +   I +ESV
Sbjct  786  HTNDQQRQLLLDFAQRTMPVTGFNASGANGGHITSESV  823



>ref|NP_001044369.2| Os01g0769000 [Oryza sativa Japonica Group]
 dbj|BAD52714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94608.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06283.2| Os01g0769000 [Oryza sativa Japonica Group]
Length=809

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S AGDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  672  LASSAGDGASLIIKSVLDRATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCL  728


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   V   EV++A + EMPVELLRASLP
Sbjct  711  LWQASFDAFFGLLTKYCLSKYESIKQMFV-MQSPCSVTGSEVSKATSREMPVELLRASLP  769

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  770  HTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  807



>ref|NP_001046960.1| Os02g0517300 [Oryza sativa Japonica Group]
 dbj|BAD46717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08874.1| Os02g0517300 [Oryza sativa Japonica Group]
Length=815

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S AGDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  678  LASSAGDGASLIIKSVLDRATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCL  734


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   VI  EV++A + EMPVELLRASLP
Sbjct  717  LWQASFDAFFGLLTKYCLSKYESIRQMFTM-QSPGSVIGSEVSKATSREMPVELLRASLP  775

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ GFN+ G +   I +ESV
Sbjct  776  HTNDQQRQLLLDFAQRTMPVTGFNASGANGGHITSESV  813



>gb|EAY85452.1| hypothetical protein OsI_06832 [Oryza sativa Indica Group]
Length=898

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS I KSVL+RA+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+
Sbjct  762  LGHAAGDGASFIIKSVLDRATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCM  818


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 16/99 (16%)
 Frame = -2

Query  559  CLFQTSY--------EILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S+        E    KFD+++ A+ QT+       P VA  I  EMPVELLRASL
Sbjct  800  ALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------PAVAAVIGREMPVELLRASL  851

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTN  QRK L+ F Q ++P+   +S G  +  + +ES+
Sbjct  852  PHTNAYQRKQLLGFAQRTVPVNNHSSHGSITGPMTSESI  890



>ref|XP_006406189.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
 gb|ESQ47642.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
Length=784

 Score = 53.9 bits (128),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++      +  + PN  LW+ASFD FF LLTKYC
Sbjct  653  IGSSAGDGASVVLISLLERAAEVVVVVPRVSHGNNPNDGLWRASFDEFFNLLTKYC  708


 Score = 50.4 bits (119),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HT++ QR  L+NFG+   ++  +  ++RGG   +IN+ESV
Sbjct  730  AIKREMPAELLRASLCHTSDDQRNYLLNFGRKPSAVSESASHARGG---QINSESV  782



>ref|XP_006648671.1| PREDICTED: uncharacterized protein LOC102700029 [Oryza brachyantha]
Length=782

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S +GDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  645  LASSSGDGASLIIKSVLDRATELLTDQHAAASYTVSNRTLWQASFDAFFGLLTKYCI  701


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q        + V+  EV++A + EMPVELLRASLP
Sbjct  684  LWQASFDAFFGLLTKYCISKYESIRQMFVMQPPGS-VVGSEVSKATSREMPVELLRASLP  742

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ GFN    +   I +ESV
Sbjct  743  HTNDQQRQLLLDFAQRTMPVTGFNPTDANGGHITSESV  780



>gb|EAZ13676.1| hypothetical protein OsJ_03596 [Oryza sativa Japonica Group]
Length=827

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S AGDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  690  LASSAGDGASLIIKSVLDRATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCL  746


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   V   EV++A + EMPVELLRASLP
Sbjct  729  LWQASFDAFFGLLTKYCLSKYESIKQMFV-MQSPCSVTGSEVSKATSREMPVELLRASLP  787

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ G N  G +   I +ESV
Sbjct  788  HTNDQQRQLLLDFAQRTMPVTGINPTGANGGYITSESV  825



>ref|XP_010480501.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=760

 Score = 58.9 bits (141),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD +++I K+ L+RAS LL+    AN+++     LW+ASFD FF LL K+C+
Sbjct  638  LGSPVGDESTIILKTALDRASELLS----ANNYNNAGMNLWRASFDEFFNLLMKHCI  690


 Score = 45.1 bits (105),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQT---ETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +        +T+ +S   A+AI  EMP+ELLRAS PH ++ Q+++LM F
Sbjct  692  KYDSIMQNLNSQFLPHFATE-MSDAAAQAIVREMPIELLRASFPHISDEQKRILMEF  747



>dbj|BAJ94686.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86063.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=810

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGAS+I KSVL+RA+ LL DP +A S+S    +LWQASFDAFF LLTKYC
Sbjct  673  LGSSAGDGASVIIKSVLDRATELLADPHSAASYSRSTRSLWQASFDAFFGLLTKYC  728


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+ +I+Q     + S  +  PE ++A++ EMP ELLRASLP
Sbjct  712  LWQASFDAFFGLLTKYCDSKYGSILQRFT-MQGSDSMGGPEASKAVSREMPAELLRASLP  770

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HT+E QR+ML++F + S+P+ G+N  G S  +  +E V
Sbjct  771  HTSEEQRQMLLDFARKSMPVIGYNHSGASGGRPASEPV  808



>emb|CBI34052.3| unnamed protein product [Vitis vinifera]
Length=513

 Score = 72.8 bits (177),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -2

Query  445  INSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            I+ EMPVELLRASLPHT+E QRK+L++F Q S+P+ GFN+R GSS ++ +ESV
Sbjct  460  IHREMPVELLRASLPHTDEHQRKLLLDFAQRSMPITGFNTR-GSSGQVTSESV  511


 Score = 31.2 bits (69),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  570  ASFDAFFKLLTKYCV  526
            ASFD FF LLTKYC+
Sbjct  439  ASFDEFFSLLTKYCL  453



>gb|KJB42926.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=776

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGDGAS+I KSVLERA+ LL+ P  + + SMPN A W+ASFD FF LLTKYCV
Sbjct  664  LGSPAGDGASVILKSVLERATQLLSHP--SGNCSMPNYAFWRASFDEFFTLLTKYCV  718



>ref|XP_007149274.1| hypothetical protein PHAVU_005G056500g [Phaseolus vulgaris]
 gb|ESW21268.1| hypothetical protein PHAVU_005G056500g [Phaseolus vulgaris]
Length=828

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S AGDGASLI  SVLERA+ LLTDP AA+++++ N +LWQ++FD FF LLTKYCV
Sbjct  688  LRSSAGDGASLILVSVLERATELLTDPHAASNYNIANRSLWQSTFDEFFGLLTKYCV  744


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 10/100 (10%)
 Frame = -2

Query  556  LFQTSYE--------ILCCKFDNIMQA-VAQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q++++            K+D +MQ+ + Q   +   I  + A AI+ EMPVELLRASL
Sbjct  727  LWQSTFDEFFGLLTKYCVSKYDGVMQSFLIQGTPNMAAIGADAANAISKEMPVELLRASL  786

Query  403  PHTNELQRKMLMNFGQGSIPLAGFN-SRGGSSRKINAESV  287
            PHT++ Q+K+L++F Q SIP+ GFN + GG    +N+ESV
Sbjct  787  PHTDDRQKKLLLDFAQRSIPVVGFNGNSGGHGHHVNSESV  826



>ref|XP_006845982.1| hypothetical protein AMTR_s00155p00028780 [Amborella trichopoda]
 gb|ERN07657.1| hypothetical protein AMTR_s00155p00028780 [Amborella trichopoda]
Length=808

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGAS++ K+VL+RA+ LL DP    S+SMPN  LWQASFDAFF LLTKYC
Sbjct  679  LGSSAGDGASVVVKAVLDRATELLMDPHG--SYSMPNRTLWQASFDAFFGLLTKYC  732


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 11/89 (12%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASL  404
            L+Q S++         C  K+++I+QAV +       + + EVARA+  EMPVELLRASL
Sbjct  716  LWQASFDAFFGLLTKYCFSKYESIIQAVVSGPGGPGPIGAREVARAVAREMPVELLRASL  775

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGG  317
            PHT+E QRK+L+ F Q S  ++G    GG
Sbjct  776  PHTSEAQRKVLVEFSQRS--MSGLTGPGG  802



>ref|XP_001755124.1| predicted protein [Physcomitrella patens]
 gb|EDQ80068.1| predicted protein [Physcomitrella patens]
Length=439

 Score = 60.8 bits (146),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNP-ALWQASFDAFFKLLTKYCV  526
            +G+PAGDGA++I +S+LE+AS +  D  A   F  P    +WQ +FDAFF +LTKYC 
Sbjct  301  IGAPAGDGAAVILRSLLEKASMVRRDRHA---FHTPQSLTIWQHAFDAFFSVLTKYCT  355


 Score = 42.4 bits (98),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  523  KFDNIMQAVAQTET-STDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+++ ++      +   I+     A+  E+PVELL+A+LPHT+E QRK+L + 
Sbjct  357  KYDSVIHSLMMLYPGNIPAINTAADEALKKEIPVELLQATLPHTSEQQRKLLYDL  411



>ref|XP_003568135.1| PREDICTED: protein PAT1 homolog 1-like [Brachypodium distachyon]
Length=806

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGASLI KSVL+RA+ LL DP +A  +S    +LWQASFDAFF LLTKYC
Sbjct  669  LGSSAGDGASLIIKSVLDRATELLADPHSAADYSRSTRSLWQASFDAFFGLLTKYC  724


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+ +I+Q  +  + S  +   E ++A++ EMPVELLRASLP
Sbjct  708  LWQASFDAFFGLLTKYCDSKYGSILQMFS-MQGSNSIARSEASKAVSREMPVELLRASLP  766

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  284
            HTNE QR+ML++F + S+P+ GFN  G SS    +ESV+
Sbjct  767  HTNEQQRQMLLDFARKSMPVTGFNHSGASSGHFTSESVA  805



>ref|XP_004961544.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Setaria italica]
Length=731

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGASLI KSVL+RA+ LL DP +A ++S    +LWQASFDAFF LLTKYC
Sbjct  595  LGSSAGDGASLIIKSVLDRATDLLADPHSAANYSRSTRSLWQASFDAFFGLLTKYC  650


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 10/98 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I+Q  A    S  +  PE  +A++ EMPVELLRASLP
Sbjct  634  LWQASFDAFFGLLTKYCDSKYESIVQRFA-MHGSNSLGGPEATKAVSREMPVELLRASLP  692

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE  R+ L++F + S  ++GF S   S   IN+ESV
Sbjct  693  HTNEQHRQTLLDFARKSTHVSGF-SPNASRGHINSESV  729



>ref|XP_006646364.1| PREDICTED: uncharacterized protein LOC102701783 [Oryza brachyantha]
Length=808

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            L S +GDGASLI KSVL+RA+ LLTD  AA S+++ N  LWQASFDAFF LLTKYC+
Sbjct  671  LASSSGDGASLIIKSVLDRATELLTDHHAAASYTVSNRTLWQASFDAFFGLLTKYCL  727


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 61/98 (62%), Gaps = 9/98 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I Q     ++   VI  EV++A + EMPVELLRASLP
Sbjct  710  LWQASFDAFFGLLTKYCLSKYESIRQMFV-MQSPCSVIGAEVSKATSREMPVELLRASLP  768

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTN+ QR++L++F Q ++P+ GFN  G +     +ESV
Sbjct  769  HTNDQQRQLLLDFAQRTMPVTGFNPTGANGGHATSESV  806



>ref|NP_001145976.1| hypothetical protein [Zea mays]
 gb|ACN33235.1| unknown [Zea mays]
 gb|AFW70877.1| hypothetical protein ZEAMMB73_167578 [Zea mays]
Length=791

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSPAGD AS+I K VL+RA+ LLTD   A+++SM N +LWQASFDAFF LLT+YC+
Sbjct  672  LGSPAGDWASVIIKYVLDRATVLLTDHHVASNYSMRNRSLWQASFDAFFGLLTQYCM  728


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 16/87 (18%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  KFD ++         T  + P  A  I  EMPVELLRASLP
Sbjct  711  LWQASFDAFFGLLTQYCMSKFDRVVH--------TAQLQPAAATVITREMPVELLRASLP  762

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRG  320
            HTNE QRK L++F Q ++P+   +S G
Sbjct  763  HTNEAQRKQLLSFAQRTVPVGTHSSHG  789



>ref|XP_004961543.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Setaria italica]
Length=813

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGASLI KSVL+RA+ LL DP +A ++S    +LWQASFDAFF LLTKYC
Sbjct  677  LGSSAGDGASLIIKSVLDRATDLLADPHSAANYSRSTRSLWQASFDAFFGLLTKYC  732


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 10/98 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I+Q  A    S  +  PE  +A++ EMPVELLRASLP
Sbjct  716  LWQASFDAFFGLLTKYCDSKYESIVQRFA-MHGSNSLGGPEATKAVSREMPVELLRASLP  774

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            HTNE  R+ L++F + S  ++GF S   S   IN+ESV
Sbjct  775  HTNEQHRQTLLDFARKSTHVSGF-SPNASRGHINSESV  811



>gb|EMS48493.1| hypothetical protein TRIUR3_07139 [Triticum urartu]
Length=813

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGA+LI KSVL+RA+ LL DP +A ++S    +LWQASFDAFF LLTKYC
Sbjct  675  LGSSAGDGAALIIKSVLDRATELLADPHSAANYSRSTRSLWQASFDAFFGLLTKYC  730


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 58/89 (65%), Gaps = 9/89 (10%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+ +I+Q  +  + S  +  PE ++A++ EMPVELLRASLP
Sbjct  714  LWQASFDAFFGLLTKYCDSKYGSILQRFSM-QGSNSMAGPEASKAVSREMPVELLRASLP  772

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGS  314
            HT+E QR+ML++F + S+P+ G+N  G S
Sbjct  773  HTSEEQRQMLLDFARKSMPVIGYNHSGAS  801



>ref|XP_010238435.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
Length=718

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I KSVL+RA+ LLTD   A+++S+ N ALWQASFDAFF+LL +YC+
Sbjct  588  LGYAAGDGASVIIKSVLDRATELLTDQHVASTYSIQNRALWQASFDAFFRLLMEYCM  644


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 50/91 (55%), Gaps = 8/91 (9%)
 Frame = -2

Query  559  CLFQTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQR  380
              F+   E    KFD ++  V         + P  A  I SE PVELLRASLPHTNE QR
Sbjct  634  AFFRLLMEYCMSKFDTVVHTVQ--------MQPAAAAVIRSETPVELLRASLPHTNEYQR  685

Query  379  KMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            K L++F Q S+P+   +S G  +  + +ESV
Sbjct  686  KQLLSFAQRSMPVNNSSSHGSGNVPMASESV  716



>ref|XP_003578526.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Brachypodium 
distachyon]
Length=722

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I KSVL+RA+ LLTD   A+++S+ N ALWQASFDAFF+LL +YC+
Sbjct  592  LGYAAGDGASVIIKSVLDRATELLTDQHVASTYSIQNRALWQASFDAFFRLLMEYCM  648


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 50/91 (55%), Gaps = 8/91 (9%)
 Frame = -2

Query  559  CLFQTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQR  380
              F+   E    KFD ++  V         + P  A  I SE PVELLRASLPHTNE QR
Sbjct  638  AFFRLLMEYCMSKFDTVVHTVQ--------MQPAAAAVIRSETPVELLRASLPHTNEYQR  689

Query  379  KMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            K L++F Q S+P+   +S G  +  + +ESV
Sbjct  690  KQLLSFAQRSMPVNNSSSHGSGNVPMASESV  720



>ref|XP_004967457.1| PREDICTED: protein PAT1 homolog 1-like [Setaria italica]
Length=829

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGA++I KSVL+RA+ LLT+  AA+++S+PN  LWQASF+AFF LLTKYC+
Sbjct  703  LGYAAGDGATVIIKSVLDRATELLTEQLAASNYSVPNRGLWQASFNAFFGLLTKYCI  759


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -2

Query  556  LFQTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRK  377
            L+Q S+      F  ++     ++  + V +   A AI  E+PVELLRASLPHT+E QR+
Sbjct  742  LWQASFN----AFFGLLTKYCISKFDSLVHTMHTASAIGRELPVELLRASLPHTDEQQRR  797

Query  376  MLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            +L+ F Q ++P  G NS+      + +E++
Sbjct  798  ILLEFAQRTVPATGHNSQRAPGGTMASETI  827



>ref|XP_010228365.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228366.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Brachypodium 
distachyon]
Length=860

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I  SVLERA+ LLTD   A+++SM N  LWQASFDAFF+LLT+YC+
Sbjct  728  LGHAAGDGASIIIISVLERATELLTDQHVASTYSMQNRGLWQASFDAFFRLLTEYCM  784


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = -2

Query  559  CLFQTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQR  380
              F+   E    +FD+++  V         + P  A AI+ E+PVELLRASLPHTNE QR
Sbjct  774  AFFRLLTEYCMSRFDSVVHTVQ--------MQPSAAAAISREIPVELLRASLPHTNENQR  825

Query  379  KMLMNFGQGSIPL  341
            K L+NF Q ++P+
Sbjct  826  KQLLNFAQRTVPI  838



>ref|XP_010228364.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Brachypodium 
distachyon]
Length=919

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I  SVLERA+ LLTD   A+++SM N  LWQASFDAFF+LLT+YC+
Sbjct  787  LGHAAGDGASIIIISVLERATELLTDQHVASTYSMQNRGLWQASFDAFFRLLTEYCM  843


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = -2

Query  559  CLFQTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQR  380
              F+   E    +FD+++  V         + P  A AI+ E+PVELLRASLPHTNE QR
Sbjct  833  AFFRLLTEYCMSRFDSVVHTVQ--------MQPSAAAAISREIPVELLRASLPHTNENQR  884

Query  379  KMLMNFGQGSIPL  341
            K L+NF Q ++P+
Sbjct  885  KQLLNFAQRTVPI  897



>ref|XP_002868239.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44498.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score = 53.9 bits (128),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++         S  N  LW+ASFD FF LLTKYC
Sbjct  654  IGSPSGDGASVVLVSLLERAAEVVAVAVVPPRVSNSNDGLWRASFDEFFSLLTKYC  709


 Score = 47.4 bits (111),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPLA  338
            AI  EMP ELLRASL HTNE QR  L+N G+ + P++
Sbjct  731  AIKREMPAELLRASLRHTNENQRNFLLNVGRSASPVS  767



>ref|NP_001046606.2| Os02g0294700 [Oryza sativa Japonica Group]
 dbj|BAD22175.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08520.2| Os02g0294700 [Oryza sativa Japonica Group]
Length=657

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS I KSVL+ A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+
Sbjct  521  LGHAAGDGASFIIKSVLDTATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCM  577


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 16/99 (16%)
 Frame = -2

Query  559  CLFQTSY--------EILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S+        E    KFD+++ A+ QT+       P VA  I  EMPVELLRASL
Sbjct  559  ALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------PAVAAVIGREMPVELLRASL  610

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK L+ F Q ++P+   +S G S+  + +ES+
Sbjct  611  PHTNEYQRKQLLGFAQRTVPVNNHSSHGSSNGPMTSESI  649



>emb|CDY39512.1| BnaA01g24760D [Brassica napus]
Length=774

 Score = 52.8 bits (125),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++ +     +       LW+ASFD FF LLTKYC
Sbjct  633  IGSSAGDGASVVLISLLERAAEVVVEVPPRVNHD----GLWRASFDEFFNLLTKYC  684


 Score = 48.9 bits (115),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 6/57 (11%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ---GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRAS+ HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  706  AIKREMPAELLRASIRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  759



>ref|XP_003568134.1| PREDICTED: uncharacterized protein LOC100841028 [Brachypodium 
distachyon]
Length=805

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
             GS AGDGASLI KSVL+RA+ LL DP +A  +S    +LWQASFDAFF LLTKYC
Sbjct  668  FGSSAGDGASLIIKSVLDRATELLADPHSAADYSRSTRSLWQASFDAFFGLLTKYC  723


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 9/99 (9%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+ +I+Q  +   +++   S E ++A++ EMPVELLRASLP
Sbjct  707  LWQASFDAFFGLLTKYCDSKYGSILQMFSMQGSNSTARS-EASKAVSREMPVELLRASLP  765

Query  400  HTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESVS  284
            HTNE QR+ML+ F + S+P+ GFN  G SS    +ESV+
Sbjct  766  HTNEQQRQMLLGFARKSMPVTGFNHSGTSSGHFTSESVA  804



>ref|XP_009108988.1| PREDICTED: uncharacterized protein LOC103834665 isoform X2 [Brassica 
rapa]
Length=773

 Score = 52.4 bits (124),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++ +     +       LW+ASFD FF LLTKYC
Sbjct  632  IGSSAGDGASVVLISLLERAAEVVVEVPPRVNHD----GLWRASFDEFFNLLTKYC  683


 Score = 48.9 bits (115),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 6/57 (11%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGS---IPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRAS+ HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  705  AIKREMPAELLRASIRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  758



>ref|XP_009108983.1| PREDICTED: uncharacterized protein LOC103834665 isoform X1 [Brassica 
rapa]
Length=774

 Score = 52.4 bits (124),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++ +     +       LW+ASFD FF LLTKYC
Sbjct  633  IGSSAGDGASVVLISLLERAAEVVVEVPPRVNHD----GLWRASFDEFFNLLTKYC  684


 Score = 48.9 bits (115),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 6/57 (11%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGS---IPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRAS+ HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  706  AIKREMPAELLRASIRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  759



>gb|EAZ22672.1| hypothetical protein OsJ_06342 [Oryza sativa Japonica Group]
Length=898

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS I KSVL+ A+ LLTD   A+++SM N ALWQASFDAFF LLT+YC+
Sbjct  762  LGHAAGDGASFIIKSVLDTATELLTDQHVASTYSMQNRALWQASFDAFFGLLTEYCM  818


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 16/99 (16%)
 Frame = -2

Query  559  CLFQTSY--------EILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASL  404
             L+Q S+        E    KFD+++ A+ QT+       P VA  I  EMPVELLRASL
Sbjct  800  ALWQASFDAFFGLLTEYCMSKFDSVIHAL-QTQ-------PAVAAVIGREMPVELLRASL  851

Query  403  PHTNELQRKMLMNFGQGSIPLAGFNSRGGSSRKINAESV  287
            PHTNE QRK L+ F Q ++P+   +S G S+  + +ES+
Sbjct  852  PHTNEYQRKQLLGFAQRTVPVNNHSSHGSSNGPMTSESI  890



>ref|XP_001783364.1| predicted protein [Physcomitrella patens]
 gb|EDQ51809.1| predicted protein [Physcomitrella patens]
Length=439

 Score = 59.7 bits (143),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 4/58 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPA-LWQASFDAFFKLLTKYCV  526
            +G+PAGDGA++I +S+LE+AS    D    + F  P    +WQ +FDAFF LLTKYC 
Sbjct  301  MGAPAGDGATVILRSLLEKASMARRD---RHVFQTPQSVTIWQHAFDAFFTLLTKYCT  355


 Score = 41.6 bits (96),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  523  KFDNIMQAVAQ-TETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+++ ++      +   I+     A+  E+PVELL+A+LPHT+E QRK+L + 
Sbjct  357  KYDSVVHSLMMLYPGNIPAINAAADEALKKEIPVELLQATLPHTSEQQRKLLYDL  411



>ref|XP_002441360.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
 gb|EES19790.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
Length=802

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            LGS AGDGAS++ KSVL+RA+ LL DP +A ++S    +LWQASFDAFF LLTKYC
Sbjct  666  LGSAAGDGASVVIKSVLDRATVLLADPHSAANYSRSARSLWQASFDAFFGLLTKYC  721


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 62/101 (61%), Gaps = 16/101 (16%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  K+++I+Q  A  + S  +  PE  +A++ EMPVELLRASLP
Sbjct  705  LWQASFDAFFGLLTKYCDSKYESIVQRFA-MQGSNSMGGPETTKAVSREMPVELLRASLP  763

Query  400  HTNELQRKMLMNFGQGSIPLAGFN---SRGGSSRKINAESV  287
            HTNE  R+ L++F + S  ++GF+   SRG     IN+ESV
Sbjct  764  HTNEQHRQTLLDFARKSTHVSGFSPNASRG----LINSESV  800



>ref|XP_010459204.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=768

 Score = 57.4 bits (137),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD +++I K+ L+RAS LL+    AN+++     LW+ASFD FF LL K+C+
Sbjct  650  LGSPVGDESTIILKTALDRASELLS----ANNYNNAGMNLWRASFDEFFNLLMKHCI  702


 Score = 43.9 bits (102),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQT---ETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +        +T+ +S   A+AI  EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  704  KYDSIMQNLNSQLLPHFATE-MSDAAAQAIVREMPIELLRASFPHISDEQKRILLEF  759



>ref|XP_002890176.1| hypothetical protein ARALYDRAFT_889054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66435.1| hypothetical protein ARALYDRAFT_889054 [Arabidopsis lyrata subsp. 
lyrata]
Length=770

 Score = 57.4 bits (137),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD A++I KS L+RA+ LL     AN+++     LW+ASFD FF LL K+C+
Sbjct  648  LGSPVGDEATIILKSALDRATELLR----ANNYNNAGMNLWRASFDEFFNLLMKHCI  700


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQT---ETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +        +T+ +S   A+AI  EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  702  KYDSIMQNLNSQLPPHFATE-MSEAAAQAIVREMPIELLRASFPHISDEQKRILVEF  757



>gb|KJB82134.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=562

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS I K VL+RA+ L+TD +A   +++ N +LW+ASFD FF LLTKYCV
Sbjct  455  LGSPTGDGASFILKCVLDRATKLVTDFKAGGDYNISNQSLWKASFDEFFNLLTKYCV  511



>ref|XP_010440363.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 50.1 bits (118),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  341
            AI  EMP ELLRASL HTNE QR  L+NFG+ + P+
Sbjct  739  AIKREMPAELLRASLRHTNEDQRNFLLNFGRRASPV  774


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSM-PNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++    A    S   N  LW+ASFD FF LLTKYC
Sbjct  661  IGSPSGDGASVVLVSLLERAAEVVVVVAAVPRVSNNSNDGLWRASFDEFFSLLTKYC  717



>ref|XP_010496132.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=796

 Score = 50.1 bits (118),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  341
            AI  EMP ELLRASL HTNE QR  L+NFG+ + P+
Sbjct  740  AIKREMPAELLRASLRHTNEDQRNFLLNFGRRASPV  775


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSM-PNPALWQASFDAFFKLLTKYC  529
            +GSPAGDGAS++  S+LERA+ ++    A    +   N  LW+ASFD FF LLTKYC
Sbjct  662  IGSPAGDGASVVLVSLLERAAEVVVVVAAVPRVNNNSNDGLWRASFDEFFSLLTKYC  718



>gb|KJB12766.1| hypothetical protein B456_002G0357002, partial [Gossypium raimondii]
Length=104

 Score = 50.4 bits (119),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  639  ASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            A+ L+TD  AA +++  N +LW+ASFD FF LLTKYC+
Sbjct  1    ATKLMTDSSAAGNYNTTNLSLWKASFDEFFNLLTKYCI  38


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  523  KFDNIMQAV-AQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQ  356
            K+D +MQ++  Q + +  +   + A+AI  EMPV+LL A LPH N+ Q+K L++  Q
Sbjct  40   KYDTVMQSLRMQAKPNMAIDESDSAKAIKREMPVDLLHACLPHLNDQQKKQLLDLSQ  96



>ref|XP_009145394.1| PREDICTED: uncharacterized protein LOC103869095 [Brassica rapa]
Length=791

 Score = 52.4 bits (124),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   ++  +  ++RGG   +IN+ESV
Sbjct  737  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAVSESASHARGG---QINSESV  789


 Score = 46.6 bits (109),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 8/62 (13%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTD------PQAANSFSMPNPALWQASFDAFFKLLTK  535
            +GS +GDGAS++  S+LERA+ ++        P+AA+  S  N  LW+ASF+ FF LLTK
Sbjct  656  IGSSSGDGASVVLISLLERAAEVVRAAEVVVGPRAAHGSS--NDGLWRASFNEFFNLLTK  713

Query  534  YC  529
            YC
Sbjct  714  YC  715



>emb|CDY35105.1| BnaA06g11150D [Brassica napus]
Length=551

 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD A++I K  L+RA+ LL     AN ++     LW+ASFD FF LL K+C+
Sbjct  428  LGSPVGDEATVILKCALDRAAELLR----ANHYNNAGMNLWRASFDEFFNLLMKHCI  480


 Score = 42.4 bits (98),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDV---ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +  ++ S      ++   A+AI  EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  482  KYDSIMQNL-NSQLSPHFGAEMTEAAAQAIVREMPIELLRASFPHISDEQKRILVEF  537



>emb|CDY10630.1| BnaA05g17320D [Brassica napus]
Length=765

 Score = 52.8 bits (125),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQ--GSIPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRASL HTN+ QR  L+NFG+   ++  +  ++RGG   +IN+ESV
Sbjct  711  AIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAVSESASHARGG---QINSESV  763


 Score = 46.2 bits (108),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = -3

Query  654  SVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            S+LERA+ ++  P+A +  S  N  LW+ASF+ FF LLTKYC
Sbjct  650  SLLERAAEVVVVPRAVHGSS--NDGLWRASFNEFFNLLTKYC  689



>ref|XP_010692206.1| PREDICTED: protein PAT1 homolog 1 [Beta vulgaris subsp. vulgaris]
Length=784

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            +GS AGDGAS++ KSVL+RA+ LL D  A +S++M N A WQASFD FF LL KYC+   
Sbjct  654  IGSSAGDGASVVLKSVLDRAAELLRDAHAGSSYNMANSAFWQASFDEFFNLLLKYCLNKY  713

Query  516  II*CKQLHRQ  487
             I  + +  Q
Sbjct  714  DIIVQPMQMQ  723


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            K+D I+Q +         ++ +VA+AI  EMPVELLRASLPHT+E QRK+L++    S+P
Sbjct  712  KYDIIVQPMQMQGLPN--LATDVAKAIKKEMPVELLRASLPHTSEHQRKLLLDLAHRSVP  769

Query  343  LAGFNSRGGS  314
            L G  + GG+
Sbjct  770  LVGSGAHGGN  779



>ref|XP_008655297.1| PREDICTED: uncharacterized protein LOC100383823 isoform X1 [Zea 
mays]
 gb|AFW80455.1| hypothetical protein ZEAMMB73_854795 [Zea mays]
Length=812

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCVVNL  517
            LG  AGDGA+++ K+VL+RA+ LLT+  AA  +  PN ALWQASF+AFF LLTKYC+   
Sbjct  694  LGHAAGDGATVVIKAVLDRATELLTEQPAAPDYGAPNRALWQASFNAFFGLLTKYCMSKF  753

Query  516  II*CKQLHR  490
                  +H+
Sbjct  754  DSMVHTMHK  762


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 7/68 (10%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRKMLMNFGQGSIP  344
            KFD+++  + +       +    A AI  E+PVELLRASLPHT+E QR++L+ F Q ++P
Sbjct  752  KFDSMVHTMHK-------LGAAAATAIRKELPVELLRASLPHTDEQQRRLLLEFAQRTVP  804

Query  343  LAGFNSRG  320
            ++G  S G
Sbjct  805  VSGHGSDG  812



>ref|XP_010435003.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 50.1 bits (118),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGSIPL  341
            AI  EMP ELLRASL HTNE QR  L+NFG+ + P+
Sbjct  739  AIKREMPAELLRASLRHTNEDQRNFLLNFGRRASPV  774


 Score = 48.1 bits (113),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSM-PNPALWQASFDAFFKLLTKYC  529
            +GSP+GDGAS++  S+LERA+ ++    A    +   N  LW+ASFD FF LLTKYC
Sbjct  661  IGSPSGDGASVVLVSLLERAAEVVVVVAAVPRVNNNSNDGLWRASFDEFFSLLTKYC  717



>gb|EMT27507.1| hypothetical protein F775_52260 [Aegilops tauschii]
Length=806

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I KS+L+RA+ LLTD   A+++SM N  LWQASFDAFF LL  YC+
Sbjct  676  LGYAAGDGASVIIKSLLDRATELLTDQHVASAYSMQNRTLWQASFDAFFGLLMGYCM  732


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 16/79 (20%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  KFD ++  V         + P  A  I+ E PVELLRASLP
Sbjct  715  LWQASFDAFFGLLMGYCMSKFDTVVHTVQ--------MQPAAAAVISRETPVELLRASLP  766

Query  400  HTNELQRKMLMNFGQGSIP  344
            HTNE QRK L++F Q ++P
Sbjct  767  HTNEYQRKQLLSFAQRTVP  785



>emb|CDY40046.1| BnaC05g12690D [Brassica napus]
Length=761

 Score = 55.1 bits (131),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD A++I K  L+RA+ LL     AN ++     LW+ASFD FF LL K+C+
Sbjct  638  LGSPVGDEATVILKCALDRAAELLR----ANHYNNAGMNLWRASFDEFFNLLMKHCI  690


 Score = 42.4 bits (98),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDV---ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +  ++ S      ++   A+AI  EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  692  KYDSIMQNL-NSQLSPHFGAEMTEAAAQAIVREMPIELLRASFPHISDEQKRILVEF  747



>ref|XP_009149098.1| PREDICTED: protein PAT1 homolog 1-like [Brassica rapa]
Length=764

 Score = 55.1 bits (131),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD A++I K  L+RA+ LL     AN ++     LW+ASFD FF LL K+C+
Sbjct  641  LGSPVGDEATVILKCALDRAAELLR----ANHYNNAGMNLWRASFDEFFNLLMKHCI  693


 Score = 42.4 bits (98),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -2

Query  523  KFDNIMQAVAQTETSTDV---ISPEVARAINSEMPVELLRASLPHTNELQRKMLMNF  362
            K+D+IMQ +  ++ S      ++   A+AI  EMP+ELLRAS PH ++ Q+++L+ F
Sbjct  695  KYDSIMQNL-NSQLSPHFGAEMTEAAAQAIVREMPIELLRASFPHISDEQKRILVEF  750



>gb|EMS67142.1| hypothetical protein TRIUR3_06605 [Triticum urartu]
Length=698

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LG  AGDGAS+I KS+L+RA+ LLTD   A+++SM N  LWQASFDAFF LL  YC+
Sbjct  568  LGYAAGDGASVIIKSLLDRATELLTDQHVASAYSMQNRTLWQASFDAFFGLLMGYCM  624


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (56%), Gaps = 16/79 (20%)
 Frame = -2

Query  556  LFQTSYEIL-------C-CKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLP  401
            L+Q S++         C  KFD ++  V         I P  A  I+ E PVELLRASLP
Sbjct  607  LWQASFDAFFGLLMGYCMSKFDTVVHTVQ--------IQPAAAAVISRETPVELLRASLP  658

Query  400  HTNELQRKMLMNFGQGSIP  344
            HTNE QRK L++F Q ++P
Sbjct  659  HTNEYQRKQLLSFAQRTVP  677



>ref|XP_010684289.1| PREDICTED: uncharacterized protein LOC104898860 [Beta vulgaris 
subsp. vulgaris]
Length=844

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 13/96 (14%)
 Frame = -2

Query  553  FQTSYEIL---CC-KFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNEL  386
            F T + +L   C  K+D I+Q+ ++  +S      E ARAI  EMPVELLRASLPHT+E 
Sbjct  753  FTTFFTLLTKYCVSKYDTIIQSNSEFSSS------EAARAIRREMPVELLRASLPHTDEH  806

Query  385  QRKMLMNFGQGSIPLA--GFNSRG-GSSRKINAESV  287
            QR+MLM+F   SIP +  GFN R   +S  I +ESV
Sbjct  807  QRRMLMDFAHQSIPFSGTGFNLRDEENSGWITSESV  842


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLT-DPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GD AS+I KS+LERA+ L   +PQ+  S ++P+   W+ASF  FF LLTKYCV
Sbjct  708  LGSPTGDLASVILKSLLERATVLTKPNPQSPGSCNIPHYNFWKASFTTFFTLLTKYCV  765



>emb|CDY46332.1| BnaC01g31660D [Brassica napus]
Length=774

 Score = 48.5 bits (114),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 6/57 (11%)
 Frame = -2

Query  448  AINSEMPVELLRASLPHTNELQRKMLMNFGQGS---IPLAGFNSRGGSSRKINAESV  287
            AI  EMP ELLRAS+ HT++ QR  L+NFG+     I  +  ++RGG   +IN+ESV
Sbjct  706  AIKREMPAELLRASIRHTSDDQRNYLLNFGRKPSAIISESASHARGG---QINSESV  759


 Score = 45.1 bits (105),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++       +       LW+ASFD FF LLTKYC
Sbjct  633  IGSSAGDGASVVLISLLERAAEVVVVVPPRVNHD----GLWRASFDEFFNLLTKYC  684



>gb|EPS71565.1| hypothetical protein M569_03193, partial [Genlisea aurea]
Length=420

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  684  AGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GDGAS+I KSVL+RA+ LLTDP  A+  S    + WQASFDAFF +LTKYC
Sbjct  302  SGDGASVILKSVLQRATELLTDPLHASDCSPSIRSFWQASFDAFFGVLTKYC  353


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = -2

Query  553  FQTSYEILCCKFDNIMQAVAQTE-------TSTDVISPEVARAINSEMPVELLRASLPHT  395
            F   + +L     NI  AV +T           D + PEVA+    EMPVELLRASLPHT
Sbjct  342  FDAFFGVLTKYCFNIYDAVMRTVLVHQGPLEEADSVGPEVAKTARKEMPVELLRASLPHT  401

Query  394  NELQRKMLMNFGQGSI  347
            NE QRK+L+ F Q S+
Sbjct  402  NEQQRKLLLEFTQRSM  417



>gb|KFK42288.1| hypothetical protein AALP_AA2G236100 [Arabis alpina]
Length=798

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS L+RAS LL     ANSF+    ALW+ASF+ FF LL KYC+
Sbjct  678  LGSPVGDGASTVLKSTLDRASELLQ----ANSFNNAGMALWRASFNEFFNLLMKYCI  730



>gb|AEN81988.1| AT3G22270-like protein, partial [Capsella grandiflora]
Length=185

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  107  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  160



>gb|AEN81985.1| AT3G22270-like protein, partial [Capsella grandiflora]
 gb|AEN81986.1| AT3G22270-like protein, partial [Capsella grandiflora]
 gb|AEN81989.1| AT3G22270-like protein, partial [Capsella grandiflora]
Length=185

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  107  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  160



>gb|AEN81987.1| AT3G22270-like protein, partial [Capsella grandiflora]
 gb|AEN81992.1| AT3G22270-like protein, partial [Capsella rubella]
 gb|AEN81993.1| AT3G22270-like protein, partial [Capsella rubella]
 gb|AEN81994.1| AT3G22270-like protein, partial [Capsella rubella]
 gb|AEN81995.1| AT3G22270-like protein, partial [Capsella rubella]
 gb|AEN81996.1| AT3G22270-like protein, partial [Capsella rubella]
 gb|AEN81997.1| AT3G22270-like protein, partial [Capsella rubella]
Length=185

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  107  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  160



>gb|AEN81990.1| AT3G22270-like protein, partial [Capsella rubella]
 gb|AEN81991.1| AT3G22270-like protein, partial [Capsella rubella]
Length=185

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYC  529
            +GS AGDGAS++  S+LERA+ ++  P+  +  S  N  LW+ASFD FF LLTKYC
Sbjct  107  IGSSAGDGASVVLISLLERAAEVVVVPRVMHGNS--NDGLWRASFDEFFNLLTKYC  160



>ref|XP_006300753.1| hypothetical protein CARUB_v10019819mg [Capsella rubella]
 gb|EOA33651.1| hypothetical protein CARUB_v10019819mg [Capsella rubella]
Length=799

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS I KS L+RAS L+     AN+F+    ALW+ASF+ FF LL KYCV
Sbjct  674  LGSPVGDGASTILKSALDRASELIR----ANNFNNAGMALWRASFNEFFNLLMKYCV  726



>emb|CDX79293.1| BnaC06g20100D [Brassica napus]
Length=787

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS L+RAS LL     AN+F+    ALW+ASF+ FF LL +YC+
Sbjct  662  LGSPVGDGASTVLKSTLDRASELLR----ANNFNNAGMALWRASFNEFFNLLMRYCI  714



>ref|XP_009104546.1| PREDICTED: protein PAT1 homolog 1-like [Brassica rapa]
Length=781

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS L+RAS LL     AN+F+    ALW+ASF+ FF LL +YC+
Sbjct  656  LGSPVGDGASTVLKSTLDRASELLR----ANNFNNAGMALWRASFNEFFNLLMRYCI  708



>ref|NP_565199.1| uncharacterized protein  [Arabidopsis thaliana]
 ref|NP_849904.1| uncharacterized protein  [Arabidopsis thaliana]
 dbj|BAF00945.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH56808.1| AT1G79090 [Arabidopsis thaliana]
 gb|AEE36202.1| uncharacterized protein AT1G79090 [Arabidopsis thaliana]
 gb|AEE36203.1| uncharacterized protein AT1G79090 [Arabidopsis thaliana]
Length=793

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS+L+RAS L+     AN+F+    ALW+ASF+ FF +L +YC+
Sbjct  670  LGSPVGDGASTVLKSILDRASELIR----ANNFNNAGIALWRASFNEFFNMLMRYCI  722


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  556  LFQTSYEILCCKFDNIMQAVAQTETSTDVISPEVARAINSEMPVELLRASLPHTNELQRK  377
             F         K+D+IMQ++         IS E A+AI  EMP+ELLR+S PH +E Q++
Sbjct  713  FFNMLMRYCISKYDSIMQSLQLPPHFATEISEEAAKAIVREMPIELLRSSFPHIDEQQKR  772

Query  376  MLMNF  362
            +LM F
Sbjct  773  ILMEF  777



>emb|CDX68009.1| BnaA07g20490D [Brassica napus]
Length=781

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  696  LGSPAGDGASLIXKSVLERASYLLTDPQAANSFSMPNPALWQASFDAFFKLLTKYCV  526
            LGSP GDGAS + KS L+RAS LL     AN+F+    ALW+ASF+ FF LL +YC+
Sbjct  656  LGSPVGDGASTVLKSTLDRASELLR----ANNFNNAGMALWRASFNEFFNLLMRYCI  708



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160