BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024B21

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228627.1|  PREDICTED: uncharacterized oxidoreductase C2...    371   1e-124   Solanum lycopersicum
ref|XP_006348416.1|  PREDICTED: uncharacterized protein YMR315W-like    370   4e-124   Solanum tuberosum [potatoes]
ref|XP_009588958.1|  PREDICTED: uncharacterized protein YMR315W         369   7e-124   Nicotiana tomentosiformis
ref|XP_009773348.1|  PREDICTED: uncharacterized protein LOC104223588    367   4e-123   Nicotiana sylvestris
gb|KDP20201.1|  hypothetical protein JCGZ_07921                         356   1e-118   Jatropha curcas
emb|CDP14087.1|  unnamed protein product                                350   3e-116   Coffea canephora [robusta coffee]
ref|XP_002513445.1|  oxidoreductase, putative                           349   4e-116   Ricinus communis
ref|XP_006445974.1|  hypothetical protein CICLE_v10015756mg             345   2e-114   Citrus clementina [clementine]
ref|XP_006494722.1|  PREDICTED: uncharacterized protein YMR315W-like    345   2e-114   Citrus sinensis [apfelsine]
ref|XP_011025252.1|  PREDICTED: uncharacterized protein YMR315W i...    344   6e-114   Populus euphratica
ref|XP_002285606.1|  PREDICTED: uncharacterized protein LOC100245...    343   1e-113   Vitis vinifera
emb|CBI16434.3|  unnamed protein product                                343   1e-113   Vitis vinifera
ref|XP_011080243.1|  PREDICTED: uncharacterized protein LOC105163544    341   7e-113   Sesamum indicum [beniseed]
ref|XP_011025251.1|  PREDICTED: uncharacterized protein YMR315W i...    339   4e-112   Populus euphratica
ref|XP_006386094.1|  hypothetical protein POPTR_0003s22050g             338   6e-112   Populus trichocarpa [western balsam poplar]
ref|XP_008243595.1|  PREDICTED: uncharacterized protein YMR315W         336   9e-111   Prunus mume [ume]
ref|XP_011461910.1|  PREDICTED: uncharacterized protein YMR315W         336   9e-111   Fragaria vesca subsp. vesca
ref|XP_006386095.1|  hypothetical protein POPTR_0003s22050g             334   5e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010031848.1|  PREDICTED: uncharacterized protein YMR315W         333   1e-109   Eucalyptus grandis [rose gum]
ref|XP_004162028.1|  PREDICTED: uncharacterized LOC101204258            325   3e-108   
ref|XP_010257400.1|  PREDICTED: uncharacterized protein LOC104597...    329   5e-108   Nelumbo nucifera [Indian lotus]
ref|XP_009364727.1|  PREDICTED: uncharacterized protein LOC103954617    328   6e-108   Pyrus x bretschneideri [bai li]
ref|XP_009364714.1|  PREDICTED: uncharacterized protein LOC103954601    328   6e-108   Pyrus x bretschneideri [bai li]
gb|ABK96297.1|  unknown                                                 329   6e-108   Populus trichocarpa x Populus deltoides
ref|XP_010257399.1|  PREDICTED: uncharacterized protein LOC104597...    329   6e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010257398.1|  PREDICTED: uncharacterized protein LOC104597...    329   7e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010091995.1|  Uncharacterized protein L484_007981                328   1e-107   
ref|XP_009145584.1|  PREDICTED: uncharacterized protein YMR315W         327   2e-107   Brassica rapa
ref|XP_008358864.1|  PREDICTED: uncharacterized protein YMR315W-l...    326   4e-107   Malus domestica [apple tree]
ref|XP_008449757.1|  PREDICTED: uncharacterized protein YMR315W         326   4e-107   
ref|XP_008358862.1|  PREDICTED: uncharacterized protein YMR315W-l...    326   5e-107   Malus domestica [apple tree]
gb|KFK39395.1|  hypothetical protein AALP_AA3G239500                    325   2e-106   Arabis alpina [alpine rockcress]
ref|XP_006406349.1|  hypothetical protein EUTSA_v10021019mg             324   2e-106   Eutrema salsugineum [saltwater cress]
gb|AFK46300.1|  unknown                                                 323   8e-106   Lotus japonicus
ref|XP_003543553.1|  PREDICTED: uncharacterized protein YMR315W         322   1e-105   Glycine max [soybeans]
ref|XP_006298014.1|  hypothetical protein CARUB_v10014059mg             321   6e-105   
ref|XP_010488066.1|  PREDICTED: glucose-fructose oxidoreductase d...    320   1e-104   Camelina sativa [gold-of-pleasure]
ref|NP_188715.2|  NAD(P)-binding Rossmann-fold superfamily protein      320   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KJB66097.1|  hypothetical protein B456_010G128200                    319   3e-104   Gossypium raimondii
ref|XP_004486934.1|  PREDICTED: uncharacterized protein YMR315W-like    319   3e-104   Cicer arietinum [garbanzo]
ref|XP_010913917.1|  PREDICTED: uncharacterized protein LOC105039...    319   5e-104   Elaeis guineensis
gb|KJB66094.1|  hypothetical protein B456_010G128200                    316   6e-104   Gossypium raimondii
ref|XP_003597479.1|  Oxidoreductase, putative                           317   1e-103   Medicago truncatula
ref|XP_007150403.1|  hypothetical protein PHAVU_005G150400g             318   2e-103   Phaseolus vulgaris [French bean]
ref|XP_010466287.1|  PREDICTED: uncharacterized protein LOC104746495    312   3e-103   Camelina sativa [gold-of-pleasure]
gb|KJB66101.1|  hypothetical protein B456_010G128200                    313   4e-103   Gossypium raimondii
ref|XP_010544236.1|  PREDICTED: uncharacterized protein YMR315W i...    316   4e-103   Tarenaya hassleriana [spider flower]
ref|XP_010509356.1|  PREDICTED: glucose-fructose oxidoreductase d...    316   4e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010544235.1|  PREDICTED: uncharacterized protein YMR315W i...    316   6e-103   Tarenaya hassleriana [spider flower]
gb|KJB66099.1|  hypothetical protein B456_010G128200                    315   1e-102   Gossypium raimondii
gb|KJB66096.1|  hypothetical protein B456_010G128200                    315   2e-102   Gossypium raimondii
gb|KHG07862.1|  Uncharacterized protein F383_13730                      312   1e-101   Gossypium arboreum [tree cotton]
ref|XP_008787293.1|  PREDICTED: uncharacterized protein LOC103705381    313   1e-101   Phoenix dactylifera
ref|XP_010673579.1|  PREDICTED: uncharacterized protein YMR315W i...    312   2e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002459955.1|  hypothetical protein SORBIDRAFT_02g018670          312   2e-101   Sorghum bicolor [broomcorn]
ref|XP_010673578.1|  PREDICTED: uncharacterized protein YMR315W i...    311   3e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001062764.1|  Os09g0280300                                       311   3e-101   
ref|XP_002883268.1|  oxidoreductase family protein                      310   9e-101   
ref|XP_004956459.1|  PREDICTED: uncharacterized protein YMR315W-like    310   1e-100   Setaria italica
ref|XP_009385566.1|  PREDICTED: glucose-fructose oxidoreductase d...    310   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007014899.1|  Oxidoreductase, putative isoform 1                 309   2e-100   
gb|KJB66095.1|  hypothetical protein B456_010G128200                    308   4e-100   Gossypium raimondii
gb|KJB66098.1|  hypothetical protein B456_010G128200                    308   6e-100   Gossypium raimondii
ref|XP_006660493.1|  PREDICTED: uncharacterized protein YMR315W-like    308   8e-100   Oryza brachyantha
ref|NP_001149836.1|  NAD-dependent dyhydrogenase, Gfo/Idh/MocA fa...    306   3e-99    Zea mays [maize]
ref|XP_003577920.1|  PREDICTED: uncharacterized protein LOC100827110    306   6e-99    Brachypodium distachyon [annual false brome]
emb|CDY19604.1|  BnaA05g20120D                                          305   1e-98    Brassica napus [oilseed rape]
ref|XP_008668038.1|  PREDICTED: NAD-dependent dyhydrogenase, Gfo/...    305   2e-98    Zea mays [maize]
emb|CDY06381.1|  BnaC05g31490D                                          304   2e-98    
gb|EMT01460.1|  hypothetical protein F775_26364                         300   8e-97    
ref|XP_007205433.1|  hypothetical protein PRUPE_ppa007778mg             298   5e-96    
gb|EEE69341.1|  hypothetical protein OsJ_28659                          294   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006850072.1|  hypothetical protein AMTR_s00022p00213490          293   5e-94    
emb|CAN75498.1|  hypothetical protein VITISV_020272                     289   2e-92    Vitis vinifera
ref|XP_010651283.1|  PREDICTED: uncharacterized protein LOC100245...    286   6e-92    Vitis vinifera
gb|EYU18011.1|  hypothetical protein MIMGU_mgv1a008840mg                285   5e-91    Erythranthe guttata [common monkey flower]
ref|XP_011090402.1|  PREDICTED: uncharacterized protein YMR315W-like    280   5e-89    Sesamum indicum [beniseed]
gb|EPS68382.1|  hypothetical protein M569_06387                         276   1e-87    Genlisea aurea
ref|XP_010913920.1|  PREDICTED: uncharacterized protein LOC105039...    275   3e-87    Elaeis guineensis
gb|KJB66100.1|  hypothetical protein B456_010G128200                    264   5e-85    Gossypium raimondii
ref|XP_007014900.1|  Oxidoreductase, putative isoform 2                 265   3e-83    
gb|AFK42402.1|  unknown                                                 254   3e-81    Lotus japonicus
ref|XP_010651284.1|  PREDICTED: uncharacterized protein LOC100245...    232   7e-71    
ref|XP_001762266.1|  predicted protein                                  233   9e-71    
gb|EYU46305.1|  hypothetical protein MIMGU_mgv1a0096472mg               224   4e-70    Erythranthe guttata [common monkey flower]
gb|KGN54118.1|  hypothetical protein Csa_4G286420                       213   1e-65    
ref|XP_006445973.1|  hypothetical protein CICLE_v10015756mg             208   3e-62    
gb|KCW51233.1|  hypothetical protein EUGRSUZ_J00813                     207   7e-62    Eucalyptus grandis [rose gum]
ref|XP_002969664.1|  hypothetical protein SELMODRAFT_92921              207   5e-61    
ref|XP_002976631.1|  hypothetical protein SELMODRAFT_416506             203   2e-59    Selaginella moellendorffii
ref|XP_002973220.1|  hypothetical protein SELMODRAFT_413759             203   3e-59    
ref|XP_001754780.1|  predicted protein                                  201   2e-58    
ref|XP_002981277.1|  hypothetical protein SELMODRAFT_114540             197   3e-57    
ref|XP_002973823.1|  hypothetical protein SELMODRAFT_414190             185   2e-52    
dbj|BAB02487.1|  unnamed protein product                                174   3e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001776337.1|  predicted protein                                  174   4e-48    
ref|XP_004142242.1|  PREDICTED: uncharacterized LOC101204258            151   1e-40    
gb|ACU17312.1|  unknown                                                 139   6e-36    Glycine max [soybeans]
ref|XP_006445972.1|  hypothetical protein CICLE_v10015756mg             122   8e-30    
gb|KEQ84242.1|  NAD(P)-binding protein                                  115   3e-26    Aureobasidium pullulans EXF-150
gb|KEH18356.1|  NAD(P)-binding rossmann-fold protein, putative          105   1e-24    Medicago truncatula
gb|KEH18355.1|  NAD(P)-binding rossmann-fold protein, putative          105   2e-24    Medicago truncatula
gb|KEQ74017.1|  NAD(P)-binding protein                                  110   2e-24    Aureobasidium namibiae CBS 147.97
gb|KEQ61018.1|  oxidoreductase-like protein family                      110   2e-24    Aureobasidium melanogenum CBS 110374
gb|KEQ94380.1|  hypothetical protein AUEXF2481DRAFT_270651              106   3e-23    Aureobasidium subglaciale EXF-2481
ref|XP_001942427.1|  conserved hypothetical protein                     105   1e-22    Pyrenophora tritici-repentis Pt-1C-BFP
gb|KDQ06959.1|  hypothetical protein BOTBODRAFT_60302                   105   1e-22    Botryobasidium botryosum FD-172 SS1
gb|EFQ28397.1|  oxidoreductase family protein                           102   8e-22    Colletotrichum graminicola M1.001
emb|CDY27562.1|  BnaC01g32450D                                        99.8    1e-21    Brassica napus [oilseed rape]
ref|XP_007785079.1|  hypothetical protein W97_09025                     102   1e-21    Coniosporium apollinis CBS 100218
emb|CCF43203.1|  oxidoreductase                                         101   2e-21    Colletotrichum higginsianum
gb|EMD87949.1|  hypothetical protein COCHEDRAFT_1183091                 100   5e-21    Bipolaris maydis C5
ref|XP_007713573.1|  hypothetical protein COCCADRAFT_99511            99.4    1e-20    Bipolaris zeicola 26-R-13
ref|XP_007603283.1|  oxidoreductase                                   99.4    1e-20    
gb|EPS29944.1|  hypothetical protein PDE_04894                        98.6    2e-20    Penicillium oxalicum 114-2
ref|XP_003300258.1|  hypothetical protein PTT_11448                   96.7    8e-20    
gb|ENH79899.1|  oxidoreductase nad-binding rossmann fold protein      95.9    2e-19    
ref|XP_007699535.1|  hypothetical protein COCSADRAFT_89105            95.9    2e-19    Bipolaris sorokiniana ND90Pr
gb|EUN24448.1|  hypothetical protein COCVIDRAFT_106168                95.9    2e-19    Bipolaris victoriae FI3
ref|XP_008025728.1|  hypothetical protein SETTUDRAFT_135946           95.5    2e-19    Exserohilum turcica Et28A
gb|EWC48565.1|  hypothetical protein DRE_01787                        94.7    4e-19    Drechslerella stenobrocha 248
ref|XP_011117421.1|  hypothetical protein AOL_s00004g470              94.7    4e-19    Arthrobotrys oligospora ATCC 24927
gb|EPS32813.1|  hypothetical protein PDE_07773                        94.4    4e-19    Penicillium oxalicum 114-2
ref|XP_007686203.1|  hypothetical protein COCMIDRAFT_90481            94.0    8e-19    Bipolaris oryzae ATCC 44560
ref|XP_001935897.1|  conserved hypothetical protein                   93.2    1e-18    Pyrenophora tritici-repentis Pt-1C-BFP
gb|KEZ45810.1|  Oxidoreductase-like protein                           93.2    1e-18    Scedosporium apiospermum
ref|XP_007275100.1|  oxidoreductase nad-binding rossmann fold pro...  93.2    1e-18    
gb|EQB57311.1|  hypothetical protein CGLO_02580                       92.4    2e-18    Colletotrichum gloeosporioides Cg-14
gb|KIV83264.1|  hypothetical protein PV11_05309                       91.7    4e-18    Exophiala sideris
gb|KIO22407.1|  hypothetical protein M407DRAFT_118073                 91.7    6e-18    Tulasnella calospora MUT 4182
ref|XP_007793174.1|  putative oxidoreductase nad-binding rossmann...  90.5    8e-18    
ref|XP_008085160.1|  NAD(P)-binding Rossmann-fold containing protein  90.5    1e-17    Glarea lozoyensis ATCC 20868
gb|ERT03209.1|  hypothetical protein HMPREF1624_01515                 90.5    1e-17    Sporothrix schenckii ATCC 58251
ref|XP_003347717.1|  hypothetical protein SMAC_03815                  90.5    1e-17    Sordaria macrospora k-hell
gb|KIH86578.1|  hypothetical protein SPBR_08549                       90.5    2e-17    Sporothrix brasiliensis 5110
gb|KFZ16228.1|  hypothetical protein V501_02319                       90.1    2e-17    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_003840030.1|  similar to oxidoreductase family                 89.7    2e-17    Leptosphaeria maculans JN3
ref|XP_011112776.1|  hypothetical protein H072_7001                   89.7    2e-17    
ref|XP_003045334.1|  hypothetical protein NECHADRAFT_70521            89.4    2e-17    [Nectria] haematococca mpVI 77-13-4
ref|XP_002183307.1|  predicted protein                                89.7    4e-17    Phaeodactylum tricornutum CCAP 1055/1
dbj|GAM35894.1|  oxidoreductase                                       89.0    4e-17    Talaromyces cellulolyticus
ref|XP_007295758.1|  oxidoreductase family protein                    89.0    4e-17    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KFY75511.1|  hypothetical protein V499_04510                       89.0    4e-17    Pseudogymnoascus sp. VKM F-103
ref|XP_002146783.1|  oxidoreductase family, NAD-binding Rossmann ...  88.6    5e-17    Talaromyces marneffei ATCC 18224
ref|XP_011399715.1|  Uncharacterized protein F751_0699                89.0    5e-17    Auxenochlorella protothecoides
gb|KFY61799.1|  hypothetical protein V496_04887                       90.9    7e-17    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_755974.1|  oxidoreductase family, NAD-binding Rossmann fol...  88.6    8e-17    Aspergillus fumigatus Af293
gb|KIH88824.1|  hypothetical protein SPBR_07486                       87.8    8e-17    Sporothrix brasiliensis 5110
ref|XP_004152962.1|  PREDICTED: uncharacterized protein LOC101204258  82.4    2e-16    
gb|KEZ39853.1|  Oxidoreductase-like protein                           86.7    2e-16    Scedosporium apiospermum
ref|XP_009854174.1|  hypothetical protein NEUTE1DRAFT_131795          86.7    2e-16    Neurospora tetrasperma FGSC 2508
ref|XP_011318574.1|  hypothetical protein FGSG_02628                  86.7    3e-16    Fusarium graminearum PH-1
ref|XP_006696746.1|  hypothetical protein CTHT_0064410                87.8    3e-16    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_002479070.1|  oxidoreductase family, NAD-binding Rossmann ...  86.3    4e-16    Talaromyces stipitatus ATCC 10500
ref|XP_009263289.1|  hypothetical protein FPSE_11897                  85.9    5e-16    Fusarium pseudograminearum CS3096
gb|ERT02500.1|  hypothetical protein HMPREF1624_00799                 85.5    6e-16    Sporothrix schenckii ATCC 58251
gb|KHE80312.1|  NAD(P)-binding protein                                85.5    7e-16    Neurospora crassa
ref|XP_960192.1|  NAD-binding Rossmann fold oxidoreductase            84.7    1e-15    Neurospora crassa OR74A
ref|XP_001554573.1|  hypothetical protein BC1G_07162                  84.7    1e-15    Botrytis cinerea B05.10
ref|XP_007588173.1|  putative oxidoreductase nad-binding rossmann...  83.6    2e-15    
gb|EKV16143.1|  Oxidoreductase family, NAD-binding Rossmann fold ...  85.1    2e-15    Penicillium digitatum Pd1
gb|KFZ09203.1|  hypothetical protein V502_08867                       83.6    3e-15    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|EIT80267.1|  putative dehydrogenase                                83.6    3e-15    Aspergillus oryzae 3.042
gb|KFY88446.1|  hypothetical protein V500_06334                       83.6    3e-15    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|ELR09495.1|  hypothetical protein GMDG_00677                       83.6    3e-15    Pseudogymnoascus destructans 20631-21
ref|XP_002382548.1|  oxidoreductase family, NAD-binding Rossmann ...  83.2    3e-15    Aspergillus flavus NRRL3357
dbj|BAE61316.1|  unnamed protein product                              83.2    4e-15    Aspergillus oryzae RIB40
emb|CCT69021.1|  related to dehydrogenases and related proteins       82.8    4e-15    Fusarium fujikuroi IMI 58289
ref|XP_006962588.1|  predicted protein                                82.8    4e-15    Trichoderma reesei QM6a
gb|KIM22883.1|  hypothetical protein M408DRAFT_332653                 83.6    4e-15    Serendipita vermifera MAFF 305830
gb|ETS04874.1|  NAD-binding Rossmann fold oxidoreductase              82.8    5e-15    Trichoderma reesei RUT C-30
ref|XP_002839683.1|  hypothetical protein                             82.8    6e-15    Tuber melanosporum Mel28
gb|EWG49872.1|  glucose-fructose oxidoreductase                       82.4    6e-15    Fusarium verticillioides 7600
ref|XP_002567221.1|  Pc21g01510                                       82.0    8e-15    Penicillium rubens Wisconsin 54-1255
gb|KIM99483.1|  hypothetical protein OIDMADRAFT_89802                 82.0    9e-15    Oidiodendron maius Zn
ref|XP_007674297.1|  hypothetical protein BAUCODRAFT_22896            82.4    9e-15    Baudoinia panamericana UAMH 10762
gb|KFH44383.1|  hypothetical protein ACRE_048520                      82.0    1e-14    Acremonium chrysogenum ATCC 11550
ref|XP_001275918.1|  NAD-binding Rossmann fold oxidoreductase fam...  81.6    1e-14    Aspergillus clavatus NRRL 1
dbj|GAA91490.1|  oxidoreductase family, NAD-binding Rossmann fold...  81.6    1e-14    Aspergillus kawachii IFO 4308
gb|EHK50187.1|  hypothetical protein TRIATDRAFT_233440                81.6    1e-14    Trichoderma atroviride IMI 206040
emb|CCA69637.1|  hypothetical protein PIIN_03576                      81.6    2e-14    Serendipita indica DSM 11827
ref|XP_007839104.1|  hypothetical protein PFICI_12332                 81.6    2e-14    Pestalotiopsis fici W106-1
gb|KIL95797.1|  glucose-fructose oxidoreductase                       81.3    2e-14    Fusarium avenaceum
ref|XP_009153161.1|  glucose-fructose oxidoreductase                  81.3    2e-14    Exophiala dermatitidis NIH/UT8656
ref|XP_001397204.1|  NAD-binding Rossmann fold oxidoreductase fam...  81.3    2e-14    Aspergillus niger CBS 513.88
ref|XP_001593666.1|  hypothetical protein SS1G_05094                  81.3    2e-14    Sclerotinia sclerotiorum 1980 UF-70
gb|EHK17838.1|  hypothetical protein TRIVIDRAFT_136949                80.9    2e-14    Trichoderma virens Gv29-8
gb|EMT70613.1|  hypothetical protein FOC4_g10009079                   80.9    2e-14    Fusarium oxysporum f. sp. cubense race 4
gb|ENH74564.1|  hypothetical protein FOC1_g10009984                   80.9    2e-14    Fusarium oxysporum f. sp. cubense race 1
gb|KFY35329.1|  hypothetical protein V494_06008                       80.9    2e-14    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|EER41723.1|  NAD-binding Rossmann fold oxidoreductase              80.9    2e-14    Histoplasma capsulatum H143
gb|KFY14890.1|  hypothetical protein V492_02347                       80.9    3e-14    Pseudogymnoascus sp. VKM F-4246
gb|EXK91996.1|  glucose-fructose oxidoreductase                       80.5    3e-14    Fusarium oxysporum f. sp. raphani 54005
gb|EWZ38499.1|  glucose-fructose oxidoreductase                       80.5    3e-14    Fusarium oxysporum Fo47
gb|EWY91836.1|  glucose-fructose oxidoreductase                       80.5    3e-14    Fusarium oxysporum FOSC 3-a
gb|KIN06467.1|  hypothetical protein OIDMADRAFT_155638                80.5    4e-14    Oidiodendron maius Zn
ref|XP_001822449.2|  hypothetical protein AOR_1_404134                81.6    4e-14    
gb|ESZ98482.1|  hypothetical protein SBOR_1144                        79.7    6e-14    Sclerotinia borealis F-4128
ref|XP_007324396.1|  hypothetical protein SERLADRAFT_364213           80.1    6e-14    Serpula lacrymans var. lacrymans S7.9
gb|KGO75187.1|  Oxidoreductase, N-terminal                            80.9    6e-14    Penicillium italicum
gb|KGO40526.1|  Oxidoreductase, N-terminal                            80.9    7e-14    Penicillium expansum
gb|EEQ92492.1|  NAD-binding Rossmann fold oxidoreductase              79.7    7e-14    Blastomyces dermatitidis ER-3
gb|KFY00135.1|  hypothetical protein O988_03504                       79.7    7e-14    Pseudogymnoascus sp. VKM F-3808
gb|EQL35203.1|  hypothetical protein BDFG_03181                       79.7    8e-14    Blastomyces dermatitidis ATCC 26199
ref|XP_002626131.1|  NAD-binding Rossmann fold oxidoreductase         79.3    8e-14    Blastomyces gilchristii SLH14081
ref|XP_006455042.1|  hypothetical protein AGABI2DRAFT_194743          79.7    8e-14    Agaricus bisporus var. bisporus H97
gb|EEH05857.1|  NAD-binding Rossmann fold oxidoreductase              79.3    1e-13    Histoplasma capsulatum G186AR
emb|CCX08562.1|  Similar to Putative uracil phosphoribosyltransfe...  80.5    1e-13    Pyronema omphalodes CBS 100304
gb|EGE83963.1|  NAD-binding Rossmann fold oxidoreductase              79.0    1e-13    Blastomyces dermatitidis ATCC 18188
gb|EXL57961.1|  glucose-fructose oxidoreductase                       79.0    1e-13    Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|ERS96910.1|  hypothetical protein HMPREF1624_06237                 79.0    1e-13    Sporothrix schenckii ATCC 58251
ref|XP_001538347.1|  predicted protein                                79.0    1e-13    Histoplasma capsulatum NAm1
gb|EGU88150.1|  hypothetical protein FOXB_01288                       80.5    1e-13    Fusarium oxysporum Fo5176
gb|KEY68231.1|  hypothetical protein S7711_04765                      79.0    1e-13    Stachybotrys chartarum IBT 7711
gb|KFA50043.1|  hypothetical protein S40293_06825                     78.6    2e-13    Stachybotrys chartarum IBT 40293
gb|KFA81971.1|  hypothetical protein S40288_04398                     78.6    2e-13    Stachybotrys chartarum IBT 40288
ref|XP_007330917.1|  hypothetical protein AGABI1DRAFT_114560          78.6    2e-13    Agaricus bisporus var. burnettii JB137-S8
ref|XP_001216107.1|  predicted protein                                79.3    2e-13    Aspergillus terreus NIH2624
dbj|BAE63558.1|  unnamed protein product                              78.2    3e-13    Aspergillus oryzae RIB40
gb|KIY03803.1|  hypothetical protein Z520_00494                       77.8    3e-13    Fonsecaea multimorphosa CBS 102226
ref|XP_001906379.1|  hypothetical protein                             77.8    4e-13    Podospora anserina S mat+
ref|XP_007367395.1|  oxidoreductase family protein                    77.8    4e-13    Dichomitus squalens LYAD-421 SS1
gb|KFA62356.1|  hypothetical protein S40285_08590                     77.8    4e-13    Stachybotrys chlorohalonata IBT 40285
gb|EIT72400.1|  putative dehydrogenase                                78.2    4e-13    Aspergillus oryzae 3.042
gb|EPE09779.1|  nad-binding rossmann fold oxidoreductase family p...  77.8    4e-13    Ophiostoma piceae UAMH 11346
ref|XP_007350429.1|  NAD(P)-binding protein                           77.4    5e-13    
ref|XP_009550993.1|  hypothetical protein HETIRDRAFT_441859           77.0    6e-13    Heterobasidion irregulare TC 32-1
ref|XP_680622.1|  hypothetical protein AN7353.2                       77.0    7e-13    Aspergillus nidulans FGSC A4
gb|KIW21209.1|  hypothetical protein PV08_01789                       76.6    7e-13    Exophiala spinifera
gb|KIW03136.1|  hypothetical protein PV09_05778                       76.3    1e-12    Verruconis gallopava
gb|EJU01365.1|  NADP-binding protein                                  76.3    1e-12    Dacryopinax primogenitus
ref|XP_008045096.1|  oxidoreductase family protein                    75.9    2e-12    Trametes versicolor FP-101664 SS1
gb|KIY44168.1|  NAD(P)-binding protein                                75.5    2e-12    Fistulina hepatica ATCC 64428
gb|KIL66602.1|  hypothetical protein M378DRAFT_74962                  75.9    2e-12    Amanita muscaria Koide BX008
gb|EHK44528.1|  hypothetical protein TRIATDRAFT_300680                75.5    2e-12    Trichoderma atroviride IMI 206040
gb|EHK24126.1|  hypothetical protein TRIVIDRAFT_45259                 75.5    2e-12    Trichoderma virens Gv29-8
ref|XP_007824029.2|  oxidoreductase                                   75.1    3e-12    Metarhizium robertsii ARSEF 23
gb|KIW39301.1|  hypothetical protein PV06_09085                       74.7    3e-12    Exophiala oligosperma
gb|KIW42674.1|  hypothetical protein PV06_06200                       74.7    4e-12    Exophiala oligosperma
ref|XP_007733422.1|  hypothetical protein A1O3_05105                  74.7    4e-12    Capronia epimyces CBS 606.96
gb|KIH93169.1|  hypothetical protein SPBR_02922                       75.1    4e-12    Sporothrix brasiliensis 5110
gb|KIX08304.1|  hypothetical protein Z518_02960                       74.7    4e-12    Rhinocladiella mackenziei CBS 650.93
ref|XP_008716792.1|  hypothetical protein HMPREF1541_04224            74.3    4e-12    Cyphellophora europaea CBS 101466
ref|XP_007911759.1|  putative oxidoreductase nad-binding rossmann...  74.7    5e-12    Phaeoacremonium minimum UCRPA7
ref|XP_007794424.1|  putative oxidoreductase nad-binding rossmann...  74.7    5e-12    
ref|XP_003047008.1|  hypothetical protein NECHADRAFT_95358            74.3    5e-12    [Nectria] haematococca mpVI 77-13-4
ref|XP_006969500.1|  predicted protein                                74.3    5e-12    Trichoderma reesei QM6a
gb|KIV93979.1|  hypothetical protein PV10_05146                       74.3    6e-12    Exophiala mesophila
emb|CDM31202.1|  NAD(P)-binding domain                                74.3    6e-12    Penicillium roqueforti FM164
ref|XP_001227364.1|  hypothetical protein CHGG_09437                  75.1    7e-12    Chaetomium globosum CBS 148.51
gb|KFX45295.1|  Uncharacterized protein GQ26_0241310                  73.9    9e-12    Talaromyces marneffei PM1
gb|KIO22409.1|  hypothetical protein M407DRAFT_245182                 73.9    9e-12    Tulasnella calospora MUT 4182
gb|KIW87520.1|  hypothetical protein Z519_11843                       73.6    9e-12    Cladophialophora bantiana CBS 173.52
ref|XP_001261103.1|  hypothetical protein NFIA_091650                 73.9    9e-12    Aspergillus fischeri NRRL 181
ref|WP_014856858.1|  oxidoreductase domain-containing protein         73.2    1e-11    Melioribacter roseus
gb|KID95177.1|  oxidoreductase family, NAD-binding Rossmann fold ...  73.6    1e-11    Metarhizium majus ARSEF 297
gb|KFX97097.1|  hypothetical protein V490_02972                       73.2    1e-11    Pseudogymnoascus sp. VKM F-3557
gb|EMS23348.1|  NAD dependent oxidoreductase                          73.6    1e-11    Rhodotorula toruloides NP11
ref|XP_003045013.1|  hypothetical protein NECHADRAFT_43861            72.8    1e-11    [Nectria] haematococca mpVI 77-13-4
ref|XP_007810860.1|  oxidoreductase family, NAD-binding Rossmann ...  73.2    1e-11    Metarhizium acridum CQMa 102
gb|ERT01696.1|  hypothetical protein HMPREF1624_02949                 73.2    1e-11    Sporothrix schenckii ATCC 58251
gb|KIW33724.1|  hypothetical protein PV07_00552                       73.2    1e-11    Cladophialophora immunda
ref|XP_002150922.1|  oxidoreductase, putative                         73.2    2e-11    Talaromyces marneffei ATCC 18224
gb|KEF53140.1|  hypothetical protein A1O9_11048                       72.8    2e-11    Exophiala aquamarina CBS 119918
gb|KIP10807.1|  hypothetical protein PHLGIDRAFT_22069                 72.8    2e-11    Phlebiopsis gigantea 11061_1 CR5-6
gb|KIJ64897.1|  hypothetical protein HYDPIDRAFT_181650                72.8    2e-11    Hydnomerulius pinastri MD-312
ref|XP_007870707.1|  NAD P-binding protein                            72.8    2e-11    Gloeophyllum trabeum ATCC 11539
ref|XP_003007531.1|  NAD-binding Rossmann fold oxidoreductase fam...  72.4    3e-11    Verticillium alfalfae VaMs.102
gb|KFX44107.1|  Uncharacterized protein GQ26_0300340                  70.1    3e-11    Talaromyces marneffei PM1
gb|KIV87570.1|  hypothetical protein PV11_03107                       72.0    3e-11    Exophiala sideris
gb|KFY46177.1|  hypothetical protein V495_02629                       72.0    3e-11    Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_007769867.1|  NAD(P)-binding protein                           72.0    4e-11    Coniophora puteana RWD-64-598 SS2
ref|XP_003715071.1|  NAD-binding Rossmann fold oxidoreductase         71.6    4e-11    Magnaporthe oryzae 70-15
gb|KFY59684.1|  hypothetical protein V497_04131                       71.6    4e-11    Pseudogymnoascus sp. VKM F-4516 (FW-969)
gb|KIN02849.1|  hypothetical protein OIDMADRAFT_40668                 71.6    5e-11    Oidiodendron maius Zn
dbj|GAM37326.1|  oxidoreductase                                       71.6    5e-11    Talaromyces cellulolyticus
ref|XP_003031463.1|  hypothetical protein SCHCODRAFT_77296            71.6    5e-11    Schizophyllum commune H4-8
ref|XP_007722030.1|  hypothetical protein A1O1_02932                  71.6    5e-11    Capronia coronata CBS 617.96
gb|KFY03608.1|  hypothetical protein O988_01367                       71.6    6e-11    Pseudogymnoascus sp. VKM F-3808
dbj|GAM42631.1|  oxidoreductase                                       71.2    6e-11    
ref|XP_568129.1|  hypothetical protein                                71.2    7e-11    
ref|XP_008730183.1|  hypothetical protein G647_07648                  70.9    8e-11    
gb|KFX44108.1|  Uncharacterized protein GQ26_0300340                  70.1    1e-10    
gb|KID84577.1|  oxidoreductase family, NAD-binding Rossmann fold ...  70.9    1e-10    
ref|XP_007740232.1|  hypothetical protein A1O5_01425                  70.5    1e-10    
gb|KIW64306.1|  hypothetical protein PV04_09250                       70.5    1e-10    
gb|KIM80656.1|  hypothetical protein PILCRDRAFT_822384                70.9    1e-10    
gb|KIL66581.1|  hypothetical protein M378DRAFT_123742                 70.5    1e-10    
ref|XP_003650189.1|  hypothetical protein THITE_123357                70.5    1e-10    
gb|KIJ10684.1|  hypothetical protein PAXINDRAFT_172088                70.1    2e-10    
ref|XP_007760853.1|  hypothetical protein A1O7_08673                  70.1    2e-10    
gb|KFX46381.1|  Uncharacterized protein GQ26_0191180                  69.7    2e-10    
ref|XP_009656154.1|  NAD-binding Rossmann fold oxidoreductase fam...  70.5    2e-10    
ref|XP_003660926.1|  oxidoreductase-like protein                      69.7    2e-10    
ref|XP_773472.1|  hypothetical protein CNBI0860                       69.7    2e-10    
gb|KIW86052.1|  hypothetical protein Z517_01446                       69.7    2e-10    
ref|XP_007769882.1|  NAD(P)-binding protein                           69.7    2e-10    
gb|KIR46389.1|  NAD-binding Rossmann fold oxidoreductase              69.7    3e-10    
gb|EFX03707.1|  nuclear migration protein                             70.5    3e-10    
gb|KIR59526.1|  NAD-binding Rossmann fold oxidoreductase              69.7    3e-10    
gb|KIR53880.1|  NAD-binding Rossmann fold oxidoreductase              69.3    3e-10    
ref|XP_009654382.1|  NAD-binding Rossmann fold oxidoreductase fam...  68.9    4e-10    
ref|XP_003194017.1|  hypothetical protein CGB_D1030C                  69.3    4e-10    
gb|KIR85165.1|  NAD-binding Rossmann fold oxidoreductase              68.9    5e-10    
ref|XP_002554199.1|  KLTH0E16522p                                     68.9    5e-10    
ref|XP_001800467.1|  hypothetical protein SNOG_10185                  68.6    6e-10    
ref|XP_008597824.1|  oxidoreductase family protein                    68.6    6e-10    
emb|CEP60003.1|  LALA0S01e00804g1_1                                   68.2    7e-10    
emb|CEJ83936.1|  hypothetical protein VHEMI03305                      68.2    8e-10    
gb|KIR26739.1|  NAD-binding Rossmann fold oxidoreductase              68.2    8e-10    
gb|KIS02481.1|  NAD-binding Rossmann fold oxidoreductase              68.2    8e-10    
gb|KDQ61926.1|  hypothetical protein JAAARDRAFT_190638                67.8    1e-09    
gb|KIJ28562.1|  hypothetical protein M422DRAFT_189558                 67.4    2e-09    
ref|XP_007727310.1|  hypothetical protein A1O1_08258                  67.4    2e-09    
gb|AFR94284.1|  NAD-binding Rossmann fold oxidoreductase              67.4    2e-09    
gb|KGB78824.1|  hypothetical protein CNBG_4662                        67.0    2e-09    
gb|KDQ56757.1|  hypothetical protein JAAARDRAFT_70456                 67.4    2e-09    
gb|KEZ38713.1|  Oxidoreductase                                        66.6    3e-09    
gb|KIW60300.1|  hypothetical protein PV05_00529                       66.6    3e-09    
gb|KJA21352.1|  hypothetical protein HYPSUDRAFT_42224                 65.9    5e-09    
gb|KDQ32487.1|  hypothetical protein PLEOSDRAFT_1091124               65.9    5e-09    
gb|KIW64066.1|  hypothetical protein PV04_09025                       65.5    6e-09    
ref|XP_009230177.1|  NAD-binding Rossmann fold oxidoreductase         65.9    6e-09    
ref|XP_007394970.1|  hypothetical protein PHACADRAFT_254723           65.5    7e-09    
gb|EMD36780.1|  hypothetical protein CERSUDRAFT_155077                65.1    9e-09    
ref|WP_011943217.1|  oxidoreductase                                   64.7    1e-08    
gb|KIK34237.1|  hypothetical protein CY34DRAFT_26897                  64.7    1e-08    
ref|WP_038051523.1|  oxidoreductase                                   63.9    2e-08    
ref|XP_002956633.1|  hypothetical protein VOLCADRAFT_119466           63.9    3e-08    
gb|KDR66469.1|  hypothetical protein GALMADRAFT_259259                63.9    3e-08    
ref|XP_003004419.1|  NAD-binding Rossmann fold oxidoreductase fam...  63.5    3e-08    
gb|KDE06246.1|  hypothetical protein MVLG_03405                       63.5    4e-08    
gb|EYE96563.1|  oxidoreductase family, NAD-binding Rossmann fold ...  63.2    4e-08    
gb|KGQ09050.1|  hypothetical protein BBAD15_g5618                     61.2    4e-08    
ref|XP_007267326.1|  NAD-binding protein                              62.8    6e-08    
ref|WP_041844546.1|  oxidoreductase                                   62.4    8e-08    
ref|WP_011011672.1|  oxidoreductase                                   62.0    1e-07    
ref|XP_001211482.1|  conserved hypothetical protein                   60.1    1e-07    
ref|XP_007379545.1|  oxidoreductase family protein                    61.6    1e-07    
ref|WP_020265263.1|  hypothetical protein                             61.2    2e-07    
ref|XP_003678562.1|  hypothetical protein TDEL_0A00190                61.2    2e-07    
ref|WP_038066570.1|  oxidoreductase                                   60.8    2e-07    
ref|WP_011177324.1|  dehydrogenase                                    60.8    2e-07    
gb|ACM22551.1|  Oxidoreductase domain protein                         60.8    2e-07    
gb|EGN93485.1|  hypothetical protein SERLA73DRAFT_189645              60.8    3e-07    
ref|XP_007324516.1|  hypothetical protein SERLADRAFT_480526           60.5    4e-07    
ref|WP_038033444.1|  MULTISPECIES: oxidoreductase                     60.5    4e-07    
gb|EPT01940.1|  hypothetical protein FOMPIDRAFT_1041084               60.5    4e-07    
ref|WP_004102818.1|  oxidoreductase                                   60.1    4e-07    
emb|CEL59024.1|  putative protein YMR315W OS=Saccharomyces cerevi...  59.7    6e-07    
emb|CCO30564.1|  hypothetical protein BN14_04594                      59.7    7e-07    
emb|CDO93391.1|  unnamed protein product                              58.9    1e-06    
ref|WP_004083048.1|  oxidoreductase                                   58.5    1e-06    
ref|WP_010865093.1|  oxidoreductase                                   58.5    1e-06    
gb|KIY71507.1|  NAD(P)-binding protein                                58.5    2e-06    
ref|WP_008193664.1|  MULTISPECIES: oxidoreductase                     58.2    2e-06    
gb|KIW18212.1|  hypothetical protein PV08_02500                       58.5    2e-06    
ref|WP_012310640.1|  oxidoreductase                                   58.2    2e-06    
ref|XP_003674473.1|  hypothetical protein NCAS_0B00110                57.8    3e-06    
gb|KIK67859.1|  hypothetical protein GYMLUDRAFT_36656                 57.8    3e-06    
ref|XP_004182195.1|  hypothetical protein TBLA_0I00110                57.8    3e-06    
ref|XP_001840594.2|  oxidoreductase family protein                    57.8    3e-06    
gb|KII91478.1|  hypothetical protein PLICRDRAFT_156577                57.4    4e-06    
emb|CCL99375.1|  predicted protein                                    57.4    4e-06    
ref|XP_453042.1|  hypothetical protein                                57.4    4e-06    
gb|KIM36263.1|  hypothetical protein M413DRAFT_449312                 57.4    4e-06    
ref|WP_012896260.1|  oxidoreductase                                   57.0    5e-06    
gb|KIJ64973.1|  hypothetical protein HYDPIDRAFT_111692                57.0    6e-06    
ref|XP_003954874.1|  hypothetical protein KAFR_0A03040                56.6    6e-06    
ref|XP_002495816.1|  ZYRO0C03674p                                     56.6    8e-06    
pdb|1ZH8|A  Chain A, Crystal Structure Of Oxidoreductase (tm0312)...  56.2    8e-06    
ref|XP_005716388.1|  unnamed protein product                          56.2    9e-06    
gb|KGN54119.1|  hypothetical protein Csa_4G286920                     54.3    1e-05    
ref|WP_029683343.1|  oxidoreductase                                   55.8    1e-05    
emb|CCK71422.1|  hypothetical protein KNAG_0G03650                    55.5    2e-05    
ref|XP_449954.1|  hypothetical protein                                55.1    3e-05    
ref|WP_011249602.1|  oxidoreductase                                   54.7    3e-05    
ref|XP_007303479.1|  NAD-P-binding protein                            54.7    3e-05    
ref|NP_987069.1|  AGR403Wp                                            54.7    3e-05    
gb|AEY99225.1|  FAGR403Wp                                             54.7    3e-05    
ref|WP_033191335.1|  oxidoreductase                                   54.3    3e-05    
ref|WP_036225443.1|  hypothetical protein                             54.3    4e-05    
dbj|BAO40034.1|  uncharacterized protein YMR315W                      53.9    5e-05    
ref|NP_014046.1|  hypothetical protein YMR315W                        53.9    6e-05    
gb|AJS95761.1|  hypothetical protein H823_YJM1447M00470               53.5    6e-05    
emb|CAE84407.1|  hypothetical protein                                 53.5    7e-05    
gb|EGA73622.1|  YMR315W-like protein                                  53.5    7e-05    
gb|AJS83136.1|  hypothetical protein H794_YJM1311M00474               53.5    8e-05    
gb|AJS63054.1|  hypothetical protein H749_YJM195M00474                53.5    8e-05    
gb|AJS80533.1|  hypothetical protein H788_YJM1248M00474               53.5    8e-05    
dbj|GAA25767.1|  K7_Ymr315wp                                          53.5    8e-05    
gb|AJS80962.1|  hypothetical protein H789_YJM1250M00464               53.1    8e-05    
emb|CAJ75722.1|  predicted dehydrogenases and related proteins        53.1    8e-05    
gb|AJP41010.1|  hypothetical protein F842_YJM1078M00474               53.1    8e-05    
gb|EDN64256.1|  conserved protein                                     53.1    9e-05    
emb|CAJ75716.1|  predicted dehydrogenases and related proteins        53.1    9e-05    
gb|AJS70048.1|  hypothetical protein H765_YJM627M00474                53.1    9e-05    
gb|KEP55058.1|  putative NAD-binding rossmann fold oxidoreductase     53.1    1e-04    
gb|EUC61244.1|  oxidoreductase family, NAD-binding rossmann fold ...  53.1    1e-04    
ref|XP_011276250.1|  Inositol 2-dehydrogenase/D-chiro-inositol 3-...  52.8    1e-04    
ref|XP_003644579.1|  hypothetical protein Ecym_2002                   52.8    1e-04    
ref|WP_029956047.1|  hypothetical protein                             52.4    2e-04    
ref|WP_021794418.1|  hypothetical protein                             52.4    2e-04    
ref|WP_036936424.1|  hypothetical protein                             52.0    2e-04    
gb|AGO10762.1|  AaceriAGR403Wp                                        52.0    2e-04    
gb|EIF45784.1|  ymr315w-like protein                                  52.0    2e-04    
emb|CDK28400.1|  unnamed protein product                              51.6    3e-04    
gb|EGA57295.1|  YMR315W-like protein                                  51.2    3e-04    
ref|WP_035064499.1|  dehydrogenase                                    51.6    4e-04    
ref|XP_006685803.1|  NAD(P)-binding protein                           51.2    4e-04    
ref|WP_015075613.1|  hypothetical protein                             51.2    4e-04    
ref|WP_017212183.1|  dehydrogenase                                    51.2    4e-04    
ref|WP_010053192.1|  dehydrogenase                                    50.8    5e-04    
gb|EGA60881.1|  YMR315W-like protein                                  50.8    5e-04    
ref|XP_001824691.2|  oxidoreductase                                   50.4    8e-04    
ref|XP_007848044.1|  nad-binding rossmann fold oxidoreductase         50.1    0.001    



>ref|XP_004228627.1| PREDICTED: uncharacterized oxidoreductase C26H5.09c [Solanum 
lycopersicum]
Length=359

 Score =   371 bits (953),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 209/233 (90%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T +TQ+PIWAVAENYRFEPAF E K++I+EIG+MMN+QVI+EG+MNSSNPYF+SSWRR F
Sbjct  127  TTLTQQPIWAVAENYRFEPAFIEGKRLISEIGEMMNIQVIVEGAMNSSNPYFASSWRRQF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRML+GCE+ S+S+M SHVDKTLPPPDNIS++FQLENGCSGVF M
Sbjct  187  VGGFILDMGVHFVAGLRMLIGCEIASLSSMNSHVDKTLPPPDNISSMFQLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS+SPK++WRVVGLNG L+V+RGNKDGKHGYSVSL+M DGQ KSFFYPF GV +ELKT
Sbjct  247  VVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYSVSLHMADGQSKSFFYPFSGVTDELKT  306

Query  260  FLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKKF
Sbjct  307  FLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKKF  359



>ref|XP_006348416.1| PREDICTED: uncharacterized protein YMR315W-like [Solanum tuberosum]
Length=359

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 208/233 (89%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
              +TQ+PIWAVAENYRFEPAF E K++I+EIG+MMN+Q+I+EG+MNSSNPYF+SSWRR F
Sbjct  127  ATLTQQPIWAVAENYRFEPAFIEGKRLISEIGEMMNIQIIVEGAMNSSNPYFASSWRRQF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRMLVGCE+TS+S+M SHVDKTLPPPDNIS++FQLENGCSGVF M
Sbjct  187  VGGFILDMGVHFVAGLRMLVGCEITSLSSMNSHVDKTLPPPDNISSMFQLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS+SPK++WRVVGLNG L+V+RGNKDGKHGYSVSL+M DGQ KSFFYPF GV +ELK 
Sbjct  247  VVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYSVSLHMADGQSKSFFYPFSGVTDELKA  306

Query  260  FLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKKF
Sbjct  307  FLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKKF  359



>ref|XP_009588958.1| PREDICTED: uncharacterized protein YMR315W [Nicotiana tomentosiformis]
Length=361

 Score =   369 bits (948),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 207/233 (89%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T +T +PIWAVAENYRFEPAF E KK+I+EIG+MMN+QVI+EGSMNSSNPYFSSSWRR F
Sbjct  129  TTLTHQPIWAVAENYRFEPAFIEGKKLISEIGEMMNIQVIVEGSMNSSNPYFSSSWRRQF  188

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRMLVGCE+ S+SA+ SHVDKTLPPPDNIS++FQLENGCSGVF M
Sbjct  189  DGGFILDMGVHFVAGLRMLVGCEIASLSAINSHVDKTLPPPDNISSMFQLENGCSGVFVM  248

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS+SPKI+WRVVGLNG L+VERGNKDGKHGYS+ L+M DGQ KSFFYPF GV +ELKT
Sbjct  249  VVSSKSPKIIWRVVGLNGVLQVERGNKDGKHGYSIHLHMADGQSKSFFYPFSGVTDELKT  308

Query  260  FLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKKF
Sbjct  309  FLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKKF  361



>ref|XP_009773348.1| PREDICTED: uncharacterized protein LOC104223588 [Nicotiana sylvestris]
Length=361

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 206/233 (88%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
              +T +P+WAVAENYRFEPAF E +K+I+EIG+MMN+QVI+EGSMN+SNPYFSSSWRR F
Sbjct  129  ATLTHQPLWAVAENYRFEPAFIEGRKLISEIGEMMNIQVIVEGSMNNSNPYFSSSWRRQF  188

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRMLVGCE+ S+SAM SHVDKTLPPPDNIS++FQLENGCSGVF M
Sbjct  189  VGGFILDMGVHFVAGLRMLVGCEIASLSAMNSHVDKTLPPPDNISSMFQLENGCSGVFVM  248

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS+SPKI+WRVVGLNG L+VERGNKDGKHGYS+ L+M DGQ KSFFYPF GV +ELKT
Sbjct  249  VVSSKSPKIIWRVVGLNGVLQVERGNKDGKHGYSIHLHMADGQSKSFFYPFSGVTDELKT  308

Query  260  FLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKKF
Sbjct  309  FLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKKF  361



>gb|KDP20201.1| hypothetical protein JCGZ_07921 [Jatropha curcas]
Length=359

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 203/233 (87%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N   +PIWAVAENYRFEPAF ECKK++AEIGDMM V+VI+EGSMNS+NPYFSSSWRRNF
Sbjct  127  ANSPGQPIWAVAENYRFEPAFVECKKLLAEIGDMMTVEVIVEGSMNSANPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRM+VGCEV SVSAMTSHVDKTLPPPDNIS++FQLENGCSGVF M
Sbjct  187  TGGFILDMGVHFIAGLRMVVGCEVISVSAMTSHVDKTLPPPDNISSVFQLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKI+WRVVGL GTL+V+RG++DG+HGY VS Y  DG  KS FYPF GV EELKT
Sbjct  247  VVSSRSPKILWRVVGLKGTLQVDRGSQDGRHGYVVSFYGADGICKSTFYPFSGVTEELKT  306

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DIS AN  KG   + EPR+SFVEG RD+AVL+AMLESG + GALVQVKKF
Sbjct  307  FIHDISQANLKKGSSYEAEPRISFVEGARDVAVLDAMLESGMKNGALVQVKKF  359



>emb|CDP14087.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   350 bits (897),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/233 (76%), Positives = 206/233 (88%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T++  +P+WAVAENYRFEPAF E KK++AE+GD+M++QVIIEGSM SSNPYFSSSWRRNF
Sbjct  127  THLPFQPVWAVAENYRFEPAFEESKKLMAEVGDVMSIQVIIEGSMTSSNPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRMLVGCEV+SVSA+TSHVD TLPPPDNIS+ FQLENGC+GVF +
Sbjct  187  TGGFILDMGVHFVAGLRMLVGCEVSSVSALTSHVDLTLPPPDNISSTFQLENGCTGVFVL  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKI+WRVVGLNGTL++ERGN+DGKHGY V+LY+ +GQ KSFF+PF GV EELK 
Sbjct  247  VVSSRSPKILWRVVGLNGTLQIERGNQDGKHGYLVTLYLANGQNKSFFHPFSGVTEELKA  306

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLS+IS A   K    + E RLSFVEG RD+AVL+AMLESGKR+GA VQVK+F
Sbjct  307  FLSEISQATLKKDSSYEVERRLSFVEGVRDVAVLDAMLESGKRQGAPVQVKRF  359



>ref|XP_002513445.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF48848.1| oxidoreductase, putative [Ricinus communis]
Length=359

 Score =   349 bits (896),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N   +PIWAVAENYRFEPAF EC+K++AEIGDMM VQVI+EGSMNSSNPYFSSSWRRNF
Sbjct  127  ANSPGQPIWAVAENYRFEPAFVECRKLLAEIGDMMTVQVIVEGSMNSSNPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRMLVGCEV SVSAMTSH+DKTLPPPDNIS++F LENGCSGVF M
Sbjct  187  TGGFILDMGVHFIAGLRMLVGCEVISVSAMTSHMDKTLPPPDNISSVFHLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKI WRVVGL GTL++ERG+ DGKHGY VS+   DGQ +S FYPF GV EELKT
Sbjct  247  VVSSRSPKIFWRVVGLKGTLQIERGSHDGKHGYLVSVCGTDGQSRSSFYPFSGVTEELKT  306

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DIS AN  KG   + EPR+SF+EG RD+A+L+AMLESG + GALVQVKKF
Sbjct  307  FIHDISQANLKKGSSYEVEPRISFMEGARDVAILDAMLESGTKAGALVQVKKF  359



>ref|XP_006445974.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59214.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=355

 Score =   345 bits (884),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  130  QPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRRNFTGGFI  189

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+ GCEV SVSA+TSH+DKTLPPPDNIS+ FQLENGCSGVF MVVSSR
Sbjct  190  LDMGVHFIAGLRMITGCEVVSVSAITSHIDKTLPPPDNISSNFQLENGCSGVFVMVVSSR  249

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI WRVVG+ GTL+VERGN+DG+HGY V+ Y  DGQ KS FYPF GV EELK F+ DI
Sbjct  250  SPKIFWRVVGMKGTLQVERGNQDGRHGYLVTQYGADGQSKSMFYPFSGVTEELKAFIHDI  309

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S A  KG     EPR SF+EG RD+A+LEAMLESG ++GALV VKKF
Sbjct  310  SEAK-KGINHVPEPRSSFLEGARDVALLEAMLESGSKQGALVHVKKF  355



>ref|XP_006494722.1| PREDICTED: uncharacterized protein YMR315W-like [Citrus sinensis]
 gb|KDO64912.1| hypothetical protein CISIN_1g018445mg [Citrus sinensis]
Length=355

 Score =   345 bits (884),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  130  QPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRRNFTGGFI  189

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+ GCEV SVSA+TSH+DKTLPPPDNIS+ FQLENGCSGVF MVVSSR
Sbjct  190  LDMGVHFIAGLRMITGCEVVSVSAITSHIDKTLPPPDNISSNFQLENGCSGVFVMVVSSR  249

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI WRVVG+ GTL+VERGN+DG+HGY V+ Y  DGQ KS FYPF GV EELK F+ DI
Sbjct  250  SPKIFWRVVGMKGTLQVERGNQDGRHGYLVTQYGADGQSKSMFYPFSGVTEELKAFIHDI  309

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S A  KG     EPR SF+EG RD+A+LEAMLESG ++GALV VKKF
Sbjct  310  SEAK-KGINHVPEPRSSFLEGARDVALLEAMLESGSKQGALVHVKKF  355



>ref|XP_011025252.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Populus 
euphratica]
Length=359

 Score =   344 bits (882),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFIL  603
            PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSSWRRN+ GGFIL
Sbjct  134  PIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSSWRRNYTGGFIL  193

Query  602  DMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRS  423
            DMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCSGVFAMVVSS+S
Sbjct  194  DMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCSGVFAMVVSSKS  253

Query  422  PKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDIS  243
            PKI+WR+VG+NGT+E+ RGN+DG+HGY++S Y   G  KS FYPF GV  ELK FL DIS
Sbjct  254  PKILWRIVGINGTVEIGRGNQDGQHGYTISFYGAGGHCKSNFYPFSGVTAELKAFLHDIS  313

Query  242  LANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             AN KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  314  QANLKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  359



>ref|XP_002285606.1| PREDICTED: uncharacterized protein LOC100245027 isoform X1 [Vitis 
vinifera]
Length=359

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  132  QPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRRNFTGGFI  191

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++FQLENGCSGVF MVVS+R
Sbjct  192  LDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFQLENGCSGVFVMVVSTR  251

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            +PKI WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EELKTF+ DI
Sbjct  252  APKIFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEELKTFIHDI  311

Query  245  SLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  312  SQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  359



>emb|CBI16434.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   343 bits (879),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 197/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  132  QPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRRNFTGGFI  191

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++FQLENGCSGVF MVVS+R
Sbjct  192  LDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFQLENGCSGVFVMVVSTR  251

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            +PKI WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EELKTF+ DI
Sbjct  252  APKIFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEELKTFIHDI  311

Query  245  SLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  312  SQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  359



>ref|XP_011080243.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080244.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080245.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
Length=356

 Score =   341 bits (875),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 203/233 (87%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            +++   PIWAVAENYRFEPAF E KK++AEIGD++N+ VIIEGSMNSSNPYFSSSWRR+F
Sbjct  124  SSLQPAPIWAVAENYRFEPAFVEGKKLMAEIGDVINIHVIIEGSMNSSNPYFSSSWRRDF  183

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+++GLRMLVGCE+TSVSA+TSHVD TLP PD+IS+  QLE+G SGVF M
Sbjct  184  VGGFILDMGVHFISGLRMLVGCEITSVSAITSHVDTTLPAPDHISSTIQLEDGSSGVFVM  243

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPK++WR+VGL GTL+VERG+KDGKHGY+V L+  DGQ KS+FYPF GV EELKT
Sbjct  244  VVSSRSPKVLWRIVGLKGTLQVERGSKDGKHGYTVVLFTADGQNKSWFYPFSGVTEELKT  303

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLSDIS AN  K G  + EPR+SF+EG RD+AVL+AMLESGKR+G  VQVKKF
Sbjct  304  FLSDISQANLKKDGSHQVEPRISFLEGARDVAVLDAMLESGKRQGVAVQVKKF  356



>ref|XP_011025251.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Populus 
euphratica]
Length=360

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 196/227 (86%), Gaps = 1/227 (0%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFIL  603
            PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSSWRRN+ GGFIL
Sbjct  134  PIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSSWRRNYTGGFIL  193

Query  602  DMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRS  423
            DMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCSGVFAMVVSS+S
Sbjct  194  DMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCSGVFAMVVSSKS  253

Query  422  PKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDIS  243
            PKI+WR+VG+NGT+E+ RGN+DG+HGY++S Y   G  KS FYPF GV  ELK FL DIS
Sbjct  254  PKILWRIVGINGTVEIGRGNQDGQHGYTISFYGAGGHCKSNFYPFSGVTAELKAFLHDIS  313

Query  242  LAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             AN  KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  314  QANLKKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  360



>ref|XP_006386094.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63891.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=359

 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 195/232 (84%), Gaps = 0/232 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSSWRRN+
Sbjct  128  ANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSSWRRNY  187

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCSGVFAM
Sbjct  188  TGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCSGVFAM  247

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY +S Y   G  KS FYPF GV  ELK 
Sbjct  248  VVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMISFYGAGGHCKSNFYPFSGVTAELKA  307

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FL DIS AN KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  308  FLHDISQANLKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  359



>ref|XP_008243595.1| PREDICTED: uncharacterized protein YMR315W [Prunus mume]
Length=360

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 197/233 (85%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N+  KPIWAVAENYRFEPAF E KK++ +IGD+M++QVI+EGSMNSSNPYFSSSWRRNF
Sbjct  127  ANIPDKPIWAVAENYRFEPAFVEGKKLVNDIGDVMSIQVIVEGSMNSSNPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRML GCE+ SVSA+TSHVDKTLP PDN+S+LFQLENGCSGVF M
Sbjct  187  TGGFILDMGVHFVAGLRMLAGCELVSVSAITSHVDKTLPAPDNVSSLFQLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKIVWR VGL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV EE K 
Sbjct  247  VVSSRSPKIVWRFVGLKGTLQIERGNQDGRHGYLVLFYGSDGQSKSSFYQFSGVDEEFKA  306

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F++DIS AN  KG   + EPR+SF+EG RD+AVLEAMLESG ++GA V VKK+
Sbjct  307  FINDISQANLRKGNGYEAEPRMSFLEGARDVAVLEAMLESGGKQGAPVHVKKY  359



>ref|XP_011461910.1| PREDICTED: uncharacterized protein YMR315W [Fragaria vesca subsp. 
vesca]
Length=359

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N   KPIWA+AENYRFEPAF E KK++ EIGD+M++QVI+EGSMNSSNPYFSSSWRRNF
Sbjct  127  ANTPNKPIWAIAENYRFEPAFVEGKKLMTEIGDVMSIQVIVEGSMNSSNPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLPPPDNIS+LFQLENGCSG+F M
Sbjct  187  NGGFILDMGVHFMAGLRMLAGCEIVSVSATTSHVDKTLPPPDNISSLFQLENGCSGIFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKIVWR VGL GTLEVERGN+DG+HGY V  Y  DGQ K+ FYPF GV EE   
Sbjct  247  VVSSRSPKIVWRFVGLKGTLEVERGNQDGRHGYVVIFYSADGQRKTSFYPFSGVTEEFIA  306

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F++DI  A   KG   + EPR+SF+EG RD+AVLEAMLESG ++GA V VKKF
Sbjct  307  FINDIKQATLKKGAGYEAEPRMSFLEGARDVAVLEAMLESGGKQGAPVLVKKF  359



>ref|XP_006386095.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63892.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=360

 Score =   334 bits (856),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 194/227 (85%), Gaps = 1/227 (0%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFIL  603
            PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSSWRRN+ GGFIL
Sbjct  134  PIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSSWRRNYTGGFIL  193

Query  602  DMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRS  423
            DMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCSGVFAMVVSS++
Sbjct  194  DMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCSGVFAMVVSSKT  253

Query  422  PKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDIS  243
            PKI+WR+VG+NGT+E+ RGN+ G+HGY +S Y   G  KS FYPF GV  ELK FL DIS
Sbjct  254  PKILWRIVGINGTVEIGRGNQGGQHGYMISFYGAGGHCKSNFYPFSGVTAELKAFLHDIS  313

Query  242  LAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             AN  KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  314  QANLKKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  360



>ref|XP_010031848.1| PREDICTED: uncharacterized protein YMR315W [Eucalyptus grandis]
 gb|KCW51232.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=359

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 195/228 (86%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            KPIWAVAENYRFEPAF ECKK++A+IGDMMNVQVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  132  KPIWAVAENYRFEPAFVECKKLLADIGDMMNVQVIVEGSMNSSNPYFSSSWRRNFAGGFI  191

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCE+TSVSA T+HVD TLPPPDN+S+ FQLENGCSGVF M+VSS+
Sbjct  192  LDMGVHFIAGLRMLVGCEITSVSATTTHVDLTLPPPDNLSSSFQLENGCSGVFVMIVSSK  251

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI WRVVGL GTL++ERGN+DG+HGY  +LY  +GQ KS FY F GV +ELK F++D+
Sbjct  252  SPKIFWRVVGLKGTLQLERGNQDGRHGYLATLYDANGQSKSTFYSFSGVTDELKAFINDV  311

Query  245  S-LANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S +   K    + EPR SF+EG RD+AVLEAMLESG + G LV V+KF
Sbjct  312  SNMTLKKESGYEAEPRCSFLEGARDVAVLEAMLESGYKHGELVSVRKF  359



>ref|XP_004162028.1| PREDICTED: uncharacterized LOC101204258, partial [Cucumis sativus]
Length=244

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 194/232 (84%), Gaps = 3/232 (1%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N +++ +WAVAENYRFEPAF ECK +IA+IGDMM+VQVI+EGSMNSSNPYFSSSWRR+F
Sbjct  16   ANFSRQRLWAVAENYRFEPAFVECKNLIADIGDMMSVQVIVEGSMNSSNPYFSSSWRRDF  75

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GG ILDMGVH++AGLRMLVGCEV SVSA TS+VDK+LPPPDNIS+LFQLENGCSGVF M
Sbjct  76   VGGLILDMGVHFIAGLRMLVGCEVVSVSATTSYVDKSLPPPDNISSLFQLENGCSGVFVM  135

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS     G  +  FYPF GV EELKT
Sbjct  136  VVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGVTEELKT  195

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+  IS    +G + K + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  196  FIHAIS---AEGSDDKADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  244



>ref|XP_010257400.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010257401.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
Length=359

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EGSMNSSNPYFSSSWRRNF
Sbjct  127  ANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD TLPPPDNI +LFQLENGCSGVF M
Sbjct  187  TGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTTLPPPDNICSLFQLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS Y  DG+ +S FYPF GV EELK 
Sbjct  247  AVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSFYTADGRCESSFYPFSGVNEELKA  306

Query  260  FLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DI  +  K  G  + EPR SF+EG RD+AVLEAMLESG ++GA V VK+F
Sbjct  307  FVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAMLESGMKQGAQVTVKRF  359



>ref|XP_009364727.1| PREDICTED: uncharacterized protein LOC103954617 [Pyrus x bretschneideri]
Length=357

 Score =   328 bits (842),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 192/232 (83%), Gaps = 1/232 (0%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFF  618
            N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR+F 
Sbjct  126  NAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRRDFT  185

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF MV
Sbjct  186  GGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVFVMV  245

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
            VSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV EE + F
Sbjct  246  VSSRSPKIVWRFSGLKGTLQIERGNQDGRHGYVVLFYGSDGQSKSSFYQFSGVDEEFRAF  305

Query  257  LSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              DIS A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  306  FYDISQATLKKGTSYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  357



>ref|XP_009364714.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
 ref|XP_009364715.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
Length=357

 Score =   328 bits (842),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 191/232 (82%), Gaps = 1/232 (0%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFF  618
            N   KPIWAVAENYRFEP F E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR+F 
Sbjct  126  NAPDKPIWAVAENYRFEPTFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRRDFT  185

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF MV
Sbjct  186  GGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVFVMV  245

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
            VSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV EE K F
Sbjct  246  VSSRSPKIVWRFSGLKGTLQIERGNQDGRHGYVVLFYGSDGQSKSSFYQFSGVDEEFKAF  305

Query  257  LSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              DIS A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  306  FDDISQATLKKGTIYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  357



>gb|ABK96297.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   329 bits (843),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 194/230 (84%), Gaps = 4/230 (2%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFIL  603
            PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSSWRRN+ GGFIL
Sbjct  134  PIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSSWRRNYTGGFIL  193

Query  602  DMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRS  423
            DMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCSGVFAMVVSS++
Sbjct  194  DMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCSGVFAMVVSSKT  253

Query  422  PKIVWRVVGLNGTLEVERGNKDGKHGY---SVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            PKI+WR+VG+NGT+E+ RGN+ G+HGY    +S Y   G  KS FYPF GV  ELK FL 
Sbjct  254  PKILWRIVGINGTVEIGRGNQGGQHGYMPWQISFYGAGGHCKSNFYPFSGVTAELKAFLH  313

Query  251  DISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            DIS AN  KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  314  DISQANLKKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  363



>ref|XP_010257399.1| PREDICTED: uncharacterized protein LOC104597515 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EGSMNSSNPYFSSSWRRNF
Sbjct  144  ANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSSWRRNF  203

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD TLPPPDNI +LFQLENGCSGVF M
Sbjct  204  TGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTTLPPPDNICSLFQLENGCSGVFVM  263

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS Y  DG+ +S FYPF GV EELK 
Sbjct  264  AVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSFYTADGRCESSFYPFSGVNEELKA  323

Query  260  FLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DI  +  K  G  + EPR SF+EG RD+AVLEAMLESG ++GA V VK+F
Sbjct  324  FVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAMLESGMKQGAQVTVKRF  376



>ref|XP_010257398.1| PREDICTED: uncharacterized protein LOC104597515 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 194/233 (83%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EGSMNSSNPYFSSSWRRNF
Sbjct  150  ANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSSWRRNF  209

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD TLPPPDNI +LFQLENGCSGVF M
Sbjct  210  TGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTTLPPPDNICSLFQLENGCSGVFVM  269

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS Y  DG+ +S FYPF GV EELK 
Sbjct  270  AVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSFYTADGRCESSFYPFSGVNEELKA  329

Query  260  FLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DI  +  K  G  + EPR SF+EG RD+AVLEAMLESG ++GA V VK+F
Sbjct  330  FVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAMLESGMKQGAQVTVKRF  382



>ref|XP_010091995.1| Uncharacterized protein L484_007981 [Morus notabilis]
 gb|EXB48401.1| Uncharacterized protein L484_007981 [Morus notabilis]
Length=352

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N+  KPIWAVAENYRFEPAF E KK++AE+GDMM+VQVIIEGSMNSSNPYFSSSWRRNF
Sbjct  121  VNVPSKPIWAVAENYRFEPAFVESKKLVAEVGDMMSVQVIIEGSMNSSNPYFSSSWRRNF  180

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAG+RMLVG EV SVSA TSHVDKTLPPPDNIS+LFQLENGCSGVF +
Sbjct  181  SGGFILDMGVHFVAGMRMLVGSEVVSVSAATSHVDKTLPPPDNISSLFQLENGCSGVFVV  240

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS SPKI+WRVVGL GTL+VERG  DG+HGY VS Y  DGQ KS FY F GV EE K+
Sbjct  241  VVSSSSPKILWRVVGLKGTLQVERGKHDGQHGYLVSFYGADGQSKSTFYRFSGVTEEFKS  300

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DIS A+ KGG    EPR+SFVEG RD+AVLEAMLESG ++GA V VKKF
Sbjct  301  FIHDISQASVKGGVHVAEPRMSFVEGARDVAVLEAMLESGAKQGAPVHVKKF  352



>ref|XP_009145584.1| PREDICTED: uncharacterized protein YMR315W [Brassica rapa]
Length=355

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 193/232 (83%), Gaps = 5/232 (2%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T+   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN 
Sbjct  129  TDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNL  188

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF M
Sbjct  189  DGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLENGCSGVFVM  248

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF GV EELK 
Sbjct  249  VVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKA  308

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F +DIS     G   + EPRLS+VEG RD+AVLEAMLESG R GA++ VKKF
Sbjct  309  FFNDIS-----GASKEQEPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF  355



>ref|XP_008358864.1| PREDICTED: uncharacterized protein YMR315W-like isoform X2 [Malus 
domestica]
Length=351

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 192/232 (83%), Gaps = 1/232 (0%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFF  618
            N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR+F 
Sbjct  120  NAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRRDFA  179

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF MV
Sbjct  180  GGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVFVMV  239

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
            VSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ  S FY F GV EE + F
Sbjct  240  VSSRSPKIVWRFSGLKGTLQIERGNQDGQHGYVVLFYGSDGQSTSSFYQFSGVDEEFRAF  299

Query  257  LSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             +DI+ A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  300  FNDITQATLKKGTSYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  351



>ref|XP_008449757.1| PREDICTED: uncharacterized protein YMR315W [Cucumis melo]
Length=355

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 194/232 (84%), Gaps = 3/232 (1%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N  ++P+WAVAENYRFEPA  ECK +IA++GDMM+VQVI+EGSMNSSNPYFSSSWRR+F
Sbjct  127  ANFLRQPLWAVAENYRFEPALVECKNLIADVGDMMSVQVIVEGSMNSSNPYFSSSWRRDF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRMLVGCEV SVSA TS+VDK+LPPPDNIS+LFQLENGCSGVF M
Sbjct  187  AGGFILDMGVHFIAGLRMLVGCEVVSVSATTSYVDKSLPPPDNISSLFQLENGCSGVFVM  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS     G  +  F+PF GV EELKT
Sbjct  247  VVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSFTDASGLNRCTFHPFSGVTEELKT  306

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+  IS    +G + K + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  307  FIHAIS---AEGSDDKADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  355



>ref|XP_008358862.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
 ref|XP_008358863.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
Length=357

 Score =   326 bits (836),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 192/232 (83%), Gaps = 1/232 (0%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFF  618
            N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR+F 
Sbjct  126  NAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRRDFA  185

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF MV
Sbjct  186  GGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVFVMV  245

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
            VSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ  S FY F GV EE + F
Sbjct  246  VSSRSPKIVWRFSGLKGTLQIERGNQDGQHGYVVLFYGSDGQSTSSFYQFSGVDEEFRAF  305

Query  257  LSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             +DI+ A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  306  FNDITQATLKKGTSYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  357



>gb|KFK39395.1| hypothetical protein AALP_AA3G239500 [Arabis alpina]
Length=356

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 192/232 (83%), Gaps = 5/232 (2%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             + T+ PIWAVAENYRFEPAF E KK+I EIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN 
Sbjct  130  ADSTRCPIWAVAENYRFEPAFVELKKLIGEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNL  189

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVHY+AGLRMLVGCE+TSVSA TSHVDKTLP PDNI++ FQLENGCSGVF M
Sbjct  190  GGGFILDMGVHYIAGLRMLVGCEITSVSATTSHVDKTLPAPDNITSNFQLENGCSGVFVM  249

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPFCGV EELK 
Sbjct  250  VVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATVYEEGGTSRTIFYPFCGVTEELKA  309

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG R  A+V V KF
Sbjct  310  FFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGARNRAVVPVAKF  356



>ref|XP_006406349.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
 gb|ESQ47802.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
Length=356

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 190/227 (84%), Gaps = 4/227 (2%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++AE GDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  134  RPIWAVAENYRFEPAFVELKKLVAETGDMMNVQLIIEGSMNSSNPYFSSSWRRNLGGGFI  193

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF MVVSSR
Sbjct  194  LDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLENGCSGVFVMVVSSR  253

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF GV EELK F SDI
Sbjct  254  SPKILWRVVGLKGTVQLERGVQDGRHGYMATIYGEGGTSRTIFYPFSGVTEELKAFFSDI  313

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S    +  + + EPRLS+VEG  D+AVLEAMLESG R GA+V V KF
Sbjct  314  S----ETSKNEQEPRLSYVEGAHDVAVLEAMLESGARNGAVVPVTKF  356



>gb|AFK46300.1| unknown [Lotus japonicus]
Length=359

 Score =   323 bits (828),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 191/226 (85%), Gaps = 2/226 (1%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            +W+VAENYRFEPA  ECKK+IA+IG MM+VQVIIEGSMNSSNPYFSSSWRRNF GGFILD
Sbjct  135  VWSVAENYRFEPALVECKKLIADIGKMMSVQVIIEGSMNSSNPYFSSSWRRNFTGGFILD  194

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LENGCSGVF MVVSSR+P
Sbjct  195  MGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLENGCSGVFVMVVSSRTP  254

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISL  240
            KI+WRVVGLNGTL++ERG + G+HGY VS Y  DGQ KS F+PF GV EELK F +D+  
Sbjct  255  KILWRVVGLNGTLQIERGFQ-GQHGYLVSSYGADGQCKSSFFPFSGVTEELKAFFNDVFE  313

Query  239  AN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            +N  KG     E RLSFVEG RD+AVLEAMLESG R+G LV VK F
Sbjct  314  SNPEKGNNFVAEQRLSFVEGARDVAVLEAMLESGARQGELVHVKNF  359



>ref|XP_003543553.1| PREDICTED: uncharacterized protein YMR315W [Glycine max]
 gb|KHN30111.1| Hypothetical protein glysoja_010489 [Glycine soja]
Length=360

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 192/226 (85%), Gaps = 2/226 (1%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IW+VAENYRFEP   ECKK+IA IG MM+VQVIIEGSMNSSNPYFSSSWRRNF GGFILD
Sbjct  136  IWSVAENYRFEPGLVECKKLIAGIGKMMSVQVIIEGSMNSSNPYFSSSWRRNFTGGFILD  195

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LENGCSGVF MVVSSRSP
Sbjct  196  MGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLENGCSGVFVMVVSSRSP  255

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDIS-  243
            K +WRVVGLNGTL+VERG + G+HGY VS Y  DGQ KS F+PF GV EELK F++D+S 
Sbjct  256  KTLWRVVGLNGTLQVERGFQ-GQHGYLVSFYGTDGQNKSSFFPFSGVTEELKAFINDVSE  314

Query  242  LANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            +   K  +   EPRLS+VEG RD+AVLEAMLESG R+G LV++KKF
Sbjct  315  ITLKKRNQFVTEPRLSYVEGARDVAVLEAMLESGARQGELVRLKKF  360



>ref|XP_006298014.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
 gb|EOA30912.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
Length=355

 Score =   321 bits (822),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 190/227 (84%), Gaps = 4/227 (2%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  133  RPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFI  192

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVHY+AGLRMLVGCEV SVSA TSHVDKTLP PDNI++ FQLENGCSGVF MVVSSR
Sbjct  193  LDMGVHYIAGLRMLVGCEVASVSASTSHVDKTLPGPDNITSNFQLENGCSGVFVMVVSSR  252

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EELK F +DI
Sbjct  253  SPKILWRVVGLKGTVQLERGVEGGRHGYMTTIYGEGGTTRTIFYPFSGVTEELKAFFNDI  312

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S  + K    + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  313  SDTSKK----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVPKF  355



>ref|XP_010488066.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=355

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 190/227 (84%), Gaps = 5/227 (2%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  134  RPIWAVAENYRFEPAFVELKKLVVEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFI  193

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF MVVSSR
Sbjct  194  LDMGVHFIAGLRMLVGCEVTSVSAATSHVDKTLPGPDNITSNFQLENGCSGVFVMVVSSR  253

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVGL GT+++ERG + G+HGY  ++Y G G  ++ FYPF GV EELK F +DI
Sbjct  254  SPKILWRVVGLKGTVQLERGVEGGRHGYMATIYGGGGTSRTIFYPFSGVTEELKAFFNDI  313

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  314  SETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVTKF  355



>ref|NP_188715.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAM12966.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15398.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76423.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 190/227 (84%), Gaps = 5/227 (2%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  134  RPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFI  193

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVHY+AGLRMLVGCEVTSVSA T+HVDKTLP PDNI++ FQLENGCSGVF MVVSSR
Sbjct  194  LDMGVHYIAGLRMLVGCEVTSVSATTTHVDKTLPGPDNITSNFQLENGCSGVFVMVVSSR  253

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WR+VGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EELK F +DI
Sbjct  254  SPKILWRIVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFSGVTEELKAFFNDI  313

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  314  SETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVNKF  355



>gb|KJB66097.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=357

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  131  QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  190

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  191  LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  250

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  251  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  310

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN KG   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  311  VQANLKGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  357



>ref|XP_004486934.1| PREDICTED: uncharacterized protein YMR315W-like [Cicer arietinum]
Length=361

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 192/227 (85%), Gaps = 4/227 (2%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IW+VAENYRFEPA  E KK+IA IG MM+VQVIIEGSMNSSNPYFSSSWRRNF GGFILD
Sbjct  137  IWSVAENYRFEPALVEGKKLIAGIGKMMSVQVIIEGSMNSSNPYFSSSWRRNFTGGFILD  196

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVH++AGLRMLVGCEV SVSAMTSHVD TLPPPDN+S++F LENGCSGVF MVVSSRSP
Sbjct  197  MGVHFIAGLRMLVGCEVVSVSAMTSHVDLTLPPPDNLSSVFHLENGCSGVFVMVVSSRSP  256

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISL  240
            KI+WRVVG+NGTL++ERG + G+HGY VSLY  +G+ KS FYPF GV EELK F +D+S 
Sbjct  257  KILWRVVGMNGTLQIERGFQ-GQHGYLVSLYDANGESKSSFYPFSGVTEELKAFFNDVS-  314

Query  239  ANT--KGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             NT  K  +   E RLS+VEG RD+A+LEAMLESG R+G LV VKKF
Sbjct  315  ENTLKKDSQFVAEHRLSYVEGARDVAILEAMLESGSRKGELVHVKKF  361



>ref|XP_010913917.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913918.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913919.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
Length=364

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 187/229 (82%), Gaps = 2/229 (1%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E +K+I EIGDMMN+QVI+EGSMNSSNPYFSSSWRR F GGFI
Sbjct  136  QPIWAVAENYRFEPAFVEARKLINEIGDMMNIQVIVEGSMNSSNPYFSSSWRRKFIGGFI  195

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCE+T+VSA+  HVD  LPPPDN+ ALFQLENGC+GVF M VSS 
Sbjct  196  LDMGVHFIAGLRMIVGCEITTVSAIARHVDMALPPPDNLCALFQLENGCAGVFVMAVSST  255

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI WRV G NGTL++ERG+ +G+HGY V LY  DG  +  F+PF GV EELK F+ DI
Sbjct  256  SPKIYWRVDGSNGTLQIERGSDNGQHGYMVLLYKADGHCQRTFHPFSGVNEELKAFVHDI  315

Query  245  SLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + A TK G    K EPR S+VEG RD+AVLEAML+S ++EGA V VKKF
Sbjct  316  TQATTKEGVAGQKAEPRSSYVEGARDVAVLEAMLDSSRKEGAQVHVKKF  364



>gb|KJB66094.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=288

 Score =   316 bits (809),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  61   QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  120

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  121  LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  180

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  181  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  240

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  241  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  288



>ref|XP_003597479.1| Oxidoreductase, putative [Medicago truncatula]
 gb|AES67730.1| oxidoreductase family, NAD-binding rossmann fold protein [Medicago 
truncatula]
Length=356

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IW+VAENYRFEPA  E KK+IA++G MM+VQVIIEGSMNSSNPYFSSSWRRNF GGFILD
Sbjct  134  IWSVAENYRFEPALVEGKKLIADLGKMMSVQVIIEGSMNSSNPYFSSSWRRNFTGGFILD  193

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVH++AGLRMLVGCEV SVSAMTSHVD TLPPPDNIS++F LENGCSGVF MVVSSRSP
Sbjct  194  MGVHFIAGLRMLVGCEVVSVSAMTSHVDFTLPPPDNISSVFHLENGCSGVFVMVVSSRSP  253

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISL  240
            KI+WRVVG+NGTL++ERG + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S 
Sbjct  254  KILWRVVGMNGTLQIERGFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVSE  312

Query  239  ANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
               K G  + E RLSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  313  NTLKKG-SQPEHRLSFVEGARDVALLEAMLESGSKKGELVHVKKF  356



>ref|XP_007150403.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
 gb|ESW22397.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
Length=383

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 192/227 (85%), Gaps = 4/227 (2%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IW+VAENYRFE    ECKK+I  IG MM+VQVIIEGSMNSSNPYFSS+WRR F GGFI+D
Sbjct  159  IWSVAENYRFESGLLECKKLIGGIGKMMSVQVIIEGSMNSSNPYFSSNWRRKFTGGFIVD  218

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVHY+AGLRMLVGCEV SVSAMTSHVD TLPPPDNIS++F LENGCSGVF MVVSSR+P
Sbjct  219  MGVHYIAGLRMLVGCEVVSVSAMTSHVDLTLPPPDNISSVFHLENGCSGVFVMVVSSRTP  278

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISL  240
            K +WRVVGLNGTL+VERG + G+HGY VSLY  DGQ +S F+PF GV EELK F++D+S 
Sbjct  279  KTLWRVVGLNGTLQVERGFQ-GEHGYLVSLYGADGQNQSSFFPFGGVTEELKAFINDVS-  336

Query  239  ANT--KGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             NT  KG +   EPRLSFVEG RD+AVLEAMLESG ++G LVQVKKF
Sbjct  337  ENTLKKGSQFVPEPRLSFVEGARDVAVLEAMLESGAKQGELVQVKKF  383



>ref|XP_010466287.1| PREDICTED: uncharacterized protein LOC104746495 [Camelina sativa]
Length=235

 Score =   312 bits (799),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 189/228 (83%), Gaps = 5/228 (2%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGF  609
             +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGF
Sbjct  13   SRPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGF  72

Query  608  ILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            ILDMGVH++AGLRMLVGCEVT VSA TSHVDKTLP PDNI++ FQLENGCSGVF MVVSS
Sbjct  73   ILDMGVHFIAGLRMLVGCEVTLVSAATSHVDKTLPGPDNITSNFQLENGCSGVFVMVVSS  132

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
            RSPKI+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EELK F +D
Sbjct  133  RSPKILWRVVGLKGTIQLERGVEGGRHGYLATIYGEGGTSRTIFYPFSGVTEELKAFFND  192

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            IS  N+K    + EPRLS+VEG RD+AVLEAMLESG + GA+V V K 
Sbjct  193  IS-ENSK----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVTKL  235



>gb|KJB66101.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=259

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  32   QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  91

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  92   LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  151

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  152  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  211

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  212  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  259



>ref|XP_010544236.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Tarenaya 
hassleriana]
Length=355

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 190/225 (84%), Gaps = 4/225 (2%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IWAVAENYRFEPAF E KK++ EIG MMNVQ+I+EGSMNSSNPYFSSSWRRN  GGFILD
Sbjct  135  IWAVAENYRFEPAFVELKKLVGEIGTMMNVQLIVEGSMNSSNPYFSSSWRRNLGGGFILD  194

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVHY+AGLRMLVGCEVTSVSA T+HVD +LP PDNI++ FQLENGCSGVF MVVSS+SP
Sbjct  195  MGVHYIAGLRMLVGCEVTSVSATTTHVDTSLPAPDNITSNFQLENGCSGVFVMVVSSKSP  254

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISL  240
            KI+WRVVGL GT+++ERG ++G+HGY  ++Y   G+ ++ FYPF GV EELK F  D+S 
Sbjct  255  KILWRVVGLKGTVQLERGMQEGRHGYLATVYSDRGETRTIFYPFSGVTEELKAFFHDVSQ  314

Query  239  ANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            A+      +GEPRLS++EG RD+AVLEAMLESG ++GALV VK+F
Sbjct  315  ASA----SEGEPRLSYLEGARDVAVLEAMLESGAKDGALVPVKRF  355



>ref|XP_010509356.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=354

 Score =   316 bits (809),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 190/227 (84%), Gaps = 5/227 (2%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  133  RPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFI  192

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF MVVSSR
Sbjct  193  LDMGVHFIAGLRMLVGCEVTSVSAATSHVDKTLPGPDNITSNFQLENGCSGVFVMVVSSR  252

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EELK F +DI
Sbjct  253  SPKILWRVVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFSGVTEELKAFFNDI  312

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S  +      + EPRLS+VEG RD+AVLEAMLESG++ GA+V V KF
Sbjct  313  SETSK-----EQEPRLSYVEGARDVAVLEAMLESGEKNGAVVTVTKF  354



>ref|XP_010544235.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 190/225 (84%), Gaps = 3/225 (1%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IWAVAENYRFEPAF E KK++ EIG MMNVQ+I+EGSMNSSNPYFSSSWRRN  GGFILD
Sbjct  135  IWAVAENYRFEPAFVELKKLVGEIGTMMNVQLIVEGSMNSSNPYFSSSWRRNLGGGFILD  194

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSP  420
            MGVHY+AGLRMLVGCEVTSVSA T+HVD +LP PDNI++ FQLENGCSGVF MVVSS+SP
Sbjct  195  MGVHYIAGLRMLVGCEVTSVSATTTHVDTSLPAPDNITSNFQLENGCSGVFVMVVSSKSP  254

Query  419  KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISL  240
            KI+WRVVGL GT+++ERG ++G+HGY  ++Y   G+ ++ FYPF GV EELK F  D+S 
Sbjct  255  KILWRVVGLKGTVQLERGMQEGRHGYLATVYSDRGETRTIFYPFSGVTEELKAFFHDVSQ  314

Query  239  ANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            A+      +GEPRLS++EG RD+AVLEAMLESG ++GALV VK+F
Sbjct  315  ASAS---QEGEPRLSYLEGARDVAVLEAMLESGAKDGALVPVKRF  356



>gb|KJB66099.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  131  QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  190

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  191  LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  250

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  251  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  310

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  311  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  358



>gb|KJB66096.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=352

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  125  QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  184

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  185  LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  244

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  245  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  304

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  305  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  352



>gb|KHG07862.1| Uncharacterized protein F383_13730 [Gossypium arboreum]
Length=353

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  126  QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  185

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  186  LDMGVHFIAGLRMMVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  245

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  G+++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  246  SPKIIWRVVGSKGSVQVERGKVDGKHGYLVSLYSADGQSKSTFHPFCGVHEELKFFIHDI  305

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  306  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  353



>ref|XP_008787293.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787294.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787295.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787297.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787298.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787299.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787300.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
Length=364

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFF  618
            +   +PIWAVAENYRFEPAF E +K++ EIGDM+N+QVI+EGSMNSSNPYFSSSWRR F 
Sbjct  132  HFPSQPIWAVAENYRFEPAFVEARKLVNEIGDMINIQVIVEGSMNSSNPYFSSSWRRKFA  191

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILDMGVH++AGLRM+VGCE+T+VSA+  HVD  LPPPDN+ ALFQ+ENGC+GVF MV
Sbjct  192  GGFILDMGVHFIAGLRMIVGCEITTVSAIARHVDMALPPPDNLCALFQVENGCAGVFVMV  251

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
            VSS SPKI WRV G NGTL++ERG+ +G+HGY V LY  DG  +  F+PF GV EELK F
Sbjct  252  VSSASPKIYWRVDGSNGTLQIERGSDNGQHGYMVLLYKADGHCQRTFHPFSGVNEELKAF  311

Query  257  LSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + DI+ A +K G    K EPR S+VEG RD+AVLEAMLES +++GA V VK F
Sbjct  312  VQDITQATSKEGVAGQKAEPRSSYVEGARDVAVLEAMLESSRKQGAQVHVKNF  364



>ref|XP_010673579.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 188/229 (82%), Gaps = 3/229 (1%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGG  612
            + KPIWAVAENYRFEP F E +K++ EIGDMM+VQVI+EGS+NSSNPYFSSSWRRNF GG
Sbjct  130  SSKPIWAVAENYRFEPGFIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYFSSSWRRNFNGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            FILDMGVH +A LRMLVGCE+ SVSA+T+HVD TLPPPDNIS+ +QLENGC G+F M VS
Sbjct  190  FILDMGVHMIAALRMLVGCEMKSVSALTTHVDTTLPPPDNISSTYQLENGCPGIFVMAVS  249

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            +RSPK  WRVVGL GT+++ERGN DG+HGY VS +  DGQ  S F+PF GV EELKTFL 
Sbjct  250  TRSPKTFWRVVGLKGTVQIERGNIDGRHGYLVSKFNVDGQCTSSFHPFSGVTEELKTFLH  309

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            DIS A+      K + RLS+VEG RD+AVLEAMLESG + GA+V VK+F
Sbjct  310  DISEASNNH---KPDRRLSYVEGARDVAVLEAMLESGMKGGAVVPVKRF  355



>ref|XP_002459955.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
 gb|EER96476.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
Length=364

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 186/228 (82%), Gaps = 1/228 (0%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGF  609
             KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEGSMNSSNPYF+S+WRRNF GGF
Sbjct  138  HKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFNSTWRRNFVGGF  197

Query  608  ILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            ILDMGVH++AGLRMLVG E+TSVS+++ HVD TLPPPDNI +LFQLENGC+GVF   V+S
Sbjct  198  ILDMGVHFIAGLRMLVGSEITSVSSISRHVDMTLPPPDNICSLFQLENGCAGVFVFAVNS  257

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
            RSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV EELKTF+ D
Sbjct  258  RSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVNEELKTFVHD  317

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + LA  K G+ K EPR S+VEG RD+AVLEAMLES  ++GA VQVK+F
Sbjct  318  M-LAADKDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGAPVQVKRF  364



>ref|XP_010673578.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 188/229 (82%), Gaps = 3/229 (1%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGG  612
            + KPIWAVAENYRFEP F E +K++ EIGDMM+VQVI+EGS+NSSNPYFSSSWRRNF GG
Sbjct  135  SSKPIWAVAENYRFEPGFIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYFSSSWRRNFNGG  194

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            FILDMGVH +A LRMLVGCE+ SVSA+T+HVD TLPPPDNIS+ +QLENGC G+F M VS
Sbjct  195  FILDMGVHMIAALRMLVGCEMKSVSALTTHVDTTLPPPDNISSTYQLENGCPGIFVMAVS  254

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            +RSPK  WRVVGL GT+++ERGN DG+HGY VS +  DGQ  S F+PF GV EELKTFL 
Sbjct  255  TRSPKTFWRVVGLKGTVQIERGNIDGRHGYLVSKFNVDGQCTSSFHPFSGVTEELKTFLH  314

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            DIS A+      K + RLS+VEG RD+AVLEAMLESG + GA+V VK+F
Sbjct  315  DISEASNNH---KPDRRLSYVEGARDVAVLEAMLESGMKGGAVVPVKRF  360



>ref|NP_001062764.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAD26513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24678.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAG93408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84244.1| hypothetical protein OsI_30682 [Oryza sativa Indica Group]
Length=359

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            KPIWA+AENYRFEPAF E +K++++IGDMMN+QVI+EGSMNSSNPYF+SSWRRNF GGFI
Sbjct  134  KPIWALAENYRFEPAFVESRKLMSDIGDMMNIQVIVEGSMNSSNPYFNSSWRRNFVGGFI  193

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VG E+ +VS+++ HVDK LPPPDNI +LFQLENGC+GVF   V+SR
Sbjct  194  LDMGVHFIAGLRMMVGSEIATVSSISRHVDKALPPPDNICSLFQLENGCAGVFVFAVNSR  253

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            +PKI+WRV G  GT+++ERG   GKHGY V     +GQ ++ FYPFCGV EELK F+ DI
Sbjct  254  TPKILWRVDGTRGTVQIERGIASGKHGYQVLFTNENGQCQTTFYPFCGVNEELKAFVHDI  313

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G+ K EPR S+VEG RD+AVLEAMLES  ++G +VQVKKF
Sbjct  314  VQAN-KDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGTMVQVKKF  359



>ref|XP_002883268.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59527.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=360

 Score =   310 bits (795),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 188/233 (81%), Gaps = 11/233 (5%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK+IAE GDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  133  RPIWAVAENYRFEPAFVELKKLIAETGDMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFI  192

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVHY+AGLRMLVGCEV SVSA TSHVDKTLP PDNI++ FQLENGCSGVF MVVSSR
Sbjct  193  LDMGVHYIAGLRMLVGCEVASVSATTSHVDKTLPGPDNITSNFQLENGCSGVFVMVVSSR  252

Query  425  SPK------IVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            SPK      I+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EELK
Sbjct  253  SPKACSKTWILWRVVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFSGVTEELK  312

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  313  AFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVTKF  360



>ref|XP_004956459.1| PREDICTED: uncharacterized protein YMR315W-like [Setaria italica]
Length=365

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            KPIWA+ ENYRFEPAF E  K+I +IGDMMN+QVIIEGSMNSSNPYF+SSWRRNF GGFI
Sbjct  139  KPIWALGENYRFEPAFVESSKLIKDIGDMMNIQVIIEGSMNSSNPYFNSSWRRNFVGGFI  198

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVG E+TSVS+++ HVD +LPPPDNI +LFQLENGC+GVF   V+SR
Sbjct  199  LDMGVHFIAGLRMLVGSEITSVSSISRHVDMSLPPPDNICSLFQLENGCAGVFVFAVNSR  258

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV EELKTF+ D+
Sbjct  259  SPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVNEELKTFVQDM  318

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             LA +K G+ K EPR S+VEG RD+AVLEAMLES  ++G  VQVK+F
Sbjct  319  -LAASKDGDHKAEPRSSYVEGARDVAVLEAMLESSVKQGTPVQVKRF  364



>ref|XP_009385566.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=364

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 184/234 (79%), Gaps = 2/234 (1%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N   +P+WA+AENYRFEPAF E +K++ +IGDMM+VQVIIEGSMNSSNPYFSSSWRRN+
Sbjct  131  NNFPHQPVWALAENYRFEPAFVESRKLLNDIGDMMHVQVIIEGSMNSSNPYFSSSWRRNY  190

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            FGGFILDMGVH+VAGLRM+VGCE+++VSA+  HVD  LPPPDNI ALFQLENGC+GVF M
Sbjct  191  FGGFILDMGVHFVAGLRMMVGCEISTVSAIARHVDMALPPPDNICALFQLENGCAGVFVM  250

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             V+S SPKI WR+ G  GTL++ERG   G+HGYSV  Y   G  +  FYPFCGV EELK+
Sbjct  251  AVNSISPKIYWRIDGSKGTLQIERGTDSGRHGYSVLFYTAGGHCQRTFYPFCGVNEELKS  310

Query  260  FLSDISLANTKGG--ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DIS AN K G    + EPR  + EG RD+AVLEAMLES  ++GA V VKK 
Sbjct  311  FIHDISQANRKDGMTSHEPEPRSLYKEGARDVAVLEAMLESSAKQGAAVHVKKL  364



>ref|XP_007014899.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
 gb|EOY32518.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
Length=358

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK+IA+IGDMMNVQ+IIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  131  QPIWAVAENYRFEPAFVESKKLIADIGDMMNVQIIIEGSMNSSNPYFSSSWRRNFEGGFI  190

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH D TLPPPD IS+ FQLENGCSGVF +VVSS 
Sbjct  191  LDMGVHFIAGLRMMVGCEVTSVSAITSHRDTTLPPPDIISSNFQLENGCSGVFVLVVSSS  250

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPK++WRVVGL GT++VERG ++G+HGY VSLY  DGQ KS FYPFCGV EELK F+ DI
Sbjct  251  SPKVIWRVVGLKGTVQVERGKQEGRHGYLVSLYSADGQCKSTFYPFCGVHEELKAFIHDI  310

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              A  K G   + EPR SFVEG RD+AVLEAMLESG + GALV VKK 
Sbjct  311  LQATVKEGSGYEAEPRSSFVEGARDVAVLEAMLESGNKGGALVHVKKL  358



>gb|KJB66095.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 192/228 (84%), Gaps = 1/228 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF   FI
Sbjct  131  QPIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEVCFI  190

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  191  LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  250

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  251  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  310

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  311  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  358



>gb|KJB66098.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=356

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 193/228 (85%), Gaps = 3/228 (1%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E  K++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFI
Sbjct  131  QPIWAVAENYRFEPAFVE--KLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFI  188

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS 
Sbjct  189  LDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSS  248

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI
Sbjct  249  SPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDI  308

Query  245  SLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  309  VQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  356



>ref|XP_006660493.1| PREDICTED: uncharacterized protein YMR315W-like [Oryza brachyantha]
Length=359

 Score =   308 bits (788),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWA+AENYRFEPAF E +K++ +IGDMMN+QVI+EGSMNSSNPYF+SSWRRNF GGFI
Sbjct  134  RPIWALAENYRFEPAFVESRKLMNDIGDMMNIQVIVEGSMNSSNPYFNSSWRRNFVGGFI  193

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVG E+ +VS+++ HVDK LPPPDNI +LFQLENGC+GVF   ++SR
Sbjct  194  LDMGVHFIAGLRMLVGSEIATVSSISRHVDKALPPPDNICSLFQLENGCAGVFVFAINSR  253

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRV G  GT+++ERG   GKHGY V  +  + Q ++ FYPFCGV EELK F+ DI
Sbjct  254  SPKILWRVDGTKGTVQIERGIAGGKHGYQVLFFSENAQCQTTFYPFCGVNEELKAFVHDI  313

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
               N K G+ K EPR S+VEG RD+AVLEAML+S  ++GA VQVKKF
Sbjct  314  VQTN-KDGDHKAEPRSSYVEGARDVAVLEAMLKSSAKQGATVQVKKF  359



>ref|NP_001149836.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
 gb|ACG36942.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 184/228 (81%), Gaps = 1/228 (0%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGF  609
             KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEGSMNSSNPYF+S+WRRNF GGF
Sbjct  138  HKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFNSTWRRNFVGGF  197

Query  608  ILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            ILDMGVH++AGLRMLVG E+TSVS+++ HVD  LPPPDNI +LFQLENGC+GVF   V+S
Sbjct  198  ILDMGVHFIAGLRMLVGSEITSVSSISRHVDMALPPPDNICSLFQLENGCAGVFVFAVNS  257

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
            RSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV EELKTF+ D
Sbjct  258  RSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVNEELKTFVHD  317

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + L   K G+ K EPR S+VEG RD+AVLEAMLES  ++GA VQVK+F
Sbjct  318  M-LEAGKDGDHKAEPRGSYVEGARDVAVLEAMLESSAKQGAPVQVKRF  364



>ref|XP_003577920.1| PREDICTED: uncharacterized protein LOC100827110 [Brachypodium 
distachyon]
Length=360

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 184/227 (81%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            KPIWA+AENYRFEPAF E  K++++IGDMMN+QVI+EGSMNSSNPYF+SSWRRNF GGF+
Sbjct  135  KPIWALAENYRFEPAFVESNKLMSDIGDMMNIQVIVEGSMNSSNPYFNSSWRRNFVGGFV  194

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVG EV +VS+++ HVD  LPPPDNI +LFQLENGC+GVF   V+SR
Sbjct  195  LDMGVHFIAGLRMLVGSEVATVSSISRHVDTALPPPDNICSLFQLENGCAGVFVFAVNSR  254

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRV G  GT+++ERG   GKHGY V     +GQ +  FYPFCGV EELK F+ DI
Sbjct  255  SPKILWRVDGTKGTVQIERGIDSGKHGYQVLFSHENGQCQKTFYPFCGVNEELKAFVHDI  314

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             L  +K  + K EPR S+VEG RD+AVLEAMLES  ++GALVQVKK 
Sbjct  315  -LQASKDVDHKAEPRSSYVEGVRDVAVLEAMLESSTKQGALVQVKKL  360



>emb|CDY19604.1| BnaA05g20120D [Brassica napus]
Length=347

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 183/227 (81%), Gaps = 13/227 (6%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN  GGFI
Sbjct  134  RPIWAVAENYRFEPAFVELKKLVEEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNLDGGFI  193

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF M     
Sbjct  194  LDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLENGCSGVFVM-----  248

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
               I+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF GV EELK F +DI
Sbjct  249  ---ILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKAFFNDI  305

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S     G   + EPRLS+VEG RD+AVLEAMLESG R GA++ VKKF
Sbjct  306  S-----GASKEQEPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF  347



>ref|XP_008668038.1| PREDICTED: NAD-dependent dyhydrogenase, Gfo/Idh/MocA family isoform 
X1 [Zea mays]
 tpg|DAA39396.1| TPA: NAD-dependent dihydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 183/228 (80%), Gaps = 1/228 (0%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGF  609
             KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEGSMNSSNPYF+S+WRRNF GGF
Sbjct  138  HKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFNSTWRRNFVGGF  197

Query  608  ILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            ILDMGVH++AGLRMLVG E+TSVS+++ HVD  LPPPDNI +LFQLENGC+GVF   V+S
Sbjct  198  ILDMGVHFIAGLRMLVGSEITSVSSISRHVDMALPPPDNICSLFQLENGCAGVFVFAVNS  257

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
            RSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV EELKTF+ D
Sbjct  258  RSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVNEELKTFVHD  317

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + L   K G+ K  PR S+VEG RD+AVLEAMLES  ++GA VQVK+F
Sbjct  318  M-LEAGKDGDHKAAPRGSYVEGARDVAVLEAMLESSAKQGAPVQVKRF  364



>emb|CDY06381.1| BnaC05g31490D [Brassica napus]
Length=348

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 185/232 (80%), Gaps = 12/232 (5%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T+   +PIWAVAENYRFEPAF E KK++ EIGD+MNVQ+IIEGSMNSSNPYFSSSWRRN 
Sbjct  129  TDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDIMNVQLIIEGSMNSSNPYFSSSWRRNL  188

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF M
Sbjct  189  DGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLENGCSGVFVM  248

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            V       I+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF GV EELK 
Sbjct  249  V-------ILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKA  301

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F  DIS     G   + EPRLS+VEG RD+AVLEAMLESG R GA++ VKKF
Sbjct  302  FFRDIS-----GTSKEQEPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF  348



>gb|EMT01460.1| hypothetical protein F775_26364 [Aegilops tauschii]
Length=355

 Score =   300 bits (768),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 181/227 (80%), Gaps = 1/227 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            KPIWAV ENYRFEPAF E  K++ +IGDMMN+QVI+EGSMNSSNPYF+SSWRRNF GGFI
Sbjct  130  KPIWAVGENYRFEPAFVESSKLMDDIGDMMNIQVIVEGSMNSSNPYFNSSWRRNFVGGFI  189

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVG EV +VS+++ HVD  LPPPDNI +LFQLENGC+GV    V SR
Sbjct  190  LDMGVHFIAGLRMLVGSEVATVSSISRHVDTDLPPPDNICSLFQLENGCAGVLVFAVKSR  249

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI+WRV G  GT+++ERG   GKHGY V      G+ +  FYPFCGV EELK F+ D+
Sbjct  250  SPKILWRVDGTKGTVQIERGVDGGKHGYQVLFSNESGECQKTFYPFCGVHEELKAFVHDM  309

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              A +K G+ K EPR S+VEG RD+AVLEAMLES  ++GA+VQVKKF
Sbjct  310  VQA-SKDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGAMVQVKKF  355



>ref|XP_007205433.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
 gb|EMJ06632.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
Length=356

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 186/233 (80%), Gaps = 5/233 (2%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N+  KPIWAVAENYRFEPAF E KK++ +IGD+M++QV++EGSMNSSNPYFSSSWRRNF
Sbjct  127  ANIPDKPIWAVAENYRFEPAFVEGKKLVNDIGDVMSIQVLVEGSMNSSNPYFSSSWRRNF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
                 + M ++    L+ L GCE+ SVSA+TSHVDKTLP PDN+S+LFQLENGCSGVF M
Sbjct  187  ----TVRMNLNMSCSLQQLAGCELVSVSAITSHVDKTLPAPDNVSSLFQLENGCSGVFVM  242

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
            VVSSRSPKIVWR VGL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV EE K 
Sbjct  243  VVSSRSPKIVWRFVGLKGTLQIERGNQDGRHGYLVLFYGSDGQSKSSFYQFSGVDEEFKA  302

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F++DIS AN  KG   + EPR+SF+EG RD+AVLEAMLESG ++GA V VKK+
Sbjct  303  FINDISQANLRKGTGYEAEPRMSFLEGARDVAVLEAMLESGGKQGAPVHVKKY  355



>gb|EEE69341.1| hypothetical protein OsJ_28659 [Oryza sativa Japonica Group]
Length=364

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 185/232 (80%), Gaps = 6/232 (3%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF-----  621
            KPIWA+AENYRFEPAF E +K++++IGDMMN+QVI+EGSMNSSNPYF+SS  + F     
Sbjct  134  KPIWALAENYRFEPAFVESRKLMSDIGDMMNIQVIVEGSMNSSNPYFNSSLEKKFCGKNQ  193

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH++AGLRM+VG E+ +VS+++ HVDK LPPPDNI +LFQLENGC+GVF  
Sbjct  194  VGGFILDMGVHFIAGLRMMVGSEIATVSSISRHVDKALPPPDNICSLFQLENGCAGVFVF  253

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             V+SR+PKI+WRV G  GT+++ERG   GKHGY V     +GQ ++ FYPFCGV EELK 
Sbjct  254  AVNSRTPKILWRVDGTRGTVQIERGIASGKHGYQVLFTNENGQCQTTFYPFCGVNEELKA  313

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DI  AN K G+ K EPR S+VEG RD+AVLEAMLES  ++G +VQVKKF
Sbjct  314  FVHDIVQAN-KDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGTMVQVKKF  364



>ref|XP_006850072.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
 gb|ERN11653.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
Length=368

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N   +PIWAVAENYRFEPAF E +++  E+GDMM+VQVI+E SMNSSNPYFSSSWRRNF
Sbjct  136  ANFPHRPIWAVAENYRFEPAFVESQRLAKEVGDMMSVQVIVESSMNSSNPYFSSSWRRNF  195

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GGFILDMGVH+VAGLRM+VG EVTS+SA++ HVD +LPPPDN+ A+FQLENGC GV  +
Sbjct  196  AGGFILDMGVHFVAGLRMIVGYEVTSISAISRHVDTSLPPPDNVCAVFQLENGCGGVLVL  255

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             VS+RSPKI WRVVG  G++E ERG ++G+HGY+V+        +  FYPFCGV EELK 
Sbjct  256  SVSTRSPKISWRVVGSKGSVETERGIRNGQHGYTVTYSPAGEPPQCSFYPFCGVNEELKA  315

Query  260  FLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+ DIS AN K GE  + +PR +++EG RD+A++EAMLESG + G L  VKK 
Sbjct  316  FVQDISQANLKDGEAYEPDPRGTYLEGARDVALVEAMLESGLKNGELFHVKKL  368



>emb|CAN75498.1| hypothetical protein VITISV_020272 [Vitis vinifera]
Length=364

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 176/224 (79%), Gaps = 16/224 (7%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  119  QPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRRNFTGGFI  178

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++F L               
Sbjct  179  LDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFPL---------------  223

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
              +I WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EELKTF+ DI
Sbjct  224  YLQIFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEELKTFIHDI  283

Query  245  SLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  117
            S A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+Q
Sbjct  284  SQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQ  327



>ref|XP_010651283.1| PREDICTED: uncharacterized protein LOC100245027 isoform X2 [Vitis 
vinifera]
Length=322

 Score =   286 bits (733),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 173/227 (76%), Gaps = 36/227 (16%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  132  QPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRRNFTGGFI  191

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++FQLENGCSGVF MVVS+R
Sbjct  192  LDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFQLENGCSGVFVMVVSTR  251

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            +PKI WRVVGL GTL++ERGNK+G HGY                                
Sbjct  252  APKIFWRVVGLKGTLQLERGNKEGSHGYQ-------------------------------  280

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
                 KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  281  -----KGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  322



>gb|EYU18011.1| hypothetical protein MIMGU_mgv1a008840mg [Erythranthe guttata]
Length=360

 Score =   285 bits (730),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 187/234 (80%), Gaps = 2/234 (1%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T +  KPIWAVAENYRFEPAF E KK++ +IG+M+N Q+I+E  MNSS+PYFSSSWR +F
Sbjct  127  TGLPSKPIWAVAENYRFEPAFLEGKKLMGDIGEMVNFQIIVEVPMNSSSPYFSSSWRHSF  186

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GG+ILDMGVH++A LRM+ GCE+TSVSAMTS+VD TLPPPD++S+L QLENG SGV   
Sbjct  187  AGGYILDMGVHFIAALRMMAGCEITSVSAMTSNVDTTLPPPDSMSSLIQLENGRSGVLVT  246

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP-FCGVQEELK  264
            VVS+++ K+ WRVVGLNGT +++  +++GK GY V+L+  DGQ KS FYP F GV EELK
Sbjct  247  VVSAKTLKLFWRVVGLNGTFQIDVESREGKFGYLVTLFTADGQTKSNFYPGFSGVTEELK  306

Query  263  TFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             F SD++ A+ K     + E R+SF+EG RD+AV++AMLESG ++GALV VKKF
Sbjct  307  IFFSDVTQASLKKESIFEAEARMSFIEGARDLAVMDAMLESGNKQGALVHVKKF  360



>ref|XP_011090402.1| PREDICTED: uncharacterized protein YMR315W-like [Sesamum indicum]
Length=358

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            T++ ++PIWA+AENYRFEPA  E KK++ +IGD++N Q+++E  MNSSNPYFSSSWR NF
Sbjct  126  TSLPRQPIWAIAENYRFEPAILEGKKLMPDIGDLVNFQILVEAPMNSSNPYFSSSWRHNF  185

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
             GG+ILDMGVH+VA LRML GCEVTSVSAMTSHVD TLPPPD++S++ QLENG  GV   
Sbjct  186  TGGYILDMGVHFVAVLRMLAGCEVTSVSAMTSHVDTTLPPPDSMSSIIQLENGRCGVLVA  245

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
             +  ++ KI  R VG+ GTL+++  N++GK GYSVSL+  DGQ K+ +YPF GV EELKT
Sbjct  246  SLPGKTLKIFHRFVGVKGTLQIDVENREGKFGYSVSLFTADGQTKNSYYPFRGVTEELKT  305

Query  260  FLSDISLANTKGG-ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F + +SLA  K     + EPRLS +EG RD+AV+EA+LESG ++GALVQV KF
Sbjct  306  FFNVVSLATEKKDLTFRAEPRLSVIEGARDVAVIEAILESGNKQGALVQVNKF  358



>gb|EPS68382.1| hypothetical protein M569_06387, partial [Genlisea aurea]
Length=340

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 183/233 (79%), Gaps = 16/233 (7%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFF  618
            ++   PIWAVAENYRFEPAF E +K++ EIG+++N  VI+EGSMNSSNPYFSSSWRRNF 
Sbjct  122  SLPSAPIWAVAENYRFEPAFVEGRKLMTEIGNVVNFHVIVEGSMNSSNPYFSSSWRRNFD  181

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILDMG+              TSVSA TSHVD T+PPPD++S+  QL+NG SGVF MV
Sbjct  182  GGFILDMGI--------------TSVSAFTSHVDTTVPPPDHLSSTVQLDNGTSGVFVMV  227

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGD-GQIKSFFYPFCGVQEELKT  261
            VSSRSPK++WR+VGLNGTL+VERG KDGKHGY+V+L+  D  Q K++FYPF GV  EL+ 
Sbjct  228  VSSRSPKVLWRIVGLNGTLQVERGTKDGKHGYTVALFTADPSQNKNWFYPFSGVTLELEA  287

Query  260  FLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            FLSD+S+A+  K G+ + E RLSF+EG RD+AVL+AMLESG+R  + VQV KF
Sbjct  288  FLSDVSMASLNKEGDHQVEKRLSFLEGARDVAVLDAMLESGRRGSSPVQVGKF  340



>ref|XP_010913920.1| PREDICTED: uncharacterized protein LOC105039462 isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 171/229 (75%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E +K+I EIGDMMN+QVI+EGSMNSSNPYFSSSWRR F     
Sbjct  136  QPIWAVAENYRFEPAFVEARKLINEIGDMMNIQVIVEGSMNSSNPYFSSSWRRKF-----  190

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
                        ++VGCE+T+VSA+  HVD  LPPPDN+ ALFQLENGC+GVF M VSS 
Sbjct  191  ------------IIVGCEITTVSAIARHVDMALPPPDNLCALFQLENGCAGVFVMAVSST  238

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPKI WRV G NGTL++ERG+ +G+HGY V LY  DG  +  F+PF GV EELK F+ DI
Sbjct  239  SPKIYWRVDGSNGTLQIERGSDNGQHGYMVLLYKADGHCQRTFHPFSGVNEELKAFVHDI  298

Query  245  SLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + A TK G    K EPR S+VEG RD+AVLEAML+S ++EGA V VKKF
Sbjct  299  TQATTKEGVAGQKAEPRSSYVEGARDVAVLEAMLDSSRKEGAQVHVKKF  347



>gb|KJB66100.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=200

 Score =   264 bits (675),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  701  MMNVQVIIEGsmnssnpyfssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSH  522
            MMNVQVIIEGSMNSSNPYFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH
Sbjct  1    MMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSH  60

Query  521  VDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGY  342
            +D+TLPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY
Sbjct  61   IDRTLPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGY  120

Query  341  SVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAV  165
             VSLY  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AV
Sbjct  121  LVSLYSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAV  180

Query  164  LEAMLESGKREGALVQVKKF  105
            LEAMLESG + G LV VKKF
Sbjct  181  LEAMLESGSKGGTLVNVKKF  200



>ref|XP_007014900.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
 gb|EOY32519.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
Length=344

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 177/231 (77%), Gaps = 21/231 (9%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK+IA+IGDMMNVQ+IIEGSMNSSNPYFSSSWRRNF     
Sbjct  131  QPIWAVAENYRFEPAFVESKKLIADIGDMMNVQIIIEGSMNSSNPYFSSSWRRNF-----  185

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
                         +VGCEVTSVSA+TSH D TLPPPD IS+ FQLENGCSGVF +VVSS 
Sbjct  186  ------------EMVGCEVTSVSAITSHRDTTLPPPDIISSNFQLENGCSGVFVLVVSSS  233

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            SPK++WRVVGL GT++VERG ++G+HGY VSLY  DGQ KS FYPFCGV EELK F+ DI
Sbjct  234  SPKVIWRVVGLKGTVQVERGKQEGRHGYLVSLYSADGQCKSTFYPFCGVHEELKAFIHDI  293

Query  245  SLANTK----GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              A  K    G   + EPR SFVEG RD+AVLEAMLESG + GALV VKK 
Sbjct  294  LQATVKVRSDGSGYEAEPRSSFVEGARDVAVLEAMLESGNKGGALVHVKKL  344



>gb|AFK42402.1| unknown [Lotus japonicus]
Length=177

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  626  NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            +F GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LENGCSGVF
Sbjct  4    HFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLENGCSGVF  63

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  267
             MVVSSRSPKI+WRVVGLNGTL +ERG + G+HGY VS Y   GQ KS F+PF GV EEL
Sbjct  64   VMVVSSRSPKILWRVVGLNGTLHIERGFQ-GQHGYLVSSYGAVGQCKSSFFPFSGVTEEL  122

Query  266  KTFLSDISLANT-KGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            K FL+D+S +N  KG     E RLSFVEG RD+AVLEAMLESG R+G LV VK F
Sbjct  123  KAFLNDVSESNPEKGNNFVAEQRLSFVEGARDVAVLEAMLESGARQGELVHVKNF  177



>ref|XP_010651284.1| PREDICTED: uncharacterized protein LOC100245027 isoform X3 [Vitis 
vinifera]
Length=309

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 151/228 (66%), Gaps = 51/228 (22%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  132  QPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRRNFTGGFI  191

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM                                               
Sbjct  192  LDMGVHFIAGLRM-----------------------------------------------  204

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
               I WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EELKTF+ DI
Sbjct  205  ---IFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEELKTFIHDI  261

Query  245  SLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            S A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  262  SQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  309



>ref|XP_001762266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73058.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 161/226 (71%), Gaps = 4/226 (2%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--N  624
            N T+ PIWAVAENYRFEPA  +  K + E+G +M VQV+IE  MNSS+PYFSSSWRR  N
Sbjct  129  NDTKLPIWAVAENYRFEPALIQAGKFVKELGQIMGVQVLIEAPMNSSSPYFSSSWRREAN  188

Query  623  FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            F GGF+LD GVH++AGLRM++GCEV SVSA  SHVD TLPPPDN+SAL QL+NG +GV  
Sbjct  189  FKGGFMLDGGVHFIAGLRMIMGCEVDSVSATVSHVDLTLPPPDNLSALIQLQNGTAGVVY  248

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +  S++S K++WRVVG  GT+EV+R  ++G+HGY  +     G+I+  F PF GV EEL+
Sbjct  249  ICYSAKSRKMIWRVVGSLGTVEVDRTVQNGQHGYKTTYQPAKGEIQEVFCPFAGVYEELR  308

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
             F  D++     G E   + R S +E  RD+AV+EAM  S   +GA
Sbjct  309  AFSEDVARCGQSGEEA--DKRSSVLEAMRDVAVIEAMFHSSDSKGA  352



>gb|EYU46305.1| hypothetical protein MIMGU_mgv1a0096472mg, partial [Erythranthe 
guttata]
 gb|EYU46306.1| hypothetical protein MIMGU_mgv1a0096472mg, partial [Erythranthe 
guttata]
Length=150

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = -1

Query  551  VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVE  372
            + SVSA+TSHVD +LPPPD+IS+  QLE+G SGVF MVVSSRSPK++WR+VGL GTL+VE
Sbjct  1    IISVSAITSHVDTSLPPPDHISSTIQLEDGSSGVFVMVVSSRSPKVLWRMVGLKGTLQVE  60

Query  371  RGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLS  195
            RGNKDGKHGY+V L+  DGQ KS+FYPF GV EELKTFLSDIS+A   K G  + EPR+S
Sbjct  61   RGNKDGKHGYTVVLFTADGQTKSWFYPFSGVTEELKTFLSDISVATLKKDGRYEVEPRIS  120

Query  194  FVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            F+EG RD+AVL+AMLESGKR+G  VQVKKF
Sbjct  121  FLEGARDVAVLDAMLESGKRKGETVQVKKF  150



>gb|KGN54118.1| hypothetical protein Csa_4G286420 [Cucumis sativus]
Length=160

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = -1

Query  572  RMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGL  393
            + LVGCEV  VSA TS+VDK+LPPPDNIS+LFQLENGCSGVF MVVSS+SPKI WRVVGL
Sbjct  8    KQLVGCEVVLVSATTSYVDKSLPPPDNISSLFQLENGCSGVFVMVVSSKSPKIFWRVVGL  67

Query  392  NGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECK  213
             GTL++ERGN+DGKHGY VS     G  +  FYPF GV EELKTF+  IS    +G + K
Sbjct  68   KGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGVTEELKTFIHAIS---AEGSDDK  124

Query  212  GEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  125  ADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  160



>ref|XP_006445973.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59213.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=268

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  130  QPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRRNFTGGFI  189

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRM+ GCEV SVSA+TSH+DKTLPPPDNIS+ FQLENGCSGVF MVVSSR
Sbjct  190  LDMGVHFIAGLRMITGCEVVSVSAITSHIDKTLPPPDNISSNFQLENGCSGVFVMVVSSR  249

Query  425  SPK  417
            SPK
Sbjct  250  SPK  252



>gb|KCW51233.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=270

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            KPIWAVAENYRFEPAF ECKK++A+IGDMMNVQVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  132  KPIWAVAENYRFEPAFVECKKLLADIGDMMNVQVIVEGSMNSSNPYFSSSWRRNFAGGFI  191

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            LDMGVH++AGLRMLVGCE+TSVSA T+HVD TLPPPDN+S+ FQLENGCSGVF M+VSS+
Sbjct  192  LDMGVHFIAGLRMLVGCEITSVSATTTHVDLTLPPPDNLSSSFQLENGCSGVFVMIVSSK  251

Query  425  SPK  417
            SPK
Sbjct  252  SPK  254



>ref|XP_002969664.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
 gb|EFJ28788.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
Length=348

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 152/230 (66%), Gaps = 12/230 (5%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGG  612
            +Q P+WAVAENYRFEP   E  +++  IGDMM+ +VI+E  MNSSNPY+SS+WRR+  GG
Sbjct  126  SQAPVWAVAENYRFEPGLIEAARLVKSIGDMMSFEVIVELPMNSSNPYYSSAWRRD--GG  183

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VAGLR++ GCEVT VSA+  HVD  LP PDN+SAL         ++A   S
Sbjct  184  FVLDGGVHFVAGLRLITGCEVTQVSAIARHVDPLLPSPDNVSAL---------LYAYSWS  234

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
               PK+ WRV+G  GT+E  R  KDG HGY V+ Y   G + S F+PF GV+ ELK F+ 
Sbjct  235  FYYPKVSWRVLGSKGTVEAVRDQKDGSHGYLVTFYPLGGTVLSKFFPFSGVENELKAFVG  294

Query  251  DISLANTKGGECK-GEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            D+S    +G   +  + R + +E   D+AV+EAML+S   +G  V V ++
Sbjct  295  DVSQIVYEGKTAEDADKRSNVIEAYHDVAVIEAMLKSSNNKGFPVHVDRY  344



>ref|XP_002976631.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
 gb|EFJ22300.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
Length=341

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 146/216 (68%), Gaps = 7/216 (3%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGG  612
            T +P+WA+AENYRFE A  E  K+  +IG M+ V+V +E  MN S   FSS WRR   GG
Sbjct  126  TMRPVWAIAENYRFERALVEAHKLAKDIGHMVAVEVTVESPMNISRSSFSSIWRRELKGG  185

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            ++LD  VH +AGLR++ G EV SVSA+  HVD+ LPPPDN+SALF+LENGC+G   +  S
Sbjct  186  YVLDGAVHQIAGLRVITGSEVKSVSAICRHVDEALPPPDNVSALFELENGCAGTLMISFS  245

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
              + K+ W++VG  GT+EV++  +DG+ G+ VS     G+  S FYP CGV+EEL++F+ 
Sbjct  246  CTTKKMSWKIVGTKGTVEVDQDTQDGQPGFMVSHATSVGK-NSIFYPCCGVEEELRSFIH  304

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  144
            D+S    +GGE   + R S  E   D+AV+EA+L S
Sbjct  305  DLS----QGGE--ADKRSSPGEAFIDVAVIEAILNS  334



>ref|XP_002973220.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
 gb|EFJ25594.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
Length=349

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 148/216 (69%), Gaps = 7/216 (3%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGG  612
            T +P+WA+AENYRFE A  E  K++ +IG M+ V+V +E  MN S P FSS WRR   GG
Sbjct  126  TMRPVWAIAENYRFERALVEAHKLVKDIGHMVAVEVTVESPMNISRPSFSSIWRRELKGG  185

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            ++LD  VH +AGLR++ G EV SVSA+  HVD+ LPPPDN+SALF+LENGC+G   +  S
Sbjct  186  YVLDGAVHQIAGLRVITGSEVKSVSAICRHVDEALPPPDNVSALFELENGCAGTLMISFS  245

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
              + K+ W++VG  GT+EV++  +DG+ G+ VS     G+  S FYP CGV+EEL++F+ 
Sbjct  246  CTTKKMSWKIVGTKGTVEVDQDTQDGQPGFMVSHATSVGK-NSSFYPCCGVEEELRSFIH  304

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  144
            D+S    +GGE   + R S  E   D+AV+EA+L S
Sbjct  305  DLS----QGGE--ADKRSSPGEAFIDVAVIEAILNS  334



>ref|XP_001754780.1| predicted protein [Physcomitrella patens]
 gb|EDQ80234.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 149/236 (63%), Gaps = 23/236 (10%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
             N  + PIWAVAENYRFEPA  +  K   EIG +M VQV+IE  +NSS+PYFSSSWRR  
Sbjct  128  VNDKKLPIWAVAENYRFEPALIQTGKFAKEIGQIMGVQVLIEAPINSSSPYFSSSWRR--  185

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
              GF+LD GVH++AGLRM VGCE+ SVSA  SH D+T PPPDN+SA  QL NG +GV  +
Sbjct  186  --GFMLDGGVHFIAGLRMFVGCEIASVSATVSHFDQTQPPPDNLSASIQLWNGSAGVVNI  243

Query  440  VVSSRSPKI----------VWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP  291
              S+ + KI          +WRVVG  GT+E ER  K+G+ GY  +     G I+  F P
Sbjct  244  CYSATTRKIQLIPGLHLQMMWRVVGSLGTVEAERVVKNGQQGYKATCQNASGDIQETFSP  303

Query  290  FCGVQEELKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREG  129
            F GV EEL+ F  D+S       +C  + + R S +E  RD+AV+EAML S   +G
Sbjct  304  FAGVYEELQAFAEDVS-------KCVVQADRRSSVLEAMRDVAVIEAMLNSSDNKG  352



>ref|XP_002981277.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
 gb|EFJ17465.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
Length=338

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 147/233 (63%), Gaps = 27/233 (12%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN----  624
            +Q P+WAVAENYRFEP   E  +++  IGDMM+ +VI+E  MNSSNPY+SS+WRR+    
Sbjct  126  SQAPVWAVAENYRFEPGLIEAARLVKSIGDMMSFEVIVELPMNSSNPYYSSAWRRDVAFT  185

Query  623  FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            + GGF+LD GVH+VAGLR++ GCEVT VSA+  HVD  LP PDN+SAL            
Sbjct  186  WQGGFVLDGGVHFVAGLRLITGCEVTQVSAIARHVDPLLPSPDNVSAL------------  233

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
                      +WRV+G  GT+E  R  KDG HGY V+ Y   G + S F+PF GV+ ELK
Sbjct  234  ----------LWRVLGSKGTVEAVRDQKDGSHGYLVTFYPLGGTVLSKFFPFSGVENELK  283

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             F+ D+S    +  E   + R +F+E   D+AV+EAML+S   +G  V V ++
Sbjct  284  AFVGDVSQIVYEVNES-ADKRSNFIEAYHDVAVIEAMLKSSNNKGFPVHVDRY  335



>ref|XP_002973823.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
 ref|XP_002983567.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ15468.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ24778.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
Length=341

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 7/214 (3%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            K +WA+ ENYRFE A  E  K++ +IG M+ V+VI+E  MN S P FSS WRR   GG+I
Sbjct  128  KLVWAIGENYRFEQALAEASKLVKDIGHMVAVEVILESPMNISRPSFSSVWRRQLQGGYI  187

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            +D  VH +AGLR++ G E+ SVSA++ HVD  LP PDN+SAL +LENGC G   +  S  
Sbjct  188  MDSAVHQIAGLRLITGFEIRSVSAISRHVDNALPSPDNVSALIELENGCVGTLMISFSCI  247

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
            + K+ W+VVG  GT+ V++  KD + G+ V+     G+  S FYP CGV+EEL  F++DI
Sbjct  248  TKKMSWKVVGTEGTIYVDQDVKDDQPGFLVTCSTSTGK-NSVFYPCCGVEEELGAFINDI  306

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  144
            ++          + R S  E   D+AV+EA+L+S
Sbjct  307  TMGGVP------DKRSSPSEAYADVAVIEAILKS  334



>dbj|BAB02487.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 142/228 (62%), Gaps = 46/228 (20%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEGSMNSSNPYFSSSWRRN      
Sbjct  134  RPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYFSSSWRRNL-----  188

Query  605  LDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISAL-FQLENGCSGVFAMVVSS  429
                             +V S+  ++S  D          AL F L     G+   V   
Sbjct  189  ----------------SDVCSI--VSSRTD----------ALGFLLWLCLQGLQRHV---  217

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                I+WR+VGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EELK F +D
Sbjct  218  ----ILWRIVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFSGVTEELKAFFND  273

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            IS  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  274  ISETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVNKF  316



>ref|XP_001776337.1| predicted protein [Physcomitrella patens]
 gb|EDQ58836.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 142/236 (60%), Gaps = 15/236 (6%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            +  PIW VAENYRFEPAF +   M+  +G M++V V I+  M  SN YF   WRR+    
Sbjct  133  SPAPIWTVAENYRFEPAFHDAAAMVKSLGTMVSVTVTIDVPMTKSNKYFGCEWRRDPALK  192

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGFILD GVH+VAGLR++ GC++  V+A+ +H D ++P PD ++ L + +NGCSG   + 
Sbjct  193  GGFILDCGVHFVAGLRVMTGCDIKLVTAIATHRDPSVPAPDTLTTLIKFDNGCSGAMVIS  252

Query  437  VSSRSPKIVWRVVGLNGTLEVERG-NKDGKHGYSVSLY--MGDGQIKSFFYPFCGVQEEL  267
             ++   K  WRVV   GT+ VERG   DG+ GY + +   +GD  ++  FYP  G++ E 
Sbjct  253  YAASVSKACWRVVCSKGTVIVERGVGDDGRFGYQLKMQPRVGDSSLQ--FYPLSGLELEW  310

Query  266  KTFLSDISLANTKGG----ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            K+F++D+  A    G      +G PR    E  +D+A++EA L SG    A + +K
Sbjct  311  KSFIADVQKAIDHTGYGSVNTRGSPR----EALKDLAIVEAALASGLHADAPMSIK  362



>ref|XP_004142242.1| PREDICTED: uncharacterized LOC101204258 [Cucumis sativus]
Length=220

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -1

Query  458  SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  279
            SGVF MVVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS     G  +  FYPF GV
Sbjct  106  SGVFVMVVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGV  165

Query  278  QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             EELKTF+  IS    +G + K + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  166  TEELKTFIHAIS---AEGSDDKADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  220



>gb|ACU17312.1| unknown [Glycine max]
Length=225

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILD  600
            IW+VAENYRFEP   ECKK+IA IG MM+VQVIIEGSMNSSNPYFSSSWRRNF GGFILD
Sbjct  136  IWSVAENYRFEPGLVECKKLIAGIGKMMSVQVIIEGSMNSSNPYFSSSWRRNFTGGFILD  195

Query  599  MGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  510
            MGVH++AGLRMLVGCE+ SVSAMTSHVD T
Sbjct  196  MGVHFIAGLRMLVGCEIVSVSAMTSHVDLT  225



>ref|XP_006445972.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59212.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=219

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFI  606
            +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRRNF GGFI
Sbjct  130  QPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRRNFTGGFI  189

Query  605  LDMGVHYVAGLRMLVGCEVT  546
            LDMGVH++AGLRM++   +T
Sbjct  190  LDMGVHFIAGLRMVISYSLT  209



>gb|KEQ84242.1| NAD(P)-binding protein [Aureobasidium pullulans EXF-150]
Length=346

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 128/237 (54%), Gaps = 23/237 (10%)
 Frame = -1

Query  800  TNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  624
            TN+ T+K IWAVAEN+R+   F    + + E+GD++  ++ +   +     Y+ + WR+ 
Sbjct  124  TNIDTKKTIWAVAENFRYLGRFQYGAEQVKELGDILGFRLRMHAFVKPGAKYYETEWRKT  183

Query  623  --FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
              + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A  +L NG S
Sbjct  184  PEYQGGFLLDGGVHFIAAMRQLLGQEAKMSQVAAFTAQLQPHLPPIDTINATVKLANGTS  243

Query  455  GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPFCG  282
            G F++   +      + V   NGT++V         G+  ++   DG    K F     G
Sbjct  244  GTFSVSFGTTFSGAEYIVACQNGTVDV---------GFDKTIVKKDGNESTKDFTEDKNG  294

Query  281  VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            V++ELK +   I+       + K  P  +  E   D+ VLEAM++SG+ +G  +++K
Sbjct  295  VRQELKAWGESIA-------QGKAHPLQTPEEALADLEVLEAMIKSGEADGKAIELK  344



>gb|KEH18356.1| NAD(P)-binding rossmann-fold protein, putative [Medicago truncatula]
Length=114

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -1

Query  395  LNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC  216
            +NGTL++ER  + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S  NT   + 
Sbjct  1    MNGTLQIERRFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVS-ENTLKKDS  58

Query  215  KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + E  LSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  59   QPEHCLSFVEGARDVALLEAMLESGSKQGELVHVKKF  95



>gb|KEH18355.1| NAD(P)-binding rossmann-fold protein, putative [Medicago truncatula]
Length=125

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -1

Query  395  LNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC  216
            +NGTL++ER  + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S  NT   + 
Sbjct  1    MNGTLQIERRFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVS-ENTLKKDS  58

Query  215  KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            + E  LSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  59   QPEHCLSFVEGARDVALLEAMLESGSKQGELVHVKKF  95



>gb|KEQ74017.1| NAD(P)-binding protein [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=347

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 123/231 (53%), Gaps = 18/231 (8%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T+K IWAVAEN+R+   F    + + E+G+++  ++ +   +     Y+ + WR+   + 
Sbjct  128  TKKTIWAVAENFRYLGRFQYGAERVKELGEILGFRLRMHALVQPGAKYYETEWRKTPEYQ  187

Query  617  GGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH++A +R L+G   ++T V+A T+ +   LPP D I+A  +L NG SG F+
Sbjct  188  GGFLLDGGVHFIAAMRQLLGQSAKMTHVAAFTAQLQPHLPPLDTINATVKLANGRSGTFS  247

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +   +      + V   NGT++V       K G        D   K F     GV++ELK
Sbjct  248  VSFGTTFSGAEYVVACQNGTVDVGFDKTIVKKG-------KDESSKDFLEDKNGVRQELK  300

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
             +   I     KG   K +P  S  E   D+ VLE+M++SG+ +G  +++K
Sbjct  301  AWGESIQ----KG---KADPMQSPEEALADLEVLESMIKSGEADGKAIELK  344



>gb|KEQ61018.1| oxidoreductase-like protein family [Aureobasidium melanogenum 
CBS 110374]
Length=346

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 127/233 (55%), Gaps = 22/233 (9%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T+K IWAVAE++R+   F    + + E+GD++  ++ +  S+     Y+ + WR+   + 
Sbjct  128  TKKTIWAVAEHFRYLGRFQYGAEQVKELGDVLGFRLRMHASVGPGAKYYETEWRKKPEYQ  187

Query  617  GGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A  +L NG SG F+
Sbjct  188  GGFLLDGGVHFIAAMRQLLGQEAKMSQVAAFTAQLQPHLPPIDTINATVKLANGRSGTFS  247

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP--FCGVQEE  270
            +   +      + V    GT++V         G+  ++   DG+  S  +P    GV++E
Sbjct  248  VSFGTTFSGAEYVVACQKGTVDV---------GFDKTIVKKDGKESSKDFPEDKNGVRQE  298

Query  269  LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            LK +   IS         K +P  +  E   D+ VLE+M++SG+ +G  +++K
Sbjct  299  LKAWGESIS-------RGKADPLQTPQEALADLEVLESMIKSGEADGKAIELK  344



>gb|KEQ94380.1| hypothetical protein AUEXF2481DRAFT_270651 [Aureobasidium subglaciale 
EXF-2481]
Length=346

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 124/230 (54%), Gaps = 22/230 (10%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T+K IWAVAEN+R+   F    + + E+GD++  ++ +  ++     Y+ + WR+   + 
Sbjct  128  TKKVIWAVAENFRYLGRFQYGAEQVKELGDILGFRLRMHANVKPGAKYYETEWRKTPEYQ  187

Query  617  GGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A  +L NG SG F+
Sbjct  188  GGFLLDGGVHFIAAMRQLLGEEARMSQVAAFTAQLQPHLPPIDTINATVKLTNGRSGTFS  247

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLY-MGDGQI-KSFFYPFCGVQEE  270
            +   +      + V   +GT++V         G+  ++   GD +I K F     GV++E
Sbjct  248  VSFGTTFSGAEYIVACQDGTVDV---------GFDKTIVKKGDNEITKEFPEDKNGVRQE  298

Query  269  LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  120
            LK +   IS         K +P  S  E   D+ VLE+M++SG+  G  +
Sbjct  299  LKAWGESIS-------RGKADPLQSPEEALADLEVLESMIKSGEANGKAI  341



>ref|XP_001942427.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU47289.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=349

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 120/233 (52%), Gaps = 26/233 (11%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGF  609
            P  ++AEN+RF   F      I  +G ++  ++ +   +  S+ YF ++WR+   + GG 
Sbjct  133  PTLSIAENFRFLDYFLYAAAEIKSLGRLLGFRMRVHSLVKPSSKYFETAWRKKPEYQGGL  192

Query  608  ILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            +LD GVH+VAG+R+++G    ++   SA T+ + + L P D + A  QL NG SG  ++ 
Sbjct  193  LLDGGVHFVAGIRLILGGSGVKIVKTSAFTTRLQEHLSPVDTVDATMQLSNGASGTASIS  252

Query  437  VSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  270
              ++     +      GT+ V R      +DG+HG          ++K F     GV+ E
Sbjct  253  FGTQFSGSEYAFACEKGTVVVTRAKVAVKRDGEHG----------EVKEFKDEGSGVKPE  302

Query  269  LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            +  +   +        E K +PR S  EG RD+ VLEAML SG++ GA V++K
Sbjct  303  VAAWGKGLQ-------EGKMDPRQSAEEGLRDLEVLEAMLTSGEKGGAPVELK  348



>gb|KDQ06959.1| hypothetical protein BOTBODRAFT_60302 [Botryobasidium botryosum 
FD-172 SS1]
Length=354

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 120/232 (52%), Gaps = 24/232 (10%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            IW VAEN+  EP +   KK+IA  EIG +    + +   ++ S+ ++ + WR    + GG
Sbjct  137  IWRVAENFEVEPGYLFAKKVIADGEIGKLQYFNLSLVAFVDESSKWYQTPWRTKPEYQGG  196

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV----FA  444
            F+LD GVH+ A LR ++   +T VSA  S     L P D I+A+ +  +G  G+    F 
Sbjct  197  FLLDGGVHFTALLRTILPSPITEVSAFASLNKAILAPHDTINAILRCADGTHGIWELSFG  256

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
               S+R       + G  G +++    KDGK    V ++ GD + K+   P CGV++EL+
Sbjct  257  SPSSTRGALNATSITGTEGWIQIGNTQKDGKTHIKVDVHKGD-ETKTTVLPSCGVEKELE  315

Query  263  TFLSDISLANTKGG--ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
             FL  +      GG  E  GEPR       +D+A +EA L S   EG L+++
Sbjct  316  HFLELL------GGRDEGFGEPRSVL----KDVAFIEAALNS---EGNLIKL  354



>gb|EFQ28397.1| oxidoreductase family protein [Colletotrichum graminicola M1.001]
Length=347

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 122/227 (54%), Gaps = 20/227 (9%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            +AVAENYRF+P +T  +  +  +G ++   V +   +     Y  ++WR+  ++ GGF+L
Sbjct  134  FAVAENYRFQPRYTAARDEVQTLGKIIGFNVRVFFYVQLGGKYIETTWRKKPDYQGGFLL  193

Query  602  DMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A LR+L+G E    SV+A +    + LPP D I+A  +  +G +G FA+ V S
Sbjct  194  DGGVHFAAALRLLLGKEAAADSVAAFSDLTQEHLPPIDTINAAIRTRSGATGSFAVSVGS  253

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF-FYPFCGVQEELKTFLS  252
                  ++V G  G++ +         G+ +++ + DG+ ++  F    GV+EE+K +  
Sbjct  254  SLSAFDFQVAGEKGSVTLS--------GHDLTVKLFDGEARTIQFEQTSGVKEEVKAWAE  305

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
             +          +  P  S  E   D+ +LE + +SG+++GA+ +++
Sbjct  306  GLVAG-------RPNPLQSPEEALADLELLEKIFKSGEKDGAVQKLQ  345



>emb|CDY27562.1| BnaC01g32450D [Brassica napus]
Length=180

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -1

Query  413  VWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN  234
            +  +  +  ++++ERG KDG+HGY  ++Y   G  ++ FYPF GV EELK F SDIS  +
Sbjct  82   IMEICRIKRSVQLERGVKDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKAFFSDISETS  141

Query  233  TKGGECKGEP-RLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
                  + EP RLS VEGTRD+AVL AMLESG R GA+V V KF
Sbjct  142  K-----EQEPRRLSCVEGTRDVAVLGAMLESGARNGAVVPVAKF  180



>ref|XP_007785079.1| hypothetical protein W97_09025 [Coniosporium apollinis CBS 100218]
 gb|EON69762.1| hypothetical protein W97_09025 [Coniosporium apollinis CBS 100218]
Length=342

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 120/235 (51%), Gaps = 26/235 (11%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T K  W+VAEN+RF  +F    + + ++G ++  +  +   +     YF ++WR+   + 
Sbjct  125  TSKVTWSVAENFRFMDSFLHGAEQVRQMGRVLGFRTRMHAFVKPGTKYFETAWRKTPEYQ  184

Query  617  GGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH++AG R+L+  E   T VSA T+ + + LPP D + A ++ ++G SG F+
Sbjct  185  GGFLLDGGVHFIAGTRLLLQPENAPTRVSAFTARLQEHLPPVDTVDATWKTKSGVSGTFS  244

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  276
            +   +      + +    GT+ V R      KDGK            + K F     GV+
Sbjct  245  VSFGTTFSGSEYTLACEKGTVTVLRSMVKIVKDGKE-----------ETKEFSGEGAGVK  293

Query  275  EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            +E+K +   I   N        +PR +  E  +D+ VLEAML+SG+  G  + +K
Sbjct  294  QEVKAWGEGIESGNQ-------DPRQTPEEALKDLEVLEAMLQSGEGNGVPIDLK  341



>emb|CCF43203.1| oxidoreductase [Colletotrichum higginsianum]
Length=348

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 117/226 (52%), Gaps = 18/226 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            +AVAENYRF+P +T  +  + ++G ++   V +   +     Y  ++WR+  ++ GGF+L
Sbjct  134  FAVAENYRFQPRYTTARDEVQKLGKIIGFNVRVFFFVQLGGKYIETAWRKKPDYQGGFLL  193

Query  602  DMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A LR+L+G E    SV+A +    K LPP D I+A+ +  +G +G FA+ V S
Sbjct  194  DGGVHFAAALRLLLGKEAAPDSVAAFSDLTQKHLPPIDTINAIVRTRSGATGSFAVSVGS  253

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  + V G  G++ +        H  +V  + G+ +    F    GV+EE+K +   
Sbjct  254  PLSAFDFHVAGEKGSVTL------SSHDLTVKPFDGEARTAQ-FEQTSGVKEEVKAWAEG  306

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            +          K  P  S  E   D+  LE + +SG+++GA  +++
Sbjct  307  LVAG-------KPNPLQSPEEALADLEFLEKIFKSGEQDGATQKLQ  345



>gb|EMD87949.1| hypothetical protein COCHEDRAFT_1183091 [Bipolaris maydis C5]
 gb|ENI03464.1| hypothetical protein COCC4DRAFT_82671 [Bipolaris maydis ATCC 
48331]
Length=343

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 123/232 (53%), Gaps = 26/232 (11%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ ++WR+     GGF+L
Sbjct  128  YTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFPVPVGSKYYETAWRKKPEHQGGFVL  187

Query  602  DMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            D GVH+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLENG SG  ++ V 
Sbjct  188  DGGVHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDTLNAVLQLENGSSGTLSISVG  247

Query  431  SRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            S      + V    G + V RG     + GK          D + K F     GV++E+K
Sbjct  248  STDQGAEYVVACEKGVVTVSRGKVVIKRQGK----------DDEAKEFPDEGNGVKQEIK  297

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
             +    SL + K  E +     S  E  +D+ +LE+ L+SG++ G  + VK+
Sbjct  298  AWAK--SLEDGKRNEMQ-----SPEEALKDLEILESCLKSGEQAGTPIDVKQ  342



>ref|XP_007713573.1| hypothetical protein COCCADRAFT_99511 [Bipolaris zeicola 26-R-13]
 gb|EUC32122.1| hypothetical protein COCCADRAFT_99511 [Bipolaris zeicola 26-R-13]
Length=343

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 122/232 (53%), Gaps = 25/232 (11%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ + WR+     GGF+L
Sbjct  128  YTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFPVPVGSKYYETEWRKKPEHQGGFVL  187

Query  602  DMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            D G+H+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLENGCSG  ++ V 
Sbjct  188  DGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPLDTLNAVLQLENGCSGTLSISVG  247

Query  431  SRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +      + V    G + V RG     + G+          + Q K F     GV++E+K
Sbjct  248  TTDKGSEYVVACEKGVVTVSRGKVVVKRQGEE---------EEQTKEFPDEGNGVKQEIK  298

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
             +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + VK+
Sbjct  299  AWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQSGTPIDVKQ  343



>ref|XP_007603283.1| oxidoreductase [Colletotrichum fioriniae PJ7]
 gb|EXF73078.1| oxidoreductase [Colletotrichum fioriniae PJ7]
Length=348

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 119/225 (53%), Gaps = 18/225 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            +AVAENYRF+P +T  +  + ++G ++   V +   +     Y  ++WR+  ++ GGF+L
Sbjct  134  FAVAENYRFQPRYTTARDELRKLGKVIGFNVRVFFFVKLGGKYIETAWRKKPDYQGGFLL  193

Query  602  DMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A LR+L+G +    SV+A +    + LPP D I+A+ + + G +G FA+ V S
Sbjct  194  DGGVHFAAALRLLLGKDAAPASVAAFSDLTREHLPPIDTINAVVKTKQGATGSFAVSVGS  253

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  + V G NG++ +        H  +V  + G+    + F    GV+EE+K +   
Sbjct  254  TLSAFDFHVAGENGSVTL------SSHDLTVKPFDGEATT-THFEQTSGVKEEVKAWAEG  306

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            + +A T        P  S  E   D+  LE +  SG+++GA+ ++
Sbjct  307  L-VAGTPN------PLQSAEEALADLEFLEKIFTSGEQDGAIQKL  344



>gb|EPS29944.1| hypothetical protein PDE_04894 [Penicillium oxalicum 114-2]
Length=349

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 112/225 (50%), Gaps = 21/225 (9%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W V EN+R+   F   ++ I E+G++    V + G +     ++++ WR+     GG
Sbjct  127  KVTWGVGENFRYLDTFRHAREKIKELGEITGFLVRLYGDVQPDGKFYNTDWRKVPTHQGG  186

Query  611  FILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            FILD GVH+ AGLR L+G +V  T VSA T+ +   LPP D ++A+ +   G  G   + 
Sbjct  187  FILDGGVHFTAGLRYLLGSDVHITQVSAFTTLIKDYLPPVDTVNAILKANTGAQGTLQVS  246

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPFCGVQEELK  264
            + +  P   W V   NG++ V  G+       SV++ M DGQ  +        GV  E++
Sbjct  247  MGTHGPAPEWTVGCENGSVSV--GDS------SVTVRMADGQEHVDKIENERSGVPPEVR  298

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             +   ++     GG  K  P  S  +   D+ ++E ML SG+  G
Sbjct  299  LWAKALA-----GG--KVNPEQSPSQALADLELIELMLRSGENNG  336



>ref|XP_003300258.1| hypothetical protein PTT_11448 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91648.1| hypothetical protein PTT_11448 [Pyrenophora teres f. teres 0-1]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 119/233 (51%), Gaps = 26/233 (11%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFI  606
            I+AVAEN+RF  ++    + ++ +G +++ +V +   +   + Y+ + WR+     GGF+
Sbjct  127  IYAVAENFRFIDSYVWGSQQVSSMGRILSFRVRVALLVQPGSKYYETEWRKKPEHQGGFL  186

Query  605  LDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            LD GVH+VA  R+L+   G ++T VSA T+ + + LPP D ++A  QL+NG SG  ++  
Sbjct  187  LDGGVHFVAATRLLLQGGGQKITKVSAFTAQLQEYLPPVDTLNATMQLDNGASGTLSISF  246

Query  434  SSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  267
             +      + V    G++ V RG     +DGK            + K F     GV +E+
Sbjct  247  GTTDTGSEYLVACEKGSVHVSRGKVVVTRDGKK----------AETKEFPDEGNGVNQEI  296

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
            K +   +   N    +       S  E  +D+ +LE  L+SG++ G  + VK+
Sbjct  297  KAWAKSLEEGNRNEMQ-------SPEEALKDLEILEVCLKSGEQGGKPIDVKQ  342



>gb|ENH79899.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
orbiculare MAFF 240422]
Length=349

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 118/226 (52%), Gaps = 18/226 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            +AVAENYRF+P +T  +  + ++G ++     +   +N    Y  + WR+   + GGF+L
Sbjct  135  FAVAENYRFQPRYTTARDEVQKLGRVIGFNARVFFFVNLGGKYIETEWRKKPAYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A LR+L+G +    SVSA ++     LPP D ++A+ + ++G  G FA+ V S
Sbjct  195  DGGVHFAAALRLLLGSDAAPLSVSAFSALTRDHLPPIDTVNAVVKTKSGAIGSFAVSVGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  ++V   NG++ V        H  +V  + G+ +    F    GV+EE+K +   
Sbjct  255  TLNAFDFQVACENGSVTV------SSHELTVKPFEGEARTVR-FEETNGVKEEVKAWAEA  307

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            ++         K  P  S  E   D+  LE + +SG+++GAL +++
Sbjct  308  LAAG-------KPNPLQSPEEALADLEFLEKIFQSGEQDGALQKLE  346



>ref|XP_007699535.1| hypothetical protein COCSADRAFT_89105 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD65015.1| hypothetical protein COCSADRAFT_89105 [Bipolaris sorokiniana 
ND90Pr]
Length=342

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 121/228 (53%), Gaps = 18/228 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ ++WR+     GGF+L
Sbjct  128  YTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFFVPVGSKYYETAWRKKPEHQGGFVL  187

Query  602  DMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            D GVH+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLENG SG  ++ V 
Sbjct  188  DGGVHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDTLNAVLQLENGSSGTLSISVG  247

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            +      + V    G + V RG         V     +G+ K F     GV++E+K +  
Sbjct  248  TTDQGSEYVVACEKGVVTVSRGK------VVVKRQGEEGETKEFPDEGNGVKQEIKAWAK  301

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
              SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + V++
Sbjct  302  --SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQGGTPIDVEQ  342



>gb|EUN24448.1| hypothetical protein COCVIDRAFT_106168 [Bipolaris victoriae FI3]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 121/232 (52%), Gaps = 25/232 (11%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ + WR+     GGF+L
Sbjct  128  YTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFPVPVGSKYYETEWRKKPEHQGGFVL  187

Query  602  DMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            D G+H+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLENG SG  ++ V 
Sbjct  188  DGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPLDTLNAVLQLENGSSGTLSISVG  247

Query  431  SRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +      + V    G + V RG     + G+          + Q K F     GV++E+K
Sbjct  248  TTDKGSEYVVACEKGVVTVSRGKVVVKRQGEE---------EEQTKEFPDEGNGVKQEIK  298

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
             +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + VK+
Sbjct  299  AWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQSGTPIDVKQ  343



>ref|XP_008025728.1| hypothetical protein SETTUDRAFT_135946 [Setosphaeria turcica 
Et28A]
 gb|EOA87278.1| hypothetical protein SETTUDRAFT_135946 [Setosphaeria turcica 
Et28A]
Length=346

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 120/234 (51%), Gaps = 27/234 (12%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            + VAEN+RF  +FT   + +A +G ++   V +   +++ + Y+ +SWR+   + GGF+L
Sbjct  129  YRVAENFRFLDSFTWAAQQLASLGRVLTFGVRVAAMVHAGSKYYETSWRQKPEYQGGFVL  188

Query  602  DMGVHYVAGLRMLV----GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            D G+H+VA  R+L+    G ++T  +A T+ +   LPP D ++A  QL+NG SG F++  
Sbjct  189  DGGIHFVAATRLLLHGAGGRKITKAAAFTAQLQPHLPPVDTLNATLQLDNGASGTFSVSF  248

Query  434  SSRSPKIVWRVVGLNGTLEVERGN----KDGKH-GYSVSLYMGDGQIKSFFYPFCGVQEE  270
             +      + V    GT+ V RG     + G+        + G+G          GV+ E
Sbjct  249  GTSDSASEYLVACERGTVHVSRGKVVVRRQGREDAEETREFPGEGN---------GVKSE  299

Query  269  LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
            +K +   +         C  E + S  E   D+ VLEA L+SG + G  V+V++
Sbjct  300  IKAWAQSLEQG------CPNEMQ-SPQEALSDLQVLEACLKSGGQGGTPVEVQQ  346



>gb|EWC48565.1| hypothetical protein DRE_01787 [Drechslerella stenobrocha 248]
Length=363

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 114/228 (50%), Gaps = 16/228 (7%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGF  609
            PIW+VAEN+R+   F    + ++E+G ++   V +   +     Y ++ WR+   + GGF
Sbjct  129  PIWSVAENFRYWKTFKFAAQQVSELGRLLTFTVDVMQFIAPGGKYVNTEWRKVPQYQGGF  188

Query  608  ILDMGVHYVAGLRMLVGC-EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
             LD GVH+ A LRML+G  E + VSA TS     LPP D + A   L++G  G F+M   
Sbjct  189  CLDAGVHFTAALRMLIGNDEASRVSAFTSLNQPHLPPIDTVMATVMLKSGACGTFSMSHG  248

Query  431  SRSPKIV-WRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            + S K   W +V   GT+ V  G K       +   + D    S    + GV+ E++ F 
Sbjct  249  TPSAKTFDWGIVCEGGTVRVADGQKVIVKKVDMPEVVSDF---SDNEDWSGVKAEVRAFA  305

Query  254  SDISLANTKG-GECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
                 A  KG G     P ++      D+ ++E M++SG++ GA  ++
Sbjct  306  E----AVRKGVGNEDQSPEMAVA----DLELIEKMIKSGEQSGAPFEI  345



>ref|XP_011117421.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53811.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
Length=366

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 119/225 (53%), Gaps = 21/225 (9%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFI  606
            IW+VAEN+R+ PAF   ++ +  +G ++   V +   +     YF ++WR+   + GGF 
Sbjct  130  IWSVAENFRYWPAFDYAEEKVKSLGKVLAFHVEVLQLVAPGGKYFETAWRKVPTYQGGFC  189

Query  605  LDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            LD GVH+ A LR LVG  ++ S+SA T+     LPP D I +  +L++G  G FAM   +
Sbjct  190  LDAGVHFTAALRRLVGEDQIASLSAFTNLAQPHLPPIDTIMSTIKLKSGVCGTFAMSHGT  249

Query  428  RSPKIV-WRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
             + K+  W +V   GT++V  G     K  +     + + GD         + GV++E++
Sbjct  250  PATKVFEWFIVCEQGTVKVSDGPKVVVKQLEMPEEWTEFGGDRN------EWSGVKKEVR  303

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             F+   S+ N KG E      LS      D+ ++E M++SG++ G
Sbjct  304  VFVE--SVKNGKGVEG-----LSPENALADLEMIEKMIQSGEQGG  341



>gb|EPS32813.1| hypothetical protein PDE_07773 [Penicillium oxalicum 114-2]
Length=336

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 114/228 (50%), Gaps = 27/228 (12%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            TQK IWAV EN+R+   F      +  +G +   +V ++  +   N Y+ + WR++  + 
Sbjct  117  TQKLIWAVGENFRYMTKFLYAADKVRNMGQVRRFRVNVQSLVKQDNKYYLTLWRQSPGYQ  176

Query  617  GGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH +AGLRM++G +  + SVSA T  +   LPP D + A+ Q E G +G  +
Sbjct  177  GGFLLDGGVHMLAGLRMILGPKNRIVSVSAQTQQLQNYLPPIDTLDAVTQTELGATGTIS  236

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +   SR    ++      GT++++  +            M + ++    +   GV  E++
Sbjct  237  LSWGSRFTDSLFEFECEKGTVKIQFDD-----------VMVNDEVHHIEFDGKGVVPEVR  285

Query  263  TFLSDISLANTKGGECKGEP---RLSFVEGTRDIAVLEAMLESGKREG  129
             F   I          +G+P   R S  E   D+++LE M+ SG+ +G
Sbjct  286  EFAETI---------LRGDPVAKRQSPEEALADLSLLEQMMRSGEHDG  324



>ref|XP_007686203.1| hypothetical protein COCMIDRAFT_90481 [Bipolaris oryzae ATCC 
44560]
 gb|EUC47328.1| hypothetical protein COCMIDRAFT_90481 [Bipolaris oryzae ATCC 
44560]
Length=343

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 121/232 (52%), Gaps = 25/232 (11%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ ++WR+     GGFIL
Sbjct  128  YTVAENFRFIDSYIWASQQLASLGRLLSFRVRVMFPVAVGSKYYETAWRKKPEHQGGFIL  187

Query  602  DMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            D G+H+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ Q ENG SG  ++ V 
Sbjct  188  DGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDTLNAVLQAENGSSGSLSISVG  247

Query  431  SRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +      + V    G + V RG     + G+    V  +  +G          GV++E+K
Sbjct  248  TTDQGSEYVVACEKGVVTVSRGKVVVKRQGEEKEEVKEFPDEGN---------GVKQEIK  298

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
             +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + VK+
Sbjct  299  AWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQGGTPIDVKQ  343



>ref|XP_001935897.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU48484.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=342

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 118/233 (51%), Gaps = 26/233 (11%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFI  606
            I+ VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ + WR+     GGF+
Sbjct  127  IYTVAENFRFIDSYVWGSQQVASLGRILSFRVRVALLVQPGSKYYETEWRKKPEHQGGFL  186

Query  605  LDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            LD GVH+VA  R+L+   G ++  VSA T+ + + LPP D ++A  QL NG SG  ++  
Sbjct  187  LDGGVHFVAATRLLLQGGGQKINKVSAFTAQLQEYLPPVDTLNATMQLGNGASGTLSISF  246

Query  434  SSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  267
             +      + V    G++ V RG     +DGK          + + K F     GV +E+
Sbjct  247  GTTDTGSEYLVACEKGSVHVSRGKVIVTRDGK----------EAETKEFPDEGNGVNQEI  296

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
            K +    SL   K  E +     S  E  +D+ +LE  L SG++ G  + VK+
Sbjct  297  KAWAK--SLEEGKRNEMQ-----SPEEALKDLEILEVCLMSGEQGGKPIDVKQ  342



>gb|KEZ45810.1| Oxidoreductase-like protein [Scedosporium apiospermum]
Length=347

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 117/236 (50%), Gaps = 25/236 (11%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRR--  627
            +++  PIWAV EN+RF        + + EIG D++     +   +   + Y+++ WR+  
Sbjct  123  SLSSPPIWAVGENWRFLQTVVYAAEQLKEIGGDVVTFSFSMYKLVRDDDKYYNTEWRKIP  182

Query  626  NFFGGFILDMGVHYVAGLRML---VGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
             + GGF+LD GVH+VAG+R     VG E+  +SA T+ +   LPP D +  L    +G S
Sbjct  183  EYQGGFLLDGGVHFVAGIRHFLAAVGQEIKHLSAHTALIQAKLPPVDTVHGLLTTTSGRS  242

Query  455  GVFAMVVSSR-SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG----QIKSFFYP  291
            G F +   S         +V  NG + +  G        +V+   GDG    + K+F + 
Sbjct  243  GTFIVSFGSEFKSGFTIELVTTNGAVRLTPGV------VNVTRKAGDGERVEETKTFEFD  296

Query  290  FCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
              GV+ E+  F   I+         K + R +  E  +D+ +L+A+LESG+  GA+
Sbjct  297  -SGVKAEVAAFAQSINAG-------KVDARQTASEALKDLEILQALLESGEDSGAI  344



>ref|XP_007275100.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
gloeosporioides Nara gc5]
 gb|ELA35828.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
gloeosporioides Nara gc5]
Length=349

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 121/227 (53%), Gaps = 20/227 (9%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            +A+AENYRF+P FT  +  + ++G ++     +   +     Y  ++WR+  ++ GGF+L
Sbjct  135  FAIAENYRFQPRFTTARDEVQKLGKVIGFNARVFFFVKLGGKYIETAWRKKPDYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A +R+L+G E    SV+A +      LPP D I+A+ +  +G +G FA+ V S
Sbjct  195  DGGVHFAATVRLLLGTEAAPESVAAFSDLTRPHLPPIDTINAVIKTRSGATGSFAVSVGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF-FYPFCGVQEELKTFLS  252
                  + V   NG++ V         G+ + +   DG+ ++  F    GV+EE+K + +
Sbjct  255  SLSAFDFEVACENGSVTVS--------GHELIVKPLDGEARTTQFEQTTGVKEEVKAW-A  305

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            ++ ++       K  P  S  E   D+  LE + +SG+++G  ++++
Sbjct  306  EVLVSG------KPNPLQSTDEALADLEFLEKIFKSGEQDGTRLKLE  346



>gb|EQB57311.1| hypothetical protein CGLO_02580 [Colletotrichum gloeosporioides 
Cg-14]
Length=349

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 118/227 (52%), Gaps = 20/227 (9%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            +A+AENYRF+P FT  +  + ++G ++     +   +     Y  ++WR+  ++ GGF+L
Sbjct  135  FAIAENYRFQPRFTTARDEVQKLGKVIGFNARVFFFVKLGGKYIETAWRKKPDYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A +R+L+G E    SV+A +      LPP D I+A+ +  +G +G FA+ V S
Sbjct  195  DGGVHFAATVRLLLGTEAAPESVAAFSDLTRPHLPPIDTINAVIKTRSGVTGSFAVSVGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF-FYPFCGVQEELKTFLS  252
                  ++V   NG++ V         G+ + +   DG+ ++  F    GV+EE+K +  
Sbjct  255  SLSAFDFQVACENGSVTV--------SGHELIVKPLDGEARTTQFEQTTGVKEEVKAWAE  306

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
             +          K  P  +  E   D+  LE + +SG+++G  ++++
Sbjct  307  ALV-------SGKPNPLQATDEALADLEFLEKIFKSGEQDGTRLKLE  346



>gb|KIV83264.1| hypothetical protein PV11_05309 [Exophiala sideris]
Length=343

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 104/220 (47%), Gaps = 16/220 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            I++VAE +RF P F   +K + E   IGD+  + + I  +      Y+ + WR+   + G
Sbjct  131  IFSVAEQFRFMPEFELGRKWVVEEKAIGDVNQLHLKIWRNQAPGGKYYETEWRKVPEYQG  190

Query  614  GFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            GF+LD GVH  A LR + G EV         V   LPP D ++A   L  G +G  +M  
Sbjct  191  GFLLDGGVHQTAMLRWISGQEVVETRGFARQVAHHLPPLDTVNAGILLSGGGTGTISMSF  250

Query  434  SSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            +S        ++G  G+  +     DG  GY V+L +  G+ ++      GVQ E+K FL
Sbjct  251  ASAKRATELTIIGTKGSFFL----TDGPDGYIVTLELTSGEKRTETLKTNGVQVEIKAFL  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
              I   N    + +  P     E   D+A++E++   G +
Sbjct  307  EAIQAGN---AQARSGPE----EALNDLAIIESLCSGGGK  339



>gb|KIO22407.1| hypothetical protein M407DRAFT_118073 [Tulasnella calospora MUT 
4182]
Length=372

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 122/236 (52%), Gaps = 20/236 (8%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            IW VAEN+  EP      + I   +IG +   ++ +   ++  + ++ +SWR   ++ GG
Sbjct  142  IWRVAENFECEPGIRAAAEAIRSGKIGKVAFFRLSVVNYIDQESKWYQTSWRTVPDYQGG  201

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV----FA  444
            F+LD GVH +A LR ++   V S+S   S     L P D+I ++  L++G  G+    FA
Sbjct  202  FLLDGGVHSMAVLRTILPSPVVSLSGHASLTKPYLLPHDSIQSVLALDSGAHGILELSFA  261

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERG-NKDGKHGYSVSLYMG--DGQIKSFFYPFCGVQE  273
               S+R   +   + G  G LE+  G N+ G  G+++   +G  D + +  FY   G+  
Sbjct  262  APSSARGESLT-VITGTEGFLELTSGKNETGVQGWTIKTVVGTKDPKEEKQFYKGQGIDN  320

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            E++ F+  + L   +     GEPR +     RD+A+++A L SG   GALV +KK 
Sbjct  321  EIEWFVQAV-LKGEQNSVSVGEPRGAI----RDVALIQAALTSG---GALVDIKKL  368



>ref|XP_007793174.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
 gb|EMR67736.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
Length=317

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/231 (27%), Positives = 111/231 (48%), Gaps = 28/231 (12%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            W + EN+RF  ++T   K +  +G ++  Q   + S+  +  +  + WRR     GG++L
Sbjct  100  WTIGENWRFLNSYTYAAKELKSLGKIIGFQGRQQASIQLNWKFNLTEWRRTPTHQGGYLL  159

Query  602  DMGVHYVAGLRMLVGC----EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            D GVHYVAGLR+L+G     E+  ++A TS + + LPP D    + Q ++G +G F +  
Sbjct  160  DGGVHYVAGLRLLIGTEPGNEIAKLAAFTSQIKEYLPPVDTADVILQTKSGITGTFQISR  219

Query  434  SSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  267
             +      W V   NG +++E      ++DGK             +K+      GV  E+
Sbjct  220  GTSLSADEWTVACENGWIKIENDKVTISRDGKE-----------DVKTVANERSGVPPEV  268

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            + +   +     +    + EP  +      D+ ++E ML SG++ GA ++ 
Sbjct  269  RAWGEALVAGKIR---PEQEPEAALA----DLEIIELMLRSGEQGGAPLET  312



>ref|XP_008085160.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis 
ATCC 20868]
 gb|EPE27801.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis 
ATCC 20868]
Length=346

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 122/229 (53%), Gaps = 20/229 (9%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            W VAEN+RF  +F   ++ + ++G ++  +V + G++   + YF ++WR+   + GGF+L
Sbjct  128  WGVAENFRFLDSFLFARQEVQKLGRVLGFRVKMFGNVQPGSKYFETAWRKKPEYQGGFLL  187

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH++A  R+L+G E   T+++A T+ + + LPP D +++++Q + G SG F++   +
Sbjct  188  DGGVHFIAATRLLLGEEATPTALTAFTTLLQEHLPPVDTVNSVWQTKTGISGTFSVSFGT  247

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ---IKSFFYPFCGVQEELKTF  258
                  + +    G++ VE          +V L M   +   +K F     GV++E+  +
Sbjct  248  TLSGSEYVIACEKGSVAVEFSK------VTVRLGMEKDKKETVKEFKEEGAGVKQEVAAW  301

Query  257  LSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
               +S      G+    P  +      D+ +LE ML+SG+ +GA   +K
Sbjct  302  AKSLSEGTPNPGQA---PEQALA----DLEILEKMLKSGENQGAAQSLK  343



>gb|ERT03209.1| hypothetical protein HMPREF1624_01515 [Sporothrix schenckii ATCC 
58251]
Length=348

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/237 (30%), Positives = 122/237 (51%), Gaps = 31/237 (13%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRRN--FFG  615
            +PIW+VAEN+R+     +    I +IG  ++   ++  G +   + Y++++WR+   + G
Sbjct  129  RPIWSVAENFRYLRVVRDAAAKIKDIGGRLVGFHLVRNGFVLEDDKYYNTAWRKEPGYQG  188

Query  614  GFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GF+LD GVH+VAGLR L+   G EV  V++ +S ++K LPP D+I A+     G +G  +
Sbjct  189  GFLLDGGVHFVAGLRFLLAAAGDEVARVASFSSLLEKRLPPVDSIHAVASTRGGVNGTIS  248

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS------VSLYMGDGQIKSFFY-PFC  285
            M   +               LE+E    +G+  ++      VS+  G    K+  Y P  
Sbjct  249  MSFGTE----------FKNVLEIEVVTTEGRVTWTWAPSSIVSVRRGQTDPKTDTYEPDF  298

Query  284  GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            GV       +S+++         + +P+ S  E  +D+A+L+A+LESG   GA+  V
Sbjct  299  GV-------VSEVAAFAASVAAGQADPQQSPQEALKDLALLQALLESGP-TGAITNV  347



>ref|XP_003347717.1| hypothetical protein SMAC_03815 [Sordaria macrospora k-hell]
 emb|CCC11108.1| unnamed protein product [Sordaria macrospora k-hell]
Length=355

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 114/231 (49%), Gaps = 26/231 (11%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            +KP+WAV ENYR+ P+     + + E+ G +   ++ + G +   N YF + WR+  ++ 
Sbjct  137  KKPLWAVGENYRYTPSLMAAAEKVKEVGGKLTTFRLNMNGWVEEENKYFKTEWRKVPSYQ  196

Query  617  GGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD GVH+VAGLR+L+     +++ V   +  +++ L P D + A+     G SG  
Sbjct  197  GGFLLDGGVHFVAGLRLLLSSLDQDISQVVGFSHLLEERLLPVDTVHAVALTSEGKSGTI  256

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGK---HGYSVSLYMGDGQIKSFFYPFCGVQ  276
            ++   ++              LEVE    +G    +   V     DG+    F    GV+
Sbjct  257  SISFGTQ----------FKSGLEVEVVTTNGSVYWNPTEVKTKTKDGEKAEQFERRSGVK  306

Query  275  EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
            EE+  F   I    T+  +    P     E  RD+ V++ +LESG+ +GA+
Sbjct  307  EEMAAFAQAIERGKTEKNQT---PE----EALRDLEVVQRLLESGEAKGAV  350



>gb|KIH86578.1| hypothetical protein SPBR_08549 [Sporothrix brasiliensis 5110]
Length=369

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 122/238 (51%), Gaps = 31/238 (13%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRRN--FFG  615
            +PIW+VAEN+R+     +    I +IG  ++   ++  G +   + Y++++WR+   + G
Sbjct  150  RPIWSVAENFRYLRVVRDAAAKIKDIGGRLVGFHLVRNGFVLEDDKYYNTAWRKEPGYQG  209

Query  614  GFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GF+LD GVH+VAGLR L+   G EV  V++ +S ++K LPP D+I A+     G +G  +
Sbjct  210  GFLLDGGVHFVAGLRFLLAAAGDEVARVASFSSLLEKRLPPVDSIHAVASTHGGVNGTIS  269

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS------VSLYMGDGQIKSFFY-PFC  285
            M   +               LE+E    +G+  ++      VS+  G    K+  Y P  
Sbjct  270  MSFGTE----------FKNVLEIEVVTTEGRVTWTWAPSSIVSVRRGQADPKTDTYEPDF  319

Query  284  GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            GV       +S+++         + +P  S  E  +D+A+L+A+LESG   GA+  V+
Sbjct  320  GV-------VSEVAAFAASVAAGQADPLQSPQEALKDLALLQALLESGP-TGAITNVE  369



>gb|KFZ16228.1| hypothetical protein V501_02319 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=350

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 116/231 (50%), Gaps = 24/231 (10%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  WAVAEN+RF   F   ++ I ++G ++  ++ +   + +   YF + WR+  ++ GG
Sbjct  128  KATWAVAENFRFLAPFRFARQEIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKIPSYQGG  187

Query  611  FILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH+ AG R+L+G      S+SA T+ +   LPP D +++++Q   G SG   + 
Sbjct  188  FLLDGGVHFTAGTRLLLGSLNRPVSLSAYTALIQPHLPPIDTVNSIWQTAKGISGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG---DGQI--KSFFYPFCGVQE  273
              +      + +   +G++ V R         +VS++ G   DG +  +       GV+ 
Sbjct  248  FGTSLSGDEYTIACYDGSVSVSRD--------TVSVHTGEEKDGNVTKRVLLSSGSGVKA  299

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  120
            E++ +   I          K  P  S  E   D+ +LEAM++SG+ EG  V
Sbjct  300  EVQAWAEGIEAG-------KENPLQSPAEALADLELLEAMIKSGEGEGVKV  343



>ref|XP_003840030.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
 emb|CBX96551.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
Length=342

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 118/226 (52%), Gaps = 27/226 (12%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFI  606
            ++AVAEN+R+  +F    + IA +G ++  +V +   + +   YF ++WR+   + GGF+
Sbjct  128  MYAVAENFRYLDSFLYAAREIASLGRVLTFRVRVAAYVEAGGKYFETAWRKVPEYQGGFL  187

Query  605  LDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            LD GVH++A +R+++   G ++  VSA T+ + K LPP D +++  +L +G SG  ++  
Sbjct  188  LDGGVHFIAAMRVMLQGGGEKIHGVSAFTAQLQKHLPPVDTLNSTLKLGSGASGTLSVSF  247

Query  434  SSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  267
             +      + V    G++ V RG     K+GK             +K F     GV++E+
Sbjct  248  GTTDKGSEYMVACEKGSVHVSRGKVTVVKEGKE-----------VVKEFGDEGNGVRQEI  296

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
            K +    SL   +  E +     S  E   D+ +LEA L SG+++G
Sbjct  297  KAWSE--SLEKGQRNEAQ-----SPEEALSDLKILEACLRSGEQDG  335



>ref|XP_011112776.1| hypothetical protein H072_7001 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39213.1| hypothetical protein H072_7001 [Dactylellina haptotyla CBS 200.50]
Length=364

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 124/232 (53%), Gaps = 22/232 (9%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            +PIW+VAEN+R+  AF   ++ +  +G ++  +V +   +     YF ++WR+   + GG
Sbjct  128  EPIWSVAENFRYWKAFEYARQQVNGLGKVLAFRVEVMQYVAPGGKYFETAWRKVPEYQGG  187

Query  611  FILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            F LD GVHY AGLRMLVG  + +S+SA T+   + L P D I +  +L++G  G FAM  
Sbjct  188  FCLDAGVHYTAGLRMLVGEDQFSSLSAFTALNQQHLVPIDTIMSTIKLKSGVCGTFAMSH  247

Query  434  SSRSPKIV-WRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFY----PFCGVQEE  270
             + S K   + +V   GT+++  G+K       V++   D   +S  +     + GV+ E
Sbjct  248  GTPSAKAFDFLIVCEEGTVKIGDGSK-------VTVKKTDMPEESVAFGGEDGWNGVKAE  300

Query  269  LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            +K F   ++    KG    G    S  +   D+ ++E M++SG++ G   +V
Sbjct  301  VKAFAEAVA----KG---VGNDDQSPEKAVADLELIEKMIQSGEQGGKPFEV  345



>ref|XP_003045334.1| hypothetical protein NECHADRAFT_70521 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU39621.1| hypothetical protein NECHADRAFT_70521 [Nectria haematococca mpVI 
77-13-4]
Length=345

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 112/228 (49%), Gaps = 23/228 (10%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            +A+AEN+RF+P+F       A++G +    V + G M +   +++++WR    + GGF+L
Sbjct  134  FAIAENFRFKPSFEYAAVEAAKLGSVQQFNVRVLGYMGADTQWYATAWRAKPEYQGGFLL  193

Query  602  DMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRS  423
            D GVH+ A  RML+      V A T+     LPP D ++A+ +LE+G SGV+     SR 
Sbjct  194  DGGVHFAAATRMLLTTRAADVRAQTALTQPHLPPIDTVNAVVRLESGVSGVYQQSAGSRL  253

Query  422  PKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDIS  243
                +      GT+ V  G+K      +V+   G+  +K F     GV EE++ +   + 
Sbjct  254  SAFDFDFSYEKGTVSVS-GDK-----VTVTPLEGEAVVKEFERT-SGVSEEVEAWGKAL-  305

Query  242  LANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
                      G+P  R S  +   D+  LE M ESG   G   + KK+
Sbjct  306  --------VAGKPDERQSVEKALGDLEFLEQMFESGSNGG---ETKKY  342



>ref|XP_002183307.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45007.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=416

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 115/263 (44%), Gaps = 49/263 (19%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIA--------------------EIGDMMNVQVIIEGsmns  660
            +W+VAEN+R+EP      + +A                     IG  +   + I      
Sbjct  165  VWSVAENFRYEPGIVATSRAVATSVPTDADSSSSSSSSVPTHTIGTPLLASLQIRAPFLP  224

Query  659  snpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  486
             N + ++ WR+N  ++GG  +D  VH+ AGLR ++G EV +VSA+TS     LP  D ++
Sbjct  225  DNQFLNTPWRKNASWYGGLFIDSFVHHAAGLRAVLG-EVETVSAVTSDRADYLPGVDTLA  283

Query  485  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN--------------KDGKH  348
            A     +G  GV ++  + R  +  + + G  GT+ +ER                  G  
Sbjct  284  AQLTWSSGVQGVVSVTYAGRDLQYEFGITGTTGTVSLERAGLGHRLTVVSSSHTASTGTD  343

Query  347  GYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGE--PRLSFVEGTRD  174
               V+         +  Y F GV+EE   F           G C+G+   R +  E  RD
Sbjct  344  REKVATTDNTSTTTTTEYGFTGVEEEFLAF----------AGACRGQGSDRNTPREALRD  393

Query  173  IAVLEAMLESGKREGALVQVKKF  105
            +A++E +L SG++ G  + V K+
Sbjct  394  LALVETLLASGQQNGRPLPVPKY  416



>dbj|GAM35894.1| oxidoreductase [Talaromyces cellulolyticus]
Length=349

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 109/220 (50%), Gaps = 17/220 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            W+VAEN+R+  +F   +  I ++G ++  +V I  ++     +F +SWR+N    GGF+L
Sbjct  130  WSVAENFRYLESFKNARLEIEKLGKIIGFRVRIYANIQEGWKFFETSWRKNPTHQGGFLL  189

Query  602  DMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVHY A LR L+G +  VT ++A T+ + + LPP D + A+ +   G  G F   V++
Sbjct  190  DGGVHYTAALRGLLGSDVHVTRLAAFTTLLKEHLPPVDTMDAILKTNTGIQGTFQSSVAT  249

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  W +    GT+ V       K   +V    G+   K+      GV  E++ +   
Sbjct  250  TLTGPEWTIACEKGTVTV------AKSEVTVRPVDGEEVTKTIPDERTGVPPEIRAWGEA  303

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
            ++         +  P  S  E   D+ +++ ML SG++EG
Sbjct  304  LAAG-------RQNPEQSPEEALADLELIQLMLRSGEKEG  336



>ref|XP_007295758.1| oxidoreductase family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13668.1| oxidoreductase family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=344

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 119/227 (52%), Gaps = 23/227 (10%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            WAVAEN+RF  +F   ++ + ++G ++  +V   G +     YF ++WR+  +  GGF+L
Sbjct  127  WAVAENFRFLDSFKFGREQVEKLGKVLGFRVKQAGKVKMGGKYFETAWRKRPDHQGGFLL  186

Query  602  DMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+VAG+R+L+G   + T++SA T  + + L P D + +++Q ++G +G F+    +
Sbjct  187  DGGVHFVAGIRLLLGNNAKPTALSAFTHLLQEHLAPVDTVDSIWQTKSGVTGTFSACFGT  246

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF-----CGVQEELK  264
                  + V   NG++ V    K       V + +G+   K+F   +      GV++E+K
Sbjct  247  TLSGSEYTVACENGSVTVIVREK-------VIVRLGEESDKNFKEEWFKEEGSGVKQEVK  299

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
             +   +        + K  P  S  E   D+ +LE ML SG++ G L
Sbjct  300  AWAQSLV-------DRKPLPAQSPEEALIDLEILEKMLRSGEQNGQL  339



>gb|KFY75511.1| hypothetical protein V499_04510 [Pseudogymnoascus pannorum VKM 
F-103]
Length=350

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 118/235 (50%), Gaps = 24/235 (10%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  WAVAEN+RF   F   ++ I ++G ++  ++ +   + +   YF + WR+  ++ GG
Sbjct  128  KATWAVAENFRFLAPFRFARQEIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKIPSYQGG  187

Query  611  FILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH+ AG R+L+G      S+SA T+ +   LPP D +++++Q   G SG   + 
Sbjct  188  FLLDGGVHFTAGTRLLLGSVNRPVSLSAYTALIQPHLPPIDTVNSIWQTAKGISGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG---DGQI--KSFFYPFCGVQE  273
              +      + +   +G++ V R         +VS++ G   DG +  +       GV+ 
Sbjct  248  FGTSLSGDEYTIACYDGSVSVSRD--------TVSVHTGEEKDGNVTKRVLLSSGSGVKA  299

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  108
            E++ +   I          K  P  S  E   D+ +LEAM++SG+ +G  V + +
Sbjct  300  EVQAWAEGIEAG-------KENPLQSPAEALADLELLEAMIKSGEGDGVKVLLTR  347



>ref|XP_002146783.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
marneffei ATCC 18224]
 gb|EEA26236.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
marneffei ATCC 18224]
Length=346

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 112/222 (50%), Gaps = 21/222 (9%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            W VAEN+R+  +F   ++ I ++G+++  +V I  ++     +F +SWR+N    GGF+L
Sbjct  127  WGVAENFRYLKSFQYARQEIEKLGEIIGFRVRIYANIKQDWKFFQTSWRKNPTHQGGFLL  186

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVHY A LR L+G +V  T ++A T+ + + LPP D + A+ +   G  G F   V++
Sbjct  187  DGGVHYTAALRGLLGPDVHFTRLAAFTTLLKEHLPPVDTMDAILKTNTGIQGTFQSSVAT  246

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPFCGVQEELKTFL  255
                  W +    GT+ V         G  V++   DG+  +++      GV  E++ + 
Sbjct  247  TLTGPEWTIACEKGTVTVV--------GSDVTVRPVDGEELVQTIADERTGVPPEIRAWG  298

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
              ++         +  P  +  E   D+ ++E ML SG+ EG
Sbjct  299  EALAAG-------RQNPEQTPEEALADLELIELMLRSGESEG  333



>ref|XP_011399715.1| Uncharacterized protein F751_0699 [Auxenochlorella protothecoides]
 gb|KFM26767.1| Uncharacterized protein F751_0699 [Auxenochlorella protothecoides]
Length=375

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/248 (28%), Positives = 119/248 (48%), Gaps = 25/248 (10%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFIL  603
            W+V ENYR E       ++     +G ++   ++ E  MN  + Y++S+WRR   G F+L
Sbjct  128  WSVQENYRGESGLVMAAELARSGALGRLVKADLVAELPMNPGSRYYASAWRRQLPGSFLL  187

Query  602  DMGVHYVAGLRMLVGC----EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            + GVH+VA LR++       E   VSA+ +   + +P PD +    + + G     ++  
Sbjct  188  EGGVHFVAALRLVCAAAGAGEPGRVSALLTRGSEGVPGPDTLVGWARFDGGVPAGVSITQ  247

Query  434  SSRSPKI--------VWRVVGL--NGTLEVERGNKDGKHGYSVSLYM------GD--GQI  309
            +   P++        VW VV +   GT+E +RG          + Y       GD    +
Sbjct  248  AGAIPRLCVTLVGTQVWMVVWIARGGTIEAKRGQWGAWTAAPANSYTLHAESSGDVPASV  307

Query  308  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
                 PF GV  ++  F++  + A   G + + +  LS  E  RD+A++EA+L SG+R+G
Sbjct  308  DQRVLPFDGVGTQVGAFVAHAA-ALRDGRDAELDASLSVQEAARDLALMEALLRSGERQG  366

Query  128  ALVQVKKF  105
              V V++ 
Sbjct  367  EAVDVERL  374



>gb|KFY61799.1| hypothetical protein V496_04887 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY99520.1| hypothetical protein V498_00671 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=852

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 117/233 (50%), Gaps = 20/233 (9%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF   F   ++ I ++G ++  +V +   + +   YF + WR+  ++ GG
Sbjct  630  KATWGVAENFRFMAPFIFARQEIEKLGGVVGFRVKVFQHVKAGTKYFETEWRKVPSYQGG  689

Query  611  FILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH+ A  R+L+G      S+SA T+ +   LPP D +++++Q  NG SG   + 
Sbjct  690  FLLDGGVHFTAATRLLLGANYRPKSLSAYTALLQPHLPPVDTVNSIWQTANGISGTVQIS  749

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGVQEELK  264
              +      + +   NG++ V R     + G        DG + +   P    GV+ E+K
Sbjct  750  FGTSLSGDEYTIACYNGSVVVSRDTVSVRSGEE-----KDGNVTTRVLPASGSGVKAEVK  804

Query  263  TFLSDISLANTKGGECKGEPRL-SFVEGTRDIAVLEAMLESGKREGALVQVKK  108
             +         +G E  GE  L S  E   D+ +LEAM++SG+ EG  V + +
Sbjct  805  AW--------AEGIESGGENGLQSPAEALADLELLEAMIKSGEGEGVKVILTR  849



>ref|XP_755974.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus Af293]
 gb|EAL93936.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus Af293]
 gb|EDP55143.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus A1163]
 gb|KEY76538.1| oxidoreductaseNAD binding Rossmann fold protein [Aspergillus 
fumigatus var. RP-2014]
Length=379

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 116/235 (49%), Gaps = 38/235 (16%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR-----R  627
            T+K +WAVAEN+R+   F    + + ++G + N +V     +++ + YFS  +R      
Sbjct  160  TRKTLWAVAENFRYMTKFLRTAEEVQKLGRVKNFRVNFHALVSTDSKYFSKLYRLRSTSH  219

Query  626  NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  453
            ++ GGFILD GVH VA LR+++G    V ++SA +    + LPP D ++A+ + ++G +G
Sbjct  220  DYLGGFILDGGVHVVAALRLILGSNDPVATISAQSCLQQQHLPPLDTVNAVMKTKSGATG  279

Query  452  VFAMVVSSRSPKIVWR------VVGLNG-TLEVERGNKDGKHGYSVSLYMGDGQIKSFFY  294
            V ++   S     V+       VV LN  TL ++                  G+     +
Sbjct  280  VLSLSFGSAFDDSVFEFDCEGGVVALNSDTLTIK------------------GESNELAF  321

Query  293  PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
               GV  E+  F + I+     GG    + R S  E   D+ ++E ML SG+R+G
Sbjct  322  DGRGVSREVAVFATTIA----SGGSV--DKRQSPEEALADLEIMEKMLTSGERDG  370



>gb|KIH88824.1| hypothetical protein SPBR_07486 [Sporothrix brasiliensis 5110]
Length=343

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 114/229 (50%), Gaps = 20/229 (9%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWR  630
            T   Q  +++VAE  RF P F   ++ + +   +G +  + + I  +  +   Y+ + WR
Sbjct  124  TYAGQGLVFSVAEQIRFMPEFERGRQWVVDEQALGTITQLHLRIWRNQAAGGKYYETPWR  183

Query  629  R--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
            +   + GGF+LD GVH  A LR + G EV         V   LPP D ++A   L  G +
Sbjct  184  KVPAYQGGFLLDGGVHQTAMLRYIAGQEVVETHGYARQVAPHLPPLDTVNAGLVLSGGAT  243

Query  455  GVFAMVVSS--RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCG  282
            G  +M  +S  R+ ++V  ++G  G+  +     DG  GY ++L +  G+ ++      G
Sbjct  244  GTLSMSFASPRRATELV--ILGTQGSFHL----TDGPDGYVLTLELLSGERRTETIKSRG  297

Query  281  VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
            V+ E+K FL  I+     GG  K +PR    E   D+A++E++ + G +
Sbjct  298  VELEVKAFLEAIA-----GG--KAQPRAGPEEALNDLAIIESLCQGGGK  339



>ref|XP_004152962.1| PREDICTED: uncharacterized protein LOC101204258, partial [Cucumis 
sativus]
Length=81

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/59 (78%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNF  621
            N +++ +WAVAENYRFEPAF ECK +IA+IGDMM+VQVI+EGSMNSSNPYFSSSWRR+F
Sbjct  17   NFSRQRLWAVAENYRFEPAFVECKNLIADIGDMMSVQVIVEGSMNSSNPYFSSSWRRDF  75



>gb|KEZ39853.1| Oxidoreductase-like protein [Scedosporium apiospermum]
Length=348

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 113/232 (49%), Gaps = 25/232 (11%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            +PIW VAEN+RF  + T   + I  IG +++     +   +   + YF++ WR+  ++ G
Sbjct  127  RPIWGVAENFRFLESVTYATEQIRAIGGEIVTFSFSLYALVKDDDKYFNTDWRKIPDYQG  186

Query  614  GFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GF+LD GVH+VAG+R  +   G EV  +SA TS + + LPP D +  L    +G SG F 
Sbjct  187  GFLLDGGVHFVAGIRSFLAAAGQEVKQLSARTSLIQEKLPPVDTVHGLLTTGSGRSGTFC  246

Query  443  MVVSSR-SPKIVWRVVGLNGTLEVE----RGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  279
            +   +         +V   G + +        K G  G          + K  F    GV
Sbjct  247  VSFGTEFKSDFCIELVTTKGAVRLTPVEVTTTKQGTDGEK-------AEEKKIFEFSVGV  299

Query  278  QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
            + E+  F   I     + GE   +PR +  +G +D+ +L+ +LESG+  GA+
Sbjct  300  KPEIVAFAKSI-----QKGEV--DPRQTPEQGYKDLEILQGLLESGECSGAI  344



>ref|XP_009854174.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO54186.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ68383.1| NAD(P)-binding protein [Neurospora tetrasperma FGSC 2509]
Length=352

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 119/235 (51%), Gaps = 38/235 (16%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            +KP+WAVAEN+R+ P+  +  + + EI G +   ++ + G +   N YF + WR+  ++ 
Sbjct  134  KKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEEGNKYFKTEWRKVPSYQ  193

Query  617  GGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD GVH++AGLR+L+     E+T V+  ++ +++ L P D + A+    +G SG  
Sbjct  194  GGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVDTVHAVALTNDGKSGTI  253

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF---------FY  294
            ++   ++              LEVE     G      S+Y    QIK+          F 
Sbjct  254  SISFGTQ----------FKTGLEVEVVTTQG------SVYWNPTQIKTKTKEGEKTEEFE  297

Query  293  PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
               GV+EE+  F   I     + G+ + E      E  +D+ V++ +LESG+ +G
Sbjct  298  KSTGVKEEMAAFAKAI-----EKGQIEKEQTPE--EALKDLEVVQRLLESGEGKG  345



>ref|XP_011318574.1| hypothetical protein FGSG_02628 [Fusarium graminearum PH-1]
 gb|ESU08089.1| hypothetical protein FGSG_02628 [Fusarium graminearum PH-1]
 gb|EYB30901.1| hypothetical protein FG05_02628 [Fusarium graminearum]
 emb|CEF74956.1| unnamed protein product [Fusarium graminearum]
Length=358

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 114/222 (51%), Gaps = 16/222 (7%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  +++AEN+R++P F       A++G + +  V +   M+  + ++ +SWR    F GG
Sbjct  143  KGTFSIAENFRYKPCFEYAANEAAKLGALQHFSVRVLFFMSEDSQWYGTSWRAKPQFQGG  202

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +R L       VSA TS V   L P D ++A+ +L++G SG +     
Sbjct  203  FLLDGGVHFVAAMRQLFDEPAADVSAFTSQVQPHLAPVDTVNAVIRLKSGVSGTYQQSCG  262

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            ++     ++     G++ V+ G+K      +V+ + G+  +K F     GV EE++ + +
Sbjct  263  TKMSTSAFQFGYEKGSVVVD-GDK-----VTVTPWEGEQVVKDFERT-SGVDEEIEAWAN  315

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
             +        + K + R S  E   D+ +LE M ESG   GA
Sbjct  316  ALV-------DGKPDKRQSVEEALADLELLEMMFESGSDGGA  350



>ref|XP_006696746.1| hypothetical protein CTHT_0064410 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS18415.1| hypothetical protein CTHT_0064410 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=510

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 117/238 (49%), Gaps = 27/238 (11%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNV-QVIIEGsmnssnpyfssSWRR--NFF  618
            +KP+W VAEN+RF  +     + + EIG ++   ++   G +   N YF++ WRR   + 
Sbjct  128  RKPVWGVAENFRFLESLAYAAQKVKEIGGLLRTFRLEKYGFVGEDNKYFNTEWRRVPQYQ  187

Query  617  GGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD GVH+VA LR L+G    E+  V+A TS ++  L P D + A+   + G SG  
Sbjct  188  GGFLLDGGVHFVAALRFLLGAAGHELDKVAAFTSLLEPRLLPADTVHAVAFTKGGKSGTI  247

Query  446  AMVVSSRSPKIVW-RVVGLNGTL-----EVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  285
             +   +    ++   VV  NG +      V   N+ G         + D  +K+  +P+C
Sbjct  248  NITFGTEFKDVLEVEVVTTNGAVTWTPNAVTTVNRKGD-------CLADKAVKTKEFPYC  300

Query  284  -GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
             GV  E+ +F   +            + R    EG +D+ V++ MLESG+  G L  V
Sbjct  301  SGVLAEVASFAQALESGRL-------DLRQMPAEGLKDLEVVQRMLESGEDHGVLKTV  351



>ref|XP_002479070.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
stipitatus ATCC 10500]
 gb|EED22107.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
stipitatus ATCC 10500]
Length=354

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 109/220 (50%), Gaps = 17/220 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            W+VAEN+R+  +F   ++ I E+G ++  +V +  ++     ++ +SWR+     GG+IL
Sbjct  132  WSVAENFRYLESFKYARQQIEELGKIIGFRVRVYANITEDFKFYHTSWRKEPTHQGGYIL  191

Query  602  DMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ AGLR+L+G +  V  V+A T+ + + LPP D + A+ +   G  G F   V++
Sbjct  192  DGGVHFTAGLRLLLGSDVFVERVAAFTTSLKEHLPPVDTVDAILKTNTGIQGTFQSSVAT  251

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  W +   NG++ V           +V    G+  +K       GV  E++ +   
Sbjct  252  TLTGPEWTIACENGSVTVSSSTV------TVLSVDGEEVVKEIPNERSGVPPEVRAWGEA  305

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
            ++         +  P  +  EG  D+ ++E ML SG  +G
Sbjct  306  LAAG-------RQNPEQTPEEGLADLELIELMLRSGNHDG  338



>ref|XP_009263289.1| hypothetical protein FPSE_11897 [Fusarium pseudograminearum CS3096]
 gb|EKJ67888.1| hypothetical protein FPSE_11897 [Fusarium pseudograminearum CS3096]
Length=354

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 115/226 (51%), Gaps = 16/226 (7%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--N  624
            ++  K  +++AEN+R++P F       A++G + +  V +   M   + ++ +SWR    
Sbjct  135  SLQGKCTFSIAENFRYKPCFEYAANEAAKLGALQHFSVRVFFFMAEDSKWYGTSWRAKPQ  194

Query  623  FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            F GGF+LD GVH+VA +R L       VSA TS V   L P D ++A+ +L++G SG + 
Sbjct  195  FQGGFLLDGGVHFVAAMRQLFDEPAADVSAFTSQVQPHLAPVDTVNAVIRLKSGVSGTYQ  254

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
                ++     ++     G++ V+ G+K      +V+ + G+  +K F     GV EE++
Sbjct  255  QSCGTKMSTSAFQFGYEKGSVVVD-GDK-----VTVTPWEGEQVVKDFERT-SGVDEEIE  307

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
             + + +        + K + R S  E   D+ +LE M ESG   GA
Sbjct  308  AWANALV-------DGKPDKRQSVEEALADLELLEMMFESGSDGGA  346



>gb|ERT02500.1| hypothetical protein HMPREF1624_00799 [Sporothrix schenckii ATCC 
58251]
Length=343

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 108/227 (48%), Gaps = 16/227 (7%)
 Frame = -1

Query  800  TNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWR  630
            T   Q  ++++AE  RF+P F + ++ + +   +G +  + + I  +  +   Y+ + WR
Sbjct  124  TYAGQGLVFSIAEQIRFQPEFEKGRQWVVDEQALGTITQLHLRIWRNQAAGGKYYETPWR  183

Query  629  R--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
            +   + GGF+LD GVH  A LR + G EV         V   LPP D ++A   L  G +
Sbjct  184  KVPAYQGGFLLDGGVHQTAMLRYISGQEVVETHGYARQVAPHLPPLDTVNAGLVLSGGAT  243

Query  455  GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  276
            G  +M  +S        ++G  G+  +     DG  GY ++L +  G+ ++      GV+
Sbjct  244  GTLSMSFASTRRATELVIIGTQGSFHL----TDGPDGYVLTLELLSGERRTETIKSRGVE  299

Query  275  EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
             E+K FL  I+         K + R    E   D+A++E++ + G +
Sbjct  300  LEVKAFLEAIA-------SGKAQSRAGPEEALNDLAIIESLCQGGGK  339



>gb|KHE80312.1| NAD(P)-binding protein, partial [Neurospora crassa]
Length=355

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 120/243 (49%), Gaps = 38/243 (16%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmnssnpyfssSWRR--  627
            N  +KP+WAVAEN+R+ P+  +  + + EI G +   ++ + G +   N YF + WR+  
Sbjct  136  NNKKKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEEGNKYFKTEWRKVP  195

Query  626  NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
            ++ GGF+LD GVH++AGLR+L+     E+T V+  ++ +++ L P D + A+    +G S
Sbjct  196  SYQGGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVDTVHAVALTNDGKS  255

Query  455  GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF----  288
            G  ++   ++              LEVE     G      S+Y    QIK+         
Sbjct  256  GTISISFGTQ----------FKTGLEVEVVTTQG------SVYWNPTQIKTKTKEGEETE  299

Query  287  -----CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
                  GV+EE+  F   I    T   E +  P     E  +D+ V++ +LESG+ +G +
Sbjct  300  EFEKSTGVKEEMAAFAKAIEKGQT---EKEQTPE----EALKDLEVVQRLLESGEGKGVV  352

Query  122  VQV  114
              V
Sbjct  353  KAV  355



>ref|XP_960192.1| NAD-binding Rossmann fold oxidoreductase [Neurospora crassa OR74A]
 gb|EAA30956.1| NAD-binding Rossmann fold oxidoreductase [Neurospora crassa OR74A]
Length=357

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 118/238 (50%), Gaps = 38/238 (16%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmnssnpyfssSWRR--  627
            N  +KP+WAVAEN+R+ P+  +  + + EI G +   ++ + G +   N YF + WR+  
Sbjct  136  NNKKKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEEGNKYFKTEWRKVP  195

Query  626  NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
            ++ GGF+LD GVH++AGLR+L+     E+T V+  ++ +++ L P D + A+    +G S
Sbjct  196  SYQGGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVDTVHAVALTNDGKS  255

Query  455  GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF----  288
            G  ++   ++              LEVE     G      S+Y    QIK+         
Sbjct  256  GTISISFGTQ----------FKTGLEVEVVTTQG------SVYWNPTQIKTKTKEGEETE  299

Query  287  -----CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
                  GV+EE+  F   I    T   E +  P     E  +D+ V++ +LESG+ +G
Sbjct  300  EFEKSTGVKEEMAAFAKAIEKGQT---EKEQTPE----EALKDLEVVQRLLESGEGKG  350



>ref|XP_001554573.1| hypothetical protein BC1G_07162 [Botrytis cinerea B05.10]
 emb|CCD44433.1| similar to oxidoreductase family [Botrytis cinerea T4]
 gb|EMR88754.1| putative oxidoreductase nad-binding rossmann fold protein [Botrytis 
cinerea BcDW1]
Length=345

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 115/222 (52%), Gaps = 18/222 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            W+VAEN+RF  +F   +K I ++G ++  ++ + GS+     YF + WR+  ++ GGF+L
Sbjct  127  WSVAENFRFLDSFIHARKEIEKLGRVLGFRIQVFGSVKPGMKYFETEWRKKPDYQGGFLL  186

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A  R+L+G E   T+V A ++ + + LPP D I++++  ++G SG F++   +
Sbjct  187  DGGVHFTAAGRLLLGEEAKPTAVVAFSTLLREHLPPVDTINSIWLTKSGISGTFSVSFGT  246

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  + V   +G++ V R     + G        + +   F     GV++E+  +   
Sbjct  247  TLSGPEYTVACEHGSVSVIRSKVIVRKGEESEKNFTEVE---FTEEGSGVKQEVAAWAQS  303

Query  248  ISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  129
            I           G+P  R S  E   D+ +LE +L SG+ +G
Sbjct  304  I---------VDGKPNSRQSPQEALADLEILEKLLRSGEEQG  336



>ref|XP_007588173.1| putative oxidoreductase nad-binding rossmann fold protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD44322.1| putative oxidoreductase nad-binding rossmann fold protein [Neofusicoccum 
parvum UCRNP2]
Length=330

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 111/232 (48%), Gaps = 36/232 (16%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF  ++    + + E+                      +SWR   ++ GG
Sbjct  127  KVTWGVAENFRFFESYRYGAEKVKELA---------------------TSWRTKPSYQGG  165

Query  611  FILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH++A  R+L+      TSVSA T+   + LPP D + A+++L NG SG F+  
Sbjct  166  FLLDGGVHFIAATRVLLSDSAHATSVSAFTALHQEHLPPVDTVDAIWKLSNGSSGTFSNS  225

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG---QIKSFFYPFCGVQEEL  267
             ++  P   +RVV   GT+    G       Y V++   D    + K F     GV  E+
Sbjct  226  FAAPVPVTEYRVVCERGTVTTGFGTVPFAPAY-VAVKRADADDEEKKEFPEVGFGVNPEV  284

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
              +   +     KGG    + R    E  +D+ +LEAML+SG++ GA V ++
Sbjct  285  AAWGQKLE----KGG---FDERQLPEEALKDLEILEAMLKSGEQGGAPVTLQ  329



>gb|EKV16143.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum Pd1]
 gb|EKV18638.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum PHI26]
Length=500

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/230 (31%), Positives = 117/230 (51%), Gaps = 32/230 (14%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            T+K  WAVAEN+RF   +    + + ++G + N +V +   M+ +N YF ++WR+  N+ 
Sbjct  125  TRKVFWAVAENFRFLTKYLFAAEQVQKLGRVQNFRVNVHSLMDENNKYFHTAWRKTPNYQ  184

Query  617  GGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH +A LR+++G    ++++SA +      LPP D + A+ + E+G +G+ +
Sbjct  185  GGFLLDGGVHMIAALRLILGPTERLSTLSAQSQLQQSFLPPVDTVDAVTKTESGATGIIS  244

Query  443  MVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIKSFFYPFCGVQE  273
            +   S     V+ V    G  TL  +    +G KH         DG+         GV  
Sbjct  245  LSWGSSFNDHVFEVACEKGLVTLNFDDVTINGEKHHVEF-----DGR---------GVVP  290

Query  272  ELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  129
            E+  F + I           G+P  R S  E   D+ +LE ML SG+++G
Sbjct  291  EVAEFANSI---------VSGKPDIRQSAEEALADLEILEQMLRSGEKDG  331



>gb|KFZ09203.1| hypothetical protein V502_08867 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=350

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 110/228 (48%), Gaps = 18/228 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF       ++ I ++G ++  ++ +   + +   YF + WR+  ++ GG
Sbjct  128  KATWGVAENFRFLEPLKFARQQIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKVPSYQGG  187

Query  611  FILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH+ AG R+L+G     +S+SA T+ +   LPP D +++++Q  NG SG   + 
Sbjct  188  FLLDGGVHFTAGTRLLLGPHNRPSSLSAYTALLQPHLPPIDTVNSIWQTTNGISGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS--FFYPFCGVQEELK  264
              +      + +    G++ V R     + G        DG + S        GV+ E+K
Sbjct  248  FGTSLSGDEYTIACYEGSVTVSRDTVTVRSGEE-----KDGNLTSRVILGSGSGVKAEVK  302

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  120
             +   I        +       S  E   D+ +LEAM++SG+ EG  V
Sbjct  303  AWAEGIEAGVENAAQ-------SPAEALADLELLEAMIKSGEGEGVKV  343



>gb|EIT80267.1| putative dehydrogenase [Aspergillus oryzae 3.042]
 gb|KDE78827.1| putative dehydrogenase [Aspergillus oryzae 100-8]
Length=333

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/230 (28%), Positives = 111/230 (48%), Gaps = 29/230 (13%)
 Frame = -1

Query  794  MTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--F  621
            ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR   +
Sbjct  116  VSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKPEY  175

Query  620  FGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
             GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +GV 
Sbjct  176  QGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATGVL  235

Query  446  AMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGV  279
            ++   S     ++     +G  TL+ +R   +G+ GY V              PF   GV
Sbjct  236  SVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGRGV  280

Query  278  QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             +EL  F   I+  +      + E  L+      D+ V+E +  S ++ G
Sbjct  281  NKELVEFAESITTGDGIATRLRPEEALA------DLEVMEGIFTSSEKAG  324



>gb|KFY88446.1| hypothetical protein V500_06334 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=350

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 110/228 (48%), Gaps = 18/228 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF       ++ I ++G ++  ++ +   + +   YF + WR+  ++ GG
Sbjct  128  KATWGVAENFRFLEPLKFARQQIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKVPSYQGG  187

Query  611  FILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH+ AG R+L+G     +S+SA T+ +   LPP D +++++Q  NG SG   + 
Sbjct  188  FLLDGGVHFTAGTRLLLGPHNRPSSLSAYTALLQPHLPPIDTVNSIWQTTNGISGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS--FFYPFCGVQEELK  264
              +      + +    G++ V R     + G        DG + S        GV+ E+K
Sbjct  248  FGTSLSGDEYTIACYEGSVTVSRDTVTVRSGEE-----KDGNLTSRVILGSGSGVKAEVK  302

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  120
             +   I        +       S  E   D+ +LEAM++SG+ EG  V
Sbjct  303  AWAEGIEAGVENAAQ-------SPAEALADLELLEAMIKSGEGEGVKV  343



>gb|ELR09495.1| hypothetical protein GMDG_00677 [Pseudogymnoascus destructans 
20631-21]
Length=350

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 115/229 (50%), Gaps = 26/229 (11%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF   F   ++ I ++G ++  ++ +   + +   YF + WR+  ++ GG
Sbjct  128  KASWGVAENFRFLAPFKFARREIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKIPSYQGG  187

Query  611  FILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            F+LD GVH+ AG R+L+G      S+SA T+ +   LPP D +++++Q   G SG   + 
Sbjct  188  FLLDGGVHFTAGTRLLLGPLNRPVSLSAYTALIQPHLPPIDTVNSIWQTTKGVSGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG---DGQIKS--FFYPFCGVQE  273
              +      + +   +G++ V R         +VS++ G   DG + +        GV+ 
Sbjct  248  FGTSLSGDEYTIACYDGSVSVSRD--------TVSVHNGEEKDGNVTTRVLLSSGSGVKA  299

Query  272  ELKTFLSDISLANTKGGECKGEPRL-SFVEGTRDIAVLEAMLESGKREG  129
            E+  +         +G E   E  L S  E   D+ +LEAM++SG+ EG
Sbjct  300  EVHAW--------AEGIETGKENSLQSPAEALADLELLEAMIKSGEGEG  340



>ref|XP_002382548.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
flavus NRRL3357]
 gb|EED47706.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
flavus NRRL3357]
Length=341

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/230 (28%), Positives = 111/230 (48%), Gaps = 29/230 (13%)
 Frame = -1

Query  794  MTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--F  621
            ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR   +
Sbjct  124  VSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKPEY  183

Query  620  FGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
             GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +GV 
Sbjct  184  QGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATGVL  243

Query  446  AMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGV  279
            ++   S     ++     +G  TL+ +R   +G+ GY V              PF   GV
Sbjct  244  SVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGRGV  288

Query  278  QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             +EL  F   I+  +      + E  L+      D+ V+E +  S ++ G
Sbjct  289  NKELVEFAESITTGDGIATRLRPEEALA------DLEVMEGIFTSSEKAG  332



>dbj|BAE61316.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=341

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/230 (28%), Positives = 111/230 (48%), Gaps = 29/230 (13%)
 Frame = -1

Query  794  MTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--F  621
            ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR   +
Sbjct  124  VSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKPEY  183

Query  620  FGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
             GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +GV 
Sbjct  184  QGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATGVL  243

Query  446  AMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGV  279
            ++   S     ++     +G  TL+ +R   +G+ GY V              PF   GV
Sbjct  244  SVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGRGV  288

Query  278  QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             +EL  F   I+  +      + E  L+      D+ V+E +  S ++ G
Sbjct  289  NKELVEFAESITTGDGIATRLRPEEALA------DLEVMEGIFTSSEKAG  332



>emb|CCT69021.1| related to dehydrogenases and related proteins [Fusarium fujikuroi 
IMI 58289]
Length=322

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 114/229 (50%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  107  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  166

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L+ G SG +     
Sbjct  167  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKGGVSGTYQQSCG  226

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V  + G+  +K F     GV EE++ +  
Sbjct  227  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVKPWDGEPAVKEFERT-SGVTEEVEAWAK  279

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  280  ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  318



>ref|XP_006962588.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR51025.1| predicted protein [Trichoderma reesei QM6a]
Length=325

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 101/218 (46%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            I+ +AE +RF   F   ++ + +   IGD+    + I         ++ + WR+   + G
Sbjct  113  IFNIAEQFRFMHEFERGREWVVDEQAIGDITQAHLRIWRHQPPEGKWYETPWRKVPEYQG  172

Query  614  GFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            GF+LD GVH  A LR + G EV   +     V   LPP D ++A   L  G +G  +M  
Sbjct  173  GFLLDGGVHQTAMLRFISGQEVVETAGFARQVLPHLPPLDTLNAGILLSGGGTGTISMSF  232

Query  434  SSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            +S        ++G  G+  +     DG  G ++SL +  G+ +S      GV+ E+K FL
Sbjct  233  ASIRRATELTIIGSKGSFSL----TDGPDGSTLSLDLATGERRSETIRSKGVELEIKAFL  288

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              I     K G  K E R    E   D+A++E+M   G
Sbjct  289  EAI-----KAG--KSEKRAGPEEALNDLAIIESMCSGG  319



>gb|KIM22883.1| hypothetical protein M408DRAFT_332653 [Serendipita vermifera 
MAFF 305830]
Length=372

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 120/242 (50%), Gaps = 31/242 (13%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDM--MNVQVIIEGsmnssnpyfssSWRR--NFF  618
            +W VAEN+  EP      K IAE  IG +   N QV+   ++N+   ++ + WR   ++ 
Sbjct  140  VWRVAENFEAEPGLQAAGKAIAEQKIGKVCFWNYQVL--NNVNTDGMWYKTPWRTVPDYQ  197

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM-  441
            GGF+LD GVH  A LR ++   +  +S + S   + L P D I  L + ++G  G+F + 
Sbjct  198  GGFLLDGGVHSAAALRTVLPSPLQQLSGLASLNREHLAPHDTIHTLIRSKDGSHGLFELS  257

Query  440  --VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM-------GDGQIKSFFYPF  288
              + SS      +RVVG  G L + + NK G+     + Y+        DG  +      
Sbjct  258  FGLPSSAGGGDSFRVVGTEGILLITKFNKPGEKEGESTQYIKVQITSAKDGSTEEIIEKT  317

Query  287  CGVQEELKTFLSDISLANTKG-GECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            CGV++EL +F      A+ +G  +  G+P    +   +D+AV++A L S    G++V + 
Sbjct  318  CGVKQELSSF-----AAHVRGQDDGLGKP----LRALQDVAVIQAALNS---NGSVVDLT  365

Query  110  KF  105
            K 
Sbjct  366  KL  367



>gb|ETS04874.1| NAD-binding Rossmann fold oxidoreductase [Trichoderma reesei 
RUT C-30]
Length=343

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 102/220 (46%), Gaps = 16/220 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            I+ +AE +RF   F   ++ + +   IGD+    + I         ++ + WR+   + G
Sbjct  131  IFNIAEQFRFMHEFERGREWVVDEQAIGDITQAHLRIWRHQPPEGKWYETPWRKVPEYQG  190

Query  614  GFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            GF+LD GVH  A LR + G EV   +     V   LPP D ++A   L  G +G  +M  
Sbjct  191  GFLLDGGVHQTAMLRFISGQEVVETAGFARQVLPHLPPLDTLNAGILLSGGGTGTISMSF  250

Query  434  SSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            +S        ++G  G+  +     DG  G ++SL +  G+ +S      GV+ E+K FL
Sbjct  251  ASIRRATELTIIGSKGSFSL----TDGPDGSTLSLDLATGERRSETIRSKGVELEIKAFL  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
              I     K G  K E R    E   D+A++E+M   G +
Sbjct  307  EAI-----KAG--KSEKRAGPEEALNDLAIIESMCSGGGK  339



>ref|XP_002839683.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83874.1| unnamed protein product [Tuber melanosporum]
Length=348

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 113/224 (50%), Gaps = 10/224 (4%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            W+VAEN+RF+ A+    + I  +G ++N +  +   +     Y+ +SWR+  ++ GGF+L
Sbjct  126  WSVAENFRFQEAWRHAHREITALGRVINFRSRVCWLVTPGWKYYETSWRKTPDYQGGFLL  185

Query  602  DMGVHYVAGLRMLVGCE-VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            D GVHY A +R+L+  E +  VSA T+   + LPP D ISA+F+ + G  G F + V + 
Sbjct  186  DAGVHYAASMRILLSDEKIVKVSAFTASNFEHLPPVDTISAIFKTDKGVVGSFEVSVGTT  245

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDI  246
                 + V   NG++ V   ++             D  +K F     GV  E+  F   +
Sbjct  246  FEGWEFAVACENGSVTVRPVSEVVILRRKPGGGFEDEIVKKFPDDKKGVGPEVAAFAKAV  305

Query  245  SLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
                    + +  P L+      D+ ++E ML SG+ +GA++++
Sbjct  306  IAG---APDERQTPELA----VGDLEMIEKMLRSGENDGAVMEI  342



>gb|EWG49872.1| glucose-fructose oxidoreductase [Fusarium verticillioides 7600]
 gb|EWG49873.1| glucose-fructose oxidoreductase [Fusarium verticillioides 7600]
Length=345

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 118/233 (51%), Gaps = 19/233 (8%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--  624
            ++  K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    
Sbjct  126  SLGDKATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPE  185

Query  623  FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG + 
Sbjct  186  FQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVVRLKSGVSGTYQ  245

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
                S+    V++     G++ V+ G+K      +V+ + G+  +K F     GV EE++
Sbjct  246  QSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDGEPAVKEFERT-SGVTEEVE  298

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             +   ++       E + + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  299  AWSKALA-------EGRPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>ref|XP_002567221.1| Pc21g01510 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP95048.1| Pc21g01510 [Penicillium rubens Wisconsin 54-1255]
Length=332

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 117/235 (50%), Gaps = 32/235 (14%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T+K  WAVAEN+R+   F    + + ++G + N +V +   M+  N YF ++WR+   + 
Sbjct  118  TRKVFWAVAENFRYMKKFLFAAEQVQKLGKVQNFRVNVHSLMDKGNKYFHTAWRKTPEYQ  177

Query  617  GGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH  A LR+++G  E  S+ +  S + ++ LPP D + A+ + E+G +GV +
Sbjct  178  GGFLLDGGVHMTAALRLILGPAEHLSILSAQSQLQQSFLPPVDTVDAVAKTESGATGVIS  237

Query  443  MVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIKSFFYPFCGVQE  273
            +   S     ++      G  TL  +    +G KH         DG+         GV  
Sbjct  238  LSWGSPFNDQIFEFACEKGVVTLNFDDVTVNGEKHHVEF-----DGK---------GVVP  283

Query  272  ELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            E+  F + I           G+P  R S  E   D+ +LE ML SG+++G  VQ+
Sbjct  284  EVAEFANSI---------VSGKPDSRQSPEEALADLEILEQMLRSGEKDGEKVQL  329



>gb|KIM99483.1| hypothetical protein OIDMADRAFT_89802, partial [Oidiodendron 
maius Zn]
Length=339

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 102/222 (46%), Gaps = 16/222 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            I+++AE +RF   F   +K + E   IGD+  + + +  +      Y+ + WRR   + G
Sbjct  129  IFSIAEQFRFMTEFELGRKWVVEEKAIGDITQLHLKLWRNQPPGGKYYETPWRRVPGYQG  188

Query  614  GFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            GF+LD GVH+ A +R + G EV         V   LPP D I+A   L  G +G  +M  
Sbjct  189  GFLLDGGVHHAAMVRYVSGQEVVETHGYARQVAAHLPPLDTINAGILLSGGGTGTISMSF  248

Query  434  SSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            +S      + ++G  G+  +     DG +G+ + L    G+ +       GVQ E+  FL
Sbjct  249  ASTKRATEFTIIGTQGSFFL----TDGPNGFILKLSQLSGETREETIKSNGVQLEIDAFL  304

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
              +          K + R    E   D+A++E++   G + G
Sbjct  305  EAVKTG-------KAQSRSGPEEAMNDLAIIESLCSGGGKVG  339



>ref|XP_007674297.1| hypothetical protein BAUCODRAFT_22896 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98052.1| hypothetical protein BAUCODRAFT_22896 [Baudoinia compniacensis 
UAMH 10762]
Length=353

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 111/226 (49%), Gaps = 21/226 (9%)
 Frame = -1

Query  770  VAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFILDM  597
            VAE +R+  +F    +     G ++  +V +  S+     Y  + WR+   + GGF+LD 
Sbjct  141  VAEQWRYYNSFLFGAEKARSFGKVIGCRVKVSASIQPGMKYLETEWRKKPEYQGGFLLDG  200

Query  596  GVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRS  423
            GVH++AG+R+L+G E  V   S  T+ +   L P D + A+F+L NG +G F+    +  
Sbjct  201  GVHFMAGMRLLLGEEAKVVKASGFTTQLQPYLLPIDTVDAVFKLANGSTGNFSASFGTTF  260

Query  422  PKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP--FCGVQEELKTFLSD  249
                W V   NG++ V         G  V++   DG  +    P    GV++E+  F   
Sbjct  261  KGGEWSVACENGSVTVS--------GQKVTINPKDGDEEVVEKPDEQGGVKQEV--FAWA  310

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
             SL +      K EPR    +   D+ VLEAML SG++ G  +++K
Sbjct  311  ESLVS-----GKQEPRQLPEQALADLEVLEAMLTSGEKGGQPIELK  351



>gb|KFH44383.1| hypothetical protein ACRE_048520 [Acremonium chrysogenum ATCC 
11550]
Length=348

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/226 (28%), Positives = 103/226 (46%), Gaps = 21/226 (9%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K   A+AEN+RF P+F    +  A +G + +  V     M   N YF++ WR    + GG
Sbjct  130  KATLAIAENHRFFPSFVYAAEQAASLGKLQHFSVKCFSLMAQDNKYFNTPWRTKPQYQGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVT---SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            F+LD GVH+ A  R+ +  +     +V A T      LPP D +SA+ +  +G +G +  
Sbjct  190  FLLDGGVHHAAATRLFLHGDANGAHTVQAFTQQAQAHLPPIDTVSAIIKTRSGATGTYQH  249

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK-SFFYPFCGVQEELK  264
               S      W +    G++ V        +G +V++    G+     F    GV+EE+ 
Sbjct  250  SAGSNVRAFEWDLGYEKGSVNV--------NGETVTVTPAGGEKTVKHFERTSGVEEEVA  301

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
             +   ++       + K  PR S  E   D+  LE M +SG  +G+
Sbjct  302  AWAQSLA-------DGKPNPRQSPEEALADLEFLEKMFKSGDEKGS  340



>ref|XP_001275918.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
clavatus NRRL 1]
 gb|EAW14492.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
clavatus NRRL 1]
Length=341

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T+K +WAVAEN+R+   F    + + ++G + N +V     +   + Y+ ++WR+   + 
Sbjct  125  TRKTLWAVAENFRYMTKFIRAAEEVQKLGRVKNFRVHCHYLVEKDSKYYKTAWRQTPEYQ  184

Query  617  GGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGFILD GVH +AGLR+++G +  +T++SA +    + LPP D + A+ + ++G +GV 
Sbjct  185  GGFILDGGVHMIAGLRLILGAQDPITTLSAQSCLQQQYLPPLDTVDAVLKTKSGATGVL  243



>dbj|GAA91490.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
kawachii IFO 4308]
Length=344

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 113/229 (49%), Gaps = 31/229 (14%)
 Frame = -1

Query  794  MTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NF  621
            +  KP+W VAEN+RF   FT   + + ++G +   +V +   +   + Y  + WRR   +
Sbjct  131  LETKPLWGVAENWRFLAKFTRVAEEVRKLGSVKAFRVGVRTLIGEGSKYHQTEWRRKPTY  190

Query  620  FGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
             GGF+LD GVH +AGLR+++G E  + +VSAM     + L P D + A+ + ++G +GV 
Sbjct  191  KGGFVLDGGVHAIAGLRLILGKEDAMAAVSAMMGLQREHLAPVDTLDAVVKTKSGANGVV  250

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGVQE  273
            ++   +   + V+      G ++++R         +V++  G+    SF  P+   GV  
Sbjct  251  SLSYGAAVNETVFEFSCERGVVKLDRD--------TVTVSGGE----SFEVPYEGRGVNY  298

Query  272  ELKTFLSDISLANTKGGECKG--EPRLSFVEGTRDIAVLEAML--ESGK  138
            E+  F   I          KG  E RL   E   D+ V+E M   E GK
Sbjct  299  EVAAFGESI---------LKGQLEERLRPEEALADLEVMEGMFVSEGGK  338



>gb|EHK50187.1| hypothetical protein TRIATDRAFT_233440, partial [Trichoderma 
atroviride IMI 206040]
Length=343

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 103/220 (47%), Gaps = 16/220 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            I+++AE +RF   F   +K I E   IG++    + +  +      ++ + WR+   + G
Sbjct  131  IFSIAEQFRFMHEFELGRKWIVEEKAIGEITQAHLRVWRNQPPVGKWYETPWRKVPEYQG  190

Query  614  GFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            GF+LD GVH  A LR + G EV         V   LPP D ++A   L  G +G  +M  
Sbjct  191  GFLLDGGVHQTALLRFITGQEVVETQGFARQVVPHLPPLDTLNAGILLSGGGTGTISMSF  250

Query  434  SSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            +S        ++G  G+ ++     DG  G+ ++L +  G+ +S      GV+ E+K FL
Sbjct  251  ASLRSAGELTLIGTKGSFQI----VDGPSGFVLTLDLVSGESRSETVNSKGVELEIKAFL  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
              I +        K E R    E   D+A +E+M + G +
Sbjct  307  EAIKIG-------KAEKRSGPEEALNDLASIESMCQGGGK  339



>emb|CCA69637.1| hypothetical protein PIIN_03576 [Piriformospora indica DSM 11827]
Length=367

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 114/230 (50%), Gaps = 25/230 (11%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDM--MNVQVIIEGsmnssnpyfssSWRR--NFF  618
            IW VAEN+  EP      K IA+  IG +   N+QV+   ++ + + ++++ WR    + 
Sbjct  136  IWRVAENFEAEPGLRAAGKAIADQKIGKVCFWNMQVL--NNVETDSMWYNTPWRTVPEYQ  193

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGF+LD GVH  A LR ++  + T ++   S   + L P D I A+ + E+G  G+F + 
Sbjct  194  GGFLLDGGVHSAAALRTVLPSKFTELAGFASLNREHLAPHDTIHAIIRSEDGSHGIFELS  253

Query  437  --VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM-------GDGQIKSFFYPFC  285
              + S      +RVVG +GTL++ R ++          ++         GQ +      C
Sbjct  254  FGLPSSPGHDSFRVVGTDGTLDINRYHEKDPETQKDQAFIKVTIKNAKTGQKEEIVERSC  313

Query  284  GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
            GV+ EL+ F + ++  +   G  +G          +D++V++A L+S  R
Sbjct  314  GVERELENFAAHLNGHDDGLGTPQG--------ALQDVSVIQAALDSHGR  355



>ref|XP_007839104.1| hypothetical protein PFICI_12332 [Pestalotiopsis fici W106-1]
 gb|ETS75388.1| hypothetical protein PFICI_12332 [Pestalotiopsis fici W106-1]
Length=346

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 114/231 (49%), Gaps = 20/231 (9%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            +  + VAE +R+  ++      IA++G ++  Q+ +  ++N    Y  + WR+   F GG
Sbjct  125  QATFGVAEQFRYLNSYLHGASEIAKLGRVLGCQLRLHFTVNLGTKYIETPWRKTPEFSGG  184

Query  611  FILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            F+LD GVH +A LR+++   G +V  VSA T+ + + LPP D + A   L++G +G  +M
Sbjct  185  FLLDGGVHQIAALRLMLKGGGVKVQKVSAFTTQLREWLPPVDTVDATLLLDSGATGFLSM  244

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGVQEEL  267
               S        V    GT+ V+R      +G       G+ +  +   P    GV  E+
Sbjct  245  SFGSSFDDAEIAVACERGTVSVDR------NGNVTVRAAGEKEAATVHKPNEEGGVATEV  298

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
              +   I     K G+   E   S  E   D+ +LEA+L+SG++ GA VQ+
Sbjct  299  WAWARSI-----KNGKPDAEQ--SPEEALADLEMLEALLKSGEQGGAPVQL  342



>gb|KIL95797.1| glucose-fructose oxidoreductase [Fusarium avenaceum]
Length=345

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 116/229 (51%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+RF+P+F        ++G + +    +   M++ + ++S++WR    F GG
Sbjct  130  KATFSIAENFRFKPSFEYAASEANKLGKLQHFGARVFFYMSADSQWYSTAWRAKPEFQGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      VSA T+ V   L P D ++A+ +L++G SG +     
Sbjct  190  FLLDGGVHFTAATRQLLTEPAADVSAFTAQVQAHLAPIDTVNAVIRLKSGVSGTYQQSCG  249

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            ++     ++     G++EV+ G+K      +V+ + G+  +K F     GV EE+  +  
Sbjct  250  AKMSTSTFQFGYEKGSIEVD-GDK-----VTVTPWEGEKSVKEFERT-SGVTEEVAAWAK  302

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
              +L + K  E K  P     E   D+  LE M ESG   G   + KK+
Sbjct  303  --ALVDGKPNE-KQSPE----EALADLEFLELMFESGANGG---EAKKY  341



>ref|XP_009153161.1| glucose-fructose oxidoreductase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY52700.1| glucose-fructose oxidoreductase [Exophiala dermatitidis NIH/UT8656]
Length=341

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 112/234 (48%), Gaps = 31/234 (13%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRRN-  624
            +K  W+VAEN+R+  +F    + +   G  +     +Q ++EG            WR+  
Sbjct  127  RKVTWSVAENFRYLNSFLHAAEAVKTKGRQLTFRCRMQTLVEGGKYFETS-----WRKTP  181

Query  623  -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  453
               GGF+LD GVH+ AGLR+++G +  + +VSA ++ + + LPP D + A  + +NG  G
Sbjct  182  THQGGFLLDGGVHFTAGLRLMLGKDNPLATVSAFSAQLQEHLPPVDTVEATGRTKNGAVG  241

Query  452  VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  273
              ++   + +    W V   NG + + R          V++   DG+ +       GV  
Sbjct  242  TISISFGTTAKGSEWTVGCENGAVSISRDQ--------VTV---DGKTERIEDEKSGVPP  290

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            E++ +   ++   T         + S  E   D+ ++EAML SG++ G  ++++
Sbjct  291  EVRNWGKALAAGTTN-------EQQSPEEALADLELIEAMLRSGEQGGVPIKLE  337



>ref|XP_001397204.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
niger CBS 513.88]
 emb|CAK42628.1| unnamed protein product [Aspergillus niger]
Length=342

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 113/230 (49%), Gaps = 31/230 (13%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--N  624
            ++  KP+W VAEN+RF   F+   + + ++G +   +V +   +   + Y  + WRR   
Sbjct  128  SLATKPLWGVAENWRFLAKFSRVAEEVRKLGAVKAFRVSVRTLIGEGSKYHQTEWRRKPT  187

Query  623  FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  450
            + GGF+LD G+H +AGLR+++G E  + +VSAM     + L P D + A+ + + G +GV
Sbjct  188  YKGGFVLDGGIHAIAGLRLILGKEDAMAAVSAMMGLQREHLAPVDTVDAVVKTKTGANGV  247

Query  449  FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGVQ  276
             ++   +   + V+      G ++++R         +V++  G+    SF  P+   GV 
Sbjct  248  VSLSYGAAVNETVFEFSCERGVVKLDRD--------TVTVSGGE----SFEVPYEGRGVN  295

Query  275  EELKTFLSDISLANTKGGECKG--EPRLSFVEGTRDIAVLEAML--ESGK  138
             E+  F   I          KG  E RL   E   D+ V+E M   E GK
Sbjct  296  YEVAAFGESI---------LKGQLEERLRPEEAMADLEVMEGMFVSEGGK  336



>ref|XP_001593666.1| hypothetical protein SS1G_05094 [Sclerotinia sclerotiorum 1980]
 gb|EDO02617.1| hypothetical protein SS1G_05094 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=345

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 113/220 (51%), Gaps = 14/220 (6%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            W+VAEN+RF  +F   +K I ++G ++  ++   G++   + Y+ + WR+  ++ GGF+L
Sbjct  127  WSVAENFRFLDSFIHARKEIEKLGRVLGFRMQSFGNVKQGSKYYETEWRKKPDYQGGFLL  186

Query  602  DMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A  R+L+G     TSV A ++ + + LPP D I++++   +G SG F++   +
Sbjct  187  DGGVHFTAAGRLLLGGAARPTSVVAFSTLLREHLPPVDTINSVWLTNSGVSGTFSVSFGT  246

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  + V   +G++ V R     + G        + +   F     GV++E+  +   
Sbjct  247  TLSGPEYTVACEDGSVTVIRSKVIVRKGEENEKNFTEVE---FTEEGSGVKQEVAAWAQS  303

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
            I        + K + R S  E   D+ +LE +L SG+ +G
Sbjct  304  IV-------DKKPDTRQSPEEALADLEILEKLLRSGEEQG  336



>gb|EHK17838.1| hypothetical protein TRIVIDRAFT_136949, partial [Trichoderma 
virens Gv29-8]
Length=331

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 102/214 (48%), Gaps = 16/214 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  615
            I+ +AE +RF   F   +K I E   +GD+    + I  +   +  ++ + WR+   + G
Sbjct  129  IFNIAEQFRFMHEFELGRKWIVEEKAVGDITQAHLRIWRNQPPNGKWYETPWRKVPEYQG  188

Query  614  GFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVV  435
            GF+LD GVH  A LR + G EV   +     V   LPP D ++A   L  G +G  +M  
Sbjct  189  GFLLDGGVHQTAMLRYISGQEVVETAGFARQVAPHLPPLDTLNAGILLSGGGTGTISMSF  248

Query  434  SSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFL  255
            +S        ++G  G+  +     DG  G+ +SL +  G+ +S      GV+ E++ FL
Sbjct  249  ASTRRASELTIIGSKGSFFL----TDGPDGFLLSLDLATGERRSETIRSKGVELEIQAFL  304

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  153
              + +  +   E K  P     E   D+A++E+M
Sbjct  305  EAVKMGKS---EKKAGPE----EALNDLAIIESM  331



>gb|EMT70613.1| hypothetical protein FOC4_g10009079 [Fusarium oxysporum f. sp. 
cubense race 4]
 gb|EMT70614.1| hypothetical protein FOC4_g10009080 [Fusarium oxysporum f. sp. 
cubense race 4]
Length=322

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 115/229 (50%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  107  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  166

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  167  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  226

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  227  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  279

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  280  ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  318



>gb|ENH74564.1| hypothetical protein FOC1_g10009984 [Fusarium oxysporum f. sp. 
cubense race 1]
Length=322

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 115/229 (50%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  107  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  166

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  167  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  226

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  227  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  279

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  280  ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  318



>gb|KFY35329.1| hypothetical protein V494_06008 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=350

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 93/180 (52%), Gaps = 7/180 (4%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF  AF    + I ++G ++  +V +   + +   YF + WR+  +  GG
Sbjct  128  KATWGVAENFRFLEAFQYASREIEKLGGVLGFRVKVFQHVKAGTKYFETDWRKTPSHQGG  187

Query  611  FILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            FILD GVH+ AG R+L+G +   TS++A T+ +   LPP D +++++Q   G SG   + 
Sbjct  188  FILDGGVHFTAGTRLLLGPQNRPTSLAAYTALLQPHLPPIDTVNSIWQTAKGISGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
              +      + V   NG++ V R   D  H  +     G+   K F     GV+ E+K +
Sbjct  248  FGTSLSGDDYTVACYNGSVTVSR---DTVHVRTGEEKDGNVSTKVFVGGGSGVKAEVKAW  304



>gb|EER41723.1| NAD-binding Rossmann fold oxidoreductase [Histoplasma capsulatum 
H143]
Length=352

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 109/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            + ++AE +R+E A     ++IA  +IG++ +V   +  +M   N +  ++WR    + GG
Sbjct  136  VLSIAEQFRYETALIRAGELIAGGKIGELHHVHGRVATTMAPDNKFCKTAWRATPGYQGG  195

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+   ++ T+     L P D ++A  +   G  G F+M  +
Sbjct  196  FVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVDTVNAALKFSGGAQGTFSMSFA  255

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-IKSFFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+R      H  +V +   D + I    +   G+  E+  F+
Sbjct  256  AATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDLKPISEEAFKADGMMNEISAFV  311

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              ++    + G+  G PR    E   D+AV+E++   G
Sbjct  312  QAVA---ARKGDKAGSPR----EALADVAVIESICSGG  342



>gb|KFY14890.1| hypothetical protein V492_02347 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=350

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 93/180 (52%), Gaps = 7/180 (4%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  W VAEN+RF  A+    + I ++G ++  +V +   + +   YF + WR+  +  GG
Sbjct  128  KATWGVAENFRFLEAYQYASREIEKLGGVLGFRVKVFQHVKAGTKYFETEWRKTPSHQGG  187

Query  611  FILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            FILD GVH+ AG R+L+G +   TS+SA T+ +   LPP D +++++Q   G SG   + 
Sbjct  188  FILDGGVHFTAGTRLLLGPQNRPTSLSAYTALLQPHLPPIDTVNSIWQTAKGISGTVQIS  247

Query  437  VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  258
              +      + +   NG++ V R   D  H  +     G+   K F     GV+ E+K +
Sbjct  248  FGTSLSGDEYTIACYNGSVTVSR---DTVHVRTGEEKDGNVSTKVFVGGGSGVKAEVKAW  304



>gb|EXK91996.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. raphani 
54005]
Length=345

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 115/229 (50%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  130  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  190  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  249

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  250  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  302

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  303  ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>gb|EWZ38499.1| glucose-fructose oxidoreductase [Fusarium oxysporum Fo47]
 gb|EWZ83059.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA46087.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK40591.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXL79085.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL99025.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM22188.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=345

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 115/229 (50%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  130  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  190  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  249

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  250  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  302

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  303  ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>gb|EWY91836.1| glucose-fructose oxidoreductase [Fusarium oxysporum FOSC 3-a]
Length=345

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 115/229 (50%), Gaps = 19/229 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  130  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  190  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  249

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  250  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  302

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
             ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  303  ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>gb|KIN06467.1| hypothetical protein OIDMADRAFT_155638 [Oidiodendron maius Zn]
Length=345

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 115/224 (51%), Gaps = 22/224 (10%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFIL  603
            W VAEN+RF  +F   ++ + ++G ++  +    G++  S+ Y++++WR   ++ GGF L
Sbjct  127  WGVAENFRFLDSFLYARQEVEKLGRILGFRTKQFGNIKVSDKYYNTAWRTKPDYQGGFTL  186

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+VAG R+L+G E   T+VSA T+ + + LPP D I+A++  ++G SG ++    +
Sbjct  187  DGGVHFVAGTRLLLGEEAKPTAVSAFTTLLQEHLPPVDTINAIWSTKSGISGTYSNSFGT  246

Query  428  RSPKIVWRVVGLNGTLEVERGNK----DGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
                  + +    GT+ +  G+K    +G+        +G    K F     GV++E+  
Sbjct  247  TFSGSEYTIACEKGTVTI-VGSKVIITEGEQK------LGKSSEKEFPDEGNGVRQEVGA  299

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
            +   +        +    PR S      D+ +LE ML SG   G
Sbjct  300  WAQALI-------DGVPNPRQSPEHALADLEILEKMLISGAEHG  336



>ref|XP_001822449.2| hypothetical protein AOR_1_404134 [Aspergillus oryzae RIB40]
Length=489

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 106/219 (48%), Gaps = 32/219 (15%)
 Frame = -1

Query  794  MTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--F  621
            ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR   +
Sbjct  124  VSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKPEY  183

Query  620  FGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
             GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +GV 
Sbjct  184  QGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATGVL  243

Query  446  AMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSV----------------SLYMG  321
            ++   S     ++     +G  TL+ +R   +G+ GY V                S+  G
Sbjct  244  SVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDVPFEGRGVNKELVEFAESITTG  302

Query  320  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEP  204
            DG I +   P     EE    L+D+ L+     +C G P
Sbjct  303  DG-IATRLRP-----EEA---LADLELSEALAPDCTGRP  332



>gb|ESZ98482.1| hypothetical protein SBOR_1144 [Sclerotinia borealis F-4157]
Length=345

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 63/235 (27%), Positives = 118/235 (50%), Gaps = 15/235 (6%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--N  624
            N+  +  W+VAEN+RF  +F   +K + ++G ++  ++ +  ++   + YF + WR+  +
Sbjct  120  NVKGRATWSVAENFRFLDSFIHARKEVEKLGRVLGFRIKVFLNVKPGDKYFETEWRKKPS  179

Query  623  FFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  450
            + GGF+LD GVH+ A  R+++G     T+V A ++ + + LPP D I++++  ++G SG 
Sbjct  180  YQGGFLLDGGVHFTAAARLILGEATRPTTVVAFSTLLREHLPPVDTINSVWLTKSGISGT  239

Query  449  FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  270
            F+           + +   NG++ V R     + G       G+     F     GV++E
Sbjct  240  FSASFGITLSGPEYTIACENGSVTVIRSKVIVRKGEEKE---GNSTEVEFTEEGSGVKQE  296

Query  269  LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            +  +   I        + K + R S  E   D+ +LE +L SG+ EG   Q  +F
Sbjct  297  VAAWAQSIK-------DGKPDSRQSPEEALADLEILEKLLRSGE-EGGKSQSLQF  343



>ref|XP_007324396.1| hypothetical protein SERLADRAFT_364213 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN93362.1| hypothetical protein SERLA73DRAFT_97769 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO18743.1| hypothetical protein SERLADRAFT_364213 [Serpula lacrymans var. 
lacrymans S7.9]
Length=376

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 122/249 (49%), Gaps = 36/249 (14%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            +W +AEN+  EP +    ++I   +IG ++   V     M+  N ++ + WR   ++ GG
Sbjct  139  VWRIAENFESEPGYITAGQIIRDGKIGKVIFFHVRAVNYMDKGNRWYKTPWRTIPDYQGG  198

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH  A LR+++  ++T +S+  S   K LPP D I+A+ ++++G  G+F M  +
Sbjct  199  FLLDGGVHSTAALRVMLPGKMTHLSSFASLNKKYLPPHDTINAIVKVDDGSHGIFEMSFA  258

Query  431  ------SRSPKIVWRVVGLNGTLEVERGNKDGKHG------YSVSLYM--------GDGQ  312
                  S+  +I+  + G +G L VE+    G  G        ++L M        G  +
Sbjct  259  APATSLSQGNRII--ITGTDGWLSVEQAKVLGTQGGIEIPVLRINLRMVTKVNDKPGPER  316

Query  311  IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  132
             +    P  GV+ EL +F + ++     G    G P    V    D+A ++A L S   E
Sbjct  317  TEIIDEPVKGVEAELGSFFAAVAGTRDDG---LGSP----VGALEDVAFIQAALNS---E  366

Query  131  GALVQVKKF  105
            G LV+++  
Sbjct  367  GCLVELQNM  375



>gb|KGO75187.1| Oxidoreductase, N-terminal [Penicillium italicum]
Length=507

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 113/227 (50%), Gaps = 26/227 (11%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T K  WAVAEN+R+   F    + + ++G + N +V +   MN +N YF+++WR+   + 
Sbjct  125  TSKVFWAVAENFRYITKFIFAAEQVQKLGKVKNFRVNVHSLMNENNKYFNTAWRKTPEYQ  184

Query  617  GGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH  A LR+++G  E  S+ +  S + +  LPP D + A+ + E+G +GV +
Sbjct  185  GGFLLDGGVHMTAALRLILGPTERLSILSAQSQLQQPFLPPVDTVDAVAKTESGATGVIS  244

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            +   S     ++ V    G + ++  +              +G+     +   GV  E+ 
Sbjct  245  LSWGSSFKDQIFEVACEKGLVTLDSDD-----------VTVNGEKHHVEFDGRGVVPEVA  293

Query  263  TFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  129
             F + I           G+P  R S  E   D+ +LE ML SG+++G
Sbjct  294  EFANSI---------LSGKPAIRQSAEEALADLEILEQMLRSGEKDG  331



>gb|KGO40526.1| Oxidoreductase, N-terminal [Penicillium expansum]
 gb|KGO63123.1| Oxidoreductase, N-terminal [Penicillium expansum]
 gb|KGO66915.1| Oxidoreductase, N-terminal [Penicillium expansum]
Length=500

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 116/230 (50%), Gaps = 32/230 (14%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FF  618
            T K  WAVAEN+R+   +    + + ++G + N +V +   M+ +N YF ++WR+   + 
Sbjct  125  TTKVFWAVAENFRYITKYLFAAEQVQKLGKVQNFRVNVHSLMDENNKYFHTAWRKTPEYQ  184

Query  617  GGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLENGCSGVFA  444
            GGF+LD GVH  A LR+++G  E  S+ +  S + ++ LPP D + A+ + E+G +GV +
Sbjct  185  GGFLLDGGVHMTAALRLILGPTERLSILSAQSQLQQSFLPPVDTVDAVAKTESGATGVIS  244

Query  443  MVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIKSFFYPFCGVQE  273
            +   S     ++ V    G  TL ++    +G KH         DG+         GV  
Sbjct  245  LSWGSSFDDHIFEVACEKGVVTLNLDDVTVNGEKHHVEF-----DGR---------GVGP  290

Query  272  ELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  129
            E+  F + I           G+P  R S  E   D+ +LE ML SG+++G
Sbjct  291  EVAEFANSI---------VSGKPDIRQSAEEALADLEILEQMLRSGEKDG  331



>gb|EEQ92492.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ER-3]
Length=345

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 109/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++WR    + GG
Sbjct  131  VFSVAEQFRYDTGFLKASEVVASGTIGELHHVHARVATSMAPENKYFQTAWRAEPGYQGG  190

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G  G  ++  +
Sbjct  191  FVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKGAQGTLSISFA  250

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+    D     +V +  GD  + S   +P  G   E++ F+
Sbjct  251  AATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVVSEEVFPADGNVNEIRAFV  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              I+      G+  G PR    E   D+AV+E++   G
Sbjct  307  QAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>gb|KFY00135.1| hypothetical protein O988_03504 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=343

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 100/221 (45%), Gaps = 16/221 (7%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--N  624
            Q  I++VAE +RF   F   +K I +   IGD+  + + I  +      Y+ + WR+   
Sbjct  128  QGIIFSVAEQFRFMTEFELGRKWIVDERAIGDITQLHLKIWRNQAPGGKYYETQWRKVPG  187

Query  623  FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            + GGF+LD GVH  A +R + G EV         +   LPP D ++A   L  G +G  +
Sbjct  188  YQGGFLLDGGVHQTAMIRYISGQEVVETRGFARQLAAHLPPLDTVNAGILLSGGATGTIS  247

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  264
            M  +S        ++G  G+  +     DG  G+ + L    G ++       GV+ E+K
Sbjct  248  MSFASTKRATELTIIGSQGSFFL----TDGPDGFILKLSQLSGSVREETIKSKGVELEIK  303

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
             FL  + +        K + R    E   D+A++E++   G
Sbjct  304  AFLEAVRVG-------KAQTRSGPEEALNDLAIIESLCSGG  337



>gb|EQL35203.1| hypothetical protein BDFG_03181 [Blastomyces dermatitidis ATCC 
26199]
Length=345

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 109/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++WR    + GG
Sbjct  131  VFSVAEQFRYDTGFLKASEVVASGTIGELRHVHARVATSMAPENKYFQTAWRAEPGYQGG  190

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G  G  ++  +
Sbjct  191  FVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKGAQGTLSISFA  250

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+    D     +V +  GD  + S   +P  G   E++ F+
Sbjct  251  AATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVVSEEVFPADGNVNEIRAFV  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              I+      G+  G PR    E   D+AV+E++   G
Sbjct  307  QAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>ref|XP_002626131.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76920.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
Length=345

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 109/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++WR    + GG
Sbjct  131  VFSVAEQFRYDTGFLKASEVVASGTIGELRHVHARVATSMAPENKYFQTAWRAEPGYQGG  190

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G  G  ++  +
Sbjct  191  FVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKGAQGTLSISFA  250

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+    D     +V +  GD  + S   +P  G   E++ F+
Sbjct  251  AATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVLSEEVFPADGNVNEIRAFV  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              I+      G+  G PR    E   D+AV+E++   G
Sbjct  307  QAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>ref|XP_006455042.1| hypothetical protein AGABI2DRAFT_194743 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV43777.1| hypothetical protein AGABI2DRAFT_194743 [Agaricus bisporus var. 
bisporus H97]
Length=376

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 110/240 (46%), Gaps = 24/240 (10%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            IW VAEN+  EP +      I   +IG + + +      +++   ++ + WR   ++ GG
Sbjct  139  IWRVAENFEAEPGYQAAAAAIRAGKIGQVHSFKAEKIDYIDTETKWYKTPWRTIPDYQGG  198

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV----FA  444
            F+LD GVH +A LR+++   +T VS   S     L P D I A+ Q   G SGV    FA
Sbjct  199  FLLDGGVHTIAALRVMLPHPLTHVSGFASLNKAYLAPHDTIHAIVQAGPGVSGVADLIFA  258

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM------GDGQ----IKSFFY  294
                SR     + ++G NG L V   +K G  G  + + +       DG      +    
Sbjct  259  SPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIHSIVRSKDGTEVEEEEIIDE  318

Query  293  PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            P  GVQ EL +F + IS      G+  G+P    +    D+A ++A L SG     L Q+
Sbjct  319  PGIGVQAELASFFAAIS--GKDDGKGLGDP----LAALGDVAFIQAALNSGGNLVDLTQL  372



>gb|EEH05857.1| NAD-binding Rossmann fold oxidoreductase [Histoplasma capsulatum 
G186AR]
Length=352

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/218 (27%), Positives = 108/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            + ++AE +R+E A     ++IA  +IG++ +V   +  +M   N +  ++WR    + GG
Sbjct  136  VLSIAEQFRYETALIRAGELIAGGKIGELHHVHGRVATTMAPDNKFCKTAWRATPGYQGG  195

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+   ++ T+     L P D ++A  +   G  G F+M  +
Sbjct  196  FVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVDTVNAALKFSGGAQGTFSMSFA  255

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-IKSFFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+R      H  +V +   D + I    +   G+  E+  F+
Sbjct  256  AATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDLKPISEEAFKADGMMNEISAFV  311

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              ++    + G+    PR    E   D+AV+E++   G
Sbjct  312  QAVA---ARKGDKAASPR----EALADVAVIESICSGG  342



>emb|CCX08562.1| Similar to Putative uracil phosphoribosyltransferase urg2; acc. 
no. Q9US43 [Pyronema omphalodes CBS 100304]
Length=603

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 74/118 (63%), Gaps = 3/118 (3%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmns-snpyfssSWRR--NF  621
            +++ IW VAENYR++  +   ++ +  +G ++   V +E  +    N Y  ++WR+    
Sbjct  128  SERGIWGVAENYRYQKWWETAREEVKGLGKVLGFSVRMETLVEQGVNKYLETTWRKEPTH  187

Query  620  FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
             GGF+LD GVH+ AGLR+++G E+ +VSA+T+   + LPP D ++A+ + E+G  G F
Sbjct  188  QGGFLLDGGVHFTAGLRLMLGEEIKTVSALTALTREYLPPVDTVNAVLKTESGVVGTF  245



>gb|EGE83963.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ATCC 18188]
Length=345

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 109/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWR--RNFFGG  612
            +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++WR    + GG
Sbjct  131  VFSVAEQFRYDTGFLKASEVVASGTIGELHHVHARVATSMAPENKYFQTAWRVEPGYQGG  190

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G  G  ++  +
Sbjct  191  FVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKGAQGTLSISFA  250

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+    D     +V +  GD  + S   +P  G   E++ F+
Sbjct  251  AATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVVSEEVFPADGNVNEIRAFV  306

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              I+      G+  G PR    E   D+AV+E++   G
Sbjct  307  QAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>gb|EXL57961.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=345

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 110/217 (51%), Gaps = 16/217 (7%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  130  KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  189

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  190  FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  249

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
            S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  250  SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  302

Query  251  DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
             ++       E K + R S  E   D+  LE M ESG
Sbjct  303  ALA-------EGKPDKRQSVEEALADLEFLELMFESG  332



>gb|ERS96910.1| hypothetical protein HMPREF1624_06237 [Sporothrix schenckii ATCC 
58251]
Length=351

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 116/246 (47%), Gaps = 44/246 (18%)
 Frame = -1

Query  782  PIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            P+WAVAEN+RF          + ++G ++    + +   +   + +F++ WR+   + GG
Sbjct  128  PLWAVAENFRFLEVIQYAAARVGQMGGEVTTFHMTMNTLIGDDDKFFNTEWRKVPGYQGG  187

Query  611  FILDMGVHYVAGLRMLVGC-----EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            F+LD GVH++AGLR L+G      ++  VSA T+ +   L P D + ++   + G  G F
Sbjct  188  FLLDGGVHFIAGLRHLLGATAAKHDIAKVSAFTTLLQPKLAPVDTVQSILATDKGAIGTF  247

Query  446  AM-------------VVSSRSPKIVWRVVGLNGTLEVERGN-KDGKHGYSVSLYMGDGQI  309
             +             VV+++    +      +  +E   GN K+ K  +S S        
Sbjct  248  CVSFGTEFKSAFEIEVVTTKGAVTLTPTAVTSTWVEAAGGNKKEDKKEFSFS--------  299

Query  308  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
                    GV+ E+  F + ++    KG     +PR S  E  +D+A+LEA+L S  + G
Sbjct  300  -------SGVKPEVVAFGASLA----KGAV---DPRQSAEEALKDLAILEALLTSADQGG  345

Query  128  ALVQVK  111
            A + V+
Sbjct  346  APLAVE  351



>ref|XP_001538347.1| predicted protein [Histoplasma capsulatum NAm1]
 gb|EDN10149.1| predicted protein [Histoplasma capsulatum NAm1]
Length=340

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 108/218 (50%), Gaps = 16/218 (7%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            + ++AE +R+E A     ++IA  +IG++ +V   +  +M   N +  ++WR    + GG
Sbjct  124  VLSIAEQFRYETALIRAGELIAGGKIGELHHVHGRVATTMAPDNKFCKTAWRATPGYQGG  183

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH+VA +RM+ G E+   ++ T+     L P D ++A  +   G  G F+M  +
Sbjct  184  FVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVDTVNAALKFSGGAQGTFSMSFA  243

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-IKSFFYPFCGVQEELKTFL  255
            + +    +  +G  G L V+R      H  +V +   D + +    +   G+  E+  F+
Sbjct  244  AATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDLKPVSEEVFKADGMMNEISAFV  299

Query  254  SDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
              ++    + G+    PR    E   D+AV+E++   G
Sbjct  300  QAVA---ARTGDKAASPR----EALADVAVIESICSGG  330



>gb|EGU88150.1| hypothetical protein FOXB_01288 [Fusarium oxysporum Fo5176]
Length=1063

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 117/238 (49%), Gaps = 19/238 (8%)
 Frame = -1

Query  785   KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
             K  +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++WR    F GG
Sbjct  812   KATFSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGG  871

Query  611   FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
             F+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G SG +     
Sbjct  872   FLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGVSGTYQQSCG  931

Query  431   SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLS  252
             S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV EE++ +  
Sbjct  932   SKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGVTEEVEAWAK  984

Query  251   DISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF*AFCTIGTT  78
              ++       E K + R S  E   D+  LE M ESG   G   Q KK+   C    T
Sbjct  985   ALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKYECRCPNNVT  1032



>gb|KEY68231.1| hypothetical protein S7711_04765 [Stachybotrys chartarum IBT 
7711]
Length=348

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 107/222 (48%), Gaps = 18/222 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            +++AEN+RF P+ T   +  A++G + +    I G M+  N Y+ ++WR    + GGF+L
Sbjct  135  FSIAENFRFIPSITYAAEQAAKLGKVEHFSARILGLMDKDNKYYKTAWRATPEYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A  R+ +  E    +VSA TS   + LPP D++  + + ++G  G +     S
Sbjct  195  DGGVHFAAATRLFLTSESKPATVSAFTSLAQEHLPPIDSVFGIVKTKSGGVGSYQQSAGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  W  +G  G      G+K      +V    G+  +K  F    GV EE+  +   
Sbjct  255  HLSAFEWD-IGSEGGRVFLSGSK-----VTVKPVGGEESVKE-FEKTSGVSEEVAAWAEA  307

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
            +     K G  K  P  S  E   D+  LE M  SG+++GAL
Sbjct  308  L-----KSG--KANPLQSPEEALADLEFLEKMFRSGEQDGAL  342



>gb|KFA50043.1| hypothetical protein S40293_06825 [Stachybotrys chartarum IBT 
40293]
Length=348

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 107/222 (48%), Gaps = 18/222 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            +++AEN+RF P+ T   +  A++G + +    I G M+  N Y+ ++WR    + GGF+L
Sbjct  135  FSIAENFRFIPSITYAAEQAAKLGKVEHFSARILGLMDKDNKYYKTAWRATPEYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A  R+ +  E    +VSA TS   + LPP D++  + + ++G  G +     S
Sbjct  195  DGGVHFAAATRLFLTSESKPATVSAFTSLAQEHLPPIDSVFGIVKTKSGGVGSYQQSAGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  W  +G  G      G+K      +V    G+  +K  F    GV EE+  +   
Sbjct  255  HLSAFEWD-IGSEGGRVFLSGSK-----VTVKPVGGEESVKE-FEKTSGVSEEVAAWAEA  307

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
            +     K G  K  P  S  E   D+  LE M  SG+++GAL
Sbjct  308  L-----KSG--KANPLQSPEEALADLEFLEKMFRSGEQDGAL  342



>gb|KFA81971.1| hypothetical protein S40288_04398 [Stachybotrys chartarum IBT 
40288]
Length=348

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 107/222 (48%), Gaps = 18/222 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            +++AEN+RF P+ T   +  A++G + +    I G M+  N Y+ ++WR    + GGF+L
Sbjct  135  FSIAENFRFIPSITYAAEQAAKLGKVEHFSARILGLMDKDNKYYKTAWRATPEYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A  R+ +  E    +VSA TS   + LPP D++  + + ++G  G +     S
Sbjct  195  DGGVHFAAATRLFLTSESKPATVSAFTSLAQEHLPPIDSVFGIVKTKSGGVGSYQQSAGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  W  +G  G      G+K      +V    G+  IK  F    GV EE+  +   
Sbjct  255  HLSAFEWD-IGSEGGRVFLSGSK-----VTVKPVGGEELIKE-FEKTSGVSEEVAAWAEA  307

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
            +     K G  K  P  S  E   D+  LE M  SG+++GAL
Sbjct  308  L-----KSG--KANPLQSPEEALADLEFLEKMFRSGEQDGAL  342



>ref|XP_007330917.1| hypothetical protein AGABI1DRAFT_114560 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78203.1| hypothetical protein AGABI1DRAFT_114560 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=377

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/244 (30%), Positives = 113/244 (46%), Gaps = 28/244 (11%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            IW VAEN+  EP +      I   +IG + + +      +++   ++ + WR   ++ GG
Sbjct  139  IWRVAENFEAEPGYQAAAAAIRAGKIGQVHSFKAEKIDYIDTETKWYKTPWRTIPDYQGG  198

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV----FA  444
            F+LD GVH +A LR+++   +T VS   S     L P D I A+ Q   G SGV    FA
Sbjct  199  FLLDGGVHTIAALRVMLPHPLTHVSGFASLNKAYLAPHDIIHAIVQAGPGVSGVADLIFA  258

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHG-------YSVSLYMGDGQIKS----FF  297
                SR     + ++G NG L V   +K G  G       +S+     D +++       
Sbjct  259  SPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIHSIVKSKDDTEVEEKEEIID  318

Query  296  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  117
             P  GVQ EL +F + IS      G+  G+P    +    D+A ++A L SG   G LV 
Sbjct  319  EPGIGVQAELASFFAAIS--GKDDGKGLGDP----LAALGDVAFIQAALNSG---GNLVD  369

Query  116  VKKF  105
            + + 
Sbjct  370  LTQL  373



>ref|XP_001216107.1| predicted protein [Aspergillus terreus NIH2624]
 gb|EAU31748.1| predicted protein [Aspergillus terreus NIH2624]
Length=523

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 120/228 (53%), Gaps = 21/228 (9%)
 Frame = -1

Query  791  TQKPI---WAVAENYRFEPAFTECKKM-IAEIGDMMNVQVIIEGsmnssnpyfs---sSW  633
            T KP+   +A+AE +R + AFT  + +    IG +++V   +  +++ +        ++W
Sbjct  300  THKPLGTHFAIAEQFRTDRAFTRARALATTRIGKIVHVHARVWSNIDPAEQANKWLETAW  359

Query  632  RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  459
            R++  + GGF+LD GVH++A +R + G E+   +++T+ +   LPP D ++A  +  NG 
Sbjct  360  RKSPAYQGGFVLDGGVHFIALVRYVSGLEIVRTASLTAQMRAFLPPLDTVNAAVEFANGA  419

Query  458  SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG-DGQI-KSFFYPFC  285
            +G  ++  +SR     +  VG  G + V+     G+   SV +  G DG++         
Sbjct  420  AGSVSISFASRRAAFEFVFVGEEGAVVVKASKTAGE---SVVVLEGRDGEVLLEESIEGR  476

Query  284  GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
            GV EE++ FL  +    T   + + +PR ++     D+AV+E++ + G
Sbjct  477  GVSEEVRVFLEGV---ETGRMDERLDPRQAYA----DLAVIESVCQGG  517



>dbj|BAE63558.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=359

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 113/241 (47%), Gaps = 40/241 (17%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRR--NFFGGF  609
            +W V EN+RF     +  +++ E+G  ++   V      +S NP++ + WR+   F GG+
Sbjct  130  LWGVGENFRFWDPVQKAARILTEMGGSLVTFSVTAYSFTDSKNPFYHTDWRQKPTFQGGY  189

Query  608  ILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            +LD GVH+ A LR L+   G  V  VSA T+ + + LPP D + A+ +   G SG +   
Sbjct  190  LLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQEDLPPLDTVHAILRTNKGGSGTYTSS  249

Query  437  VSSRSPK------------IVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFY  294
            V  ++ +            + +R   +   ++ ++G              G+ + +S   
Sbjct  250  VGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG--------------GNWEERSEPA  295

Query  293  PFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  117
            P   GV+EE+  F + IS         + + RLS  E   D+ ++EAML SG  +   V 
Sbjct  296  PLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALEDLKIVEAMLRSGDAQALPVD  348

Query  116  V  114
            +
Sbjct  349  I  349



>gb|KIY03803.1| hypothetical protein Z520_00494 [Fonsecaea multimorphosa CBS 
102226]
Length=339

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 111/233 (48%), Gaps = 31/233 (13%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRR--  627
            +K  W VAEN R+  +F    +++   G  +     +Q ++EG            WR+  
Sbjct  125  KKVTWGVAENVRYTDSFIRAAEVVKTKGRQLTFRCRMQTLVEGGKYFETE-----WRKVP  179

Query  626  NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  453
               GGF+LD GVH+ AGLR+++G +  + S+SA ++ + + LPP D + A  + +NG  G
Sbjct  180  THQGGFLLDGGVHFTAGLRLMMGKDNPLVSLSAHSAQLQEHLPPVDTVEATAKSKNGNVG  239

Query  452  VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  273
              ++   +      W V    G++ +  GNK             DG+ +       GV  
Sbjct  240  TISISFGTTHKGSEWAVGCEKGSVSLS-GNK----------VTYDGKTEEVQDERTGVPG  288

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            E++ +    +LA  K  E +     S  EG  D+ ++EAML SG++ G  +++
Sbjct  289  EVRAWGE--ALAAGKVNESQ-----SPEEGLADLELIEAMLRSGEQGGVPIKL  334



>ref|XP_001906379.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP67045.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP28788.1| Putative Oxidoreductase [Podospora anserina S mat+]
Length=352

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 113/225 (50%), Gaps = 24/225 (11%)
 Frame = -1

Query  788  QKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            +KP+W VAEN+R+  +     + +  IG  +++ ++   G +   N YF++ WR+  ++ 
Sbjct  132  KKPLWGVAENFRYMKSLVFAGEEVKRIGGRVVSFKLEKFGWVAEDNKYFNTQWRKVPDYQ  191

Query  617  GGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD GVH+VA LR L+G    E++ V+A T+ +++ L P D I  +   + G +G  
Sbjct  192  GGFLLDGGVHFVAALRYLLGASGQELSKVAAYTALLEERLQPLDTIHGVASTKQGVNGSI  251

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS---VSLYMGDGQIKSFFYPFCGVQ  276
             +   +            NGT ++E    +G   +S   V     +G+ K  F    GV 
Sbjct  252  VLSFGTEFK---------NGT-DLEIITTNGTVSWSPTEVKTVTKEGESKKEFEYSSGVG  301

Query  275  EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  141
            EE+  F   I     K G  K +   +  E  RD+ VLE +LESG
Sbjct  302  EEVAVFARAI-----KAGTGKVDGLQTPEEAFRDLEVLEGLLESG  341



>ref|XP_007367395.1| oxidoreductase family protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF59932.1| oxidoreductase family protein [Dichomitus squalens LYAD-421 SS1]
Length=368

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 113/245 (46%), Gaps = 30/245 (12%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            +W VAEN+  EP F   +++I E  +G ++         ++ ++ ++++ WR   ++ GG
Sbjct  137  VWRVAENFEAEPGFQAARRVIREGKLGKIVYFNARSYNWIDETSKWYNTPWRTVPDYQGG  196

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH +A LR+++    T++SA  S   + LPP D I+A+    NG  G+  +   
Sbjct  197  FLLDGGVHTIAALRLILDSPFTTLSAHASLAKEILPPQDTINAIVSTANGAHGIVELSWG  256

Query  431  SRSPKIVW------RVVGLNGTLEVERGNKDGKHGYSVSLYMGD-------GQIKSFFYP  291
            S  P           V G +G LE+ R +  G    +V     D        Q       
Sbjct  257  SPVPSRAADAHNSISVTGKDGWLEITRAS--GIVRITVKTATRDEKGTVTGEQTAVIEEK  314

Query  290  FCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
              GVQ E+ +FL  +   N K     G PR + V    D+A +EA L S   +G  V V 
Sbjct  315  EAGVQLEIASFLEAL---NGKDDGLDG-PRGTLV----DVAFIEAALNS---DGVAVDVG  363

Query  110  KF*AF  96
            K  A 
Sbjct  364  KLAAL  368



>gb|KFA62356.1| hypothetical protein S40285_08590 [Stachybotrys chlorohalonata 
IBT 40285]
Length=348

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 107/222 (48%), Gaps = 18/222 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            ++VAEN+RF P+ T   +  A++G + +    + G M+  N Y+ ++WR    + GGF+L
Sbjct  135  FSVAENFRFIPSITYAAEQAAKLGKVEHFSARVLGLMDKDNKYYKTAWRATPEYQGGFLL  194

Query  602  DMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVH+ A  R+ +  E    +VSA TS   + LPP D++  + + ++G  G +     S
Sbjct  195  DGGVHFAAATRLFLTSESKPATVSAFTSLAQEHLPPIDSVFGIVKTKSGGVGSYQQSAGS  254

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
                  W  +G  G      G+K      +V    G+  +K  F    GV EE+  +   
Sbjct  255  HLSAFEWD-IGSEGGRVFLSGSK-----VTVKPVGGEESVKE-FEKTSGVSEEVAAWAEA  307

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  123
            +     K G  K  P  S  E   D+  LE M  SG+++GAL
Sbjct  308  L-----KSG--KPNPLQSPEEALADLEFLEKMFRSGEQDGAL  342



>gb|EIT72400.1| putative dehydrogenase [Aspergillus oryzae 3.042]
 gb|KDE75123.1| putative dehydrogenase [Aspergillus oryzae 100-8]
Length=412

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 113/241 (47%), Gaps = 40/241 (17%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRR--NFFGGF  609
            +W V EN+RF     +  +++ E+G  ++   V      +S NP++ + WR+   F GG+
Sbjct  183  LWGVGENFRFWDPVQKAARILTEMGGSLVTFSVTAYSFTDSKNPFYHTDWRQKPTFQGGY  242

Query  608  ILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            +LD GVH+ A LR L+   G  V  VSA T+ + + LPP D + A+ +   G SG +   
Sbjct  243  LLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQENLPPLDTVHAILRTNKGRSGTYTSS  302

Query  437  VSSRSPK------------IVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFY  294
            V  ++ +            + +R   +   ++ ++G              G+ + +S   
Sbjct  303  VGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG--------------GNWEERSEPA  348

Query  293  PFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  117
            P   GV+EE+  F + IS         + + RLS  E   D+ ++EAML SG  +   V 
Sbjct  349  PLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALEDLKIVEAMLRSGDAQALPVD  401

Query  116  V  114
            +
Sbjct  402  I  402



>gb|EPE09779.1| nad-binding rossmann fold oxidoreductase family protein [Ophiostoma 
piceae UAMH 11346]
Length=368

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 112/247 (45%), Gaps = 40/247 (16%)
 Frame = -1

Query  797  NMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf--ssSWRRN  624
            ++   P+W VAENYR++ +    ++ + +IG  + V  ++  +          +++WR+N
Sbjct  124  SLPSAPLWGVAENYRYQASLHLAEEEVKKIGGTL-VSFVLNSNKFVRPDGNYFNTAWRKN  182

Query  623  --FFGGFILDMGVHYVAGLRMLVGC---------EVTSVSAMTSHVDKTLPPPDNISALF  477
                GGF+LD G+HYVA LR L+           ++T ++     + + LPP D +  + 
Sbjct  183  PTHPGGFLLDGGIHYVASLRSLLAAAGAPPSKSNKITKLAGTMEQLLEILPPADTVRNIA  242

Query  476  QLENGCSGVFAMV------------VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVS  333
              E+G SGV  M             V++    + W         +V    ++    ++  
Sbjct  243  VTESGASGVVTMSFGTEFGCPLEISVTTTEGMVTWT------PKKVTVATRNEADLFNPH  296

Query  332  LYMGDGQIKSFFYPF---CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVL  162
            +   D   K+  +P     GV+ E + F ++I+      G+   E RLS  E   D+ +L
Sbjct  297  IVEHDCSPKNPAFPADEGTGVKAEFRAFAANIA-----AGKKAVETRLSPAEALADLELL  351

Query  161  EAMLESG  141
            EAM +SG
Sbjct  352  EAMFDSG  358



>ref|XP_007350429.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD41563.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
Length=379

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 113/240 (47%), Gaps = 39/240 (16%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMI--AEIG--DMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            IW VAENY  EPAF    K I   +IG   M N+  I   +++ ++ ++ + WR    + 
Sbjct  137  IWRVAENYELEPAFHAAAKAIRDGKIGKLSMFNLSAI--NALDETSKWYKTPWRTVPEYQ  194

Query  617  GGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  438
            GGF+LD GVH  A LR ++   + S+S   +   K L P D I+A+ +   G  G+F + 
Sbjct  195  GGFLLDGGVHSAAALRTVLPDALVSLSGHATLTKKYLAPQDTINAVVRTAGGAVGIFELS  254

Query  437  VSSRSP---KIVWRVVGLNGTLEVERGNK--DGKHGYSVSLYM-----------GDGQ--  312
             ++  P   K +    G NG +E+   N   +GK G SVS               DG   
Sbjct  255  FAAPFPTRAKGLTTYTGTNGWIEIATHNAVINGK-GQSVSRVTIHSVKEKGTTDKDGNKE  313

Query  311  ----IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  144
                ++    P CGV++E ++F+  +   N  G    G P    +   RD+A +EA L S
Sbjct  314  YEEVVEVVEEPLCGVRKEFESFVEHLK-GNDDG---YGTP----LGALRDVAFIEAALTS  365



>ref|XP_009550993.1| hypothetical protein HETIRDRAFT_441859 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW77494.1| hypothetical protein HETIRDRAFT_441859 [Heterobasidion irregulare 
TC 32-1]
Length=369

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 116/239 (49%), Gaps = 28/239 (12%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            +W VAENY  EP +    + I +  IG ++  +  +   M+  + ++ + WR   ++ GG
Sbjct  142  VWRVAENYETEPIYQRAAQAIRDGKIGKVLFFKARVTNYMDKDSKWYKTPWRTVPDYQGG  201

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQ-LENGCSGVFAMVV  435
            F+LD GVH+ A LR+++   +T +SA TS     L P D I A+ +   +G  G+F +  
Sbjct  202  FLLDGGVHFAAALRIMLPSPLTHLSAFTSLSKAHLAPKDTIHAIAKSAHDGAHGLFEVTF  261

Query  434  SSRS----PKIVWRVVGLNGTL-----EVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCG  282
            ++ S    P   + + G  G L      VE G    K    + L+   G+ +       G
Sbjct  262  AAPSNEYTPGNGYTITGSTGWLTVGAAAVEEGK---KQAMQLVLHNERGEGEVIVEESTG  318

Query  281  VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  105
            V +E+++F   + + N    + K  PR +     RD+A ++A L S   EG+LV ++  
Sbjct  319  VSDEVRSFFGAV-IGND---DEKQNPRSAL----RDLAFIQAALNS---EGSLVDLEAL  366



>ref|XP_680622.1| hypothetical protein AN7353.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61724.1| hypothetical protein AN7353.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF78561.1| TPA: oxidoreductase family, NAD-binding Rossmann fold protein 
(AFU_orthologue; AFUA_2G16380) [Aspergillus nidulans FGSC A4]
Length=344

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 106/230 (46%), Gaps = 33/230 (14%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnp--yfssSWRR--NFF  618
            K  W VAEN+RF   + +  + + ++G +   +V++   + +        + WR+   + 
Sbjct  129  KTFWGVAENFRFIRKWLKTAEEVQKLGGVKTFRVVVRNKVGTEGKYFSIDTPWRKIPEYQ  188

Query  617  GGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD G+H VAG+R+++G     + S++A TS + + LPP D + AL    +G +GVF
Sbjct  189  GGFLLDGGIHTVAGVRLILGRGKNSLKSLTAQTSQLQEHLPPIDTVDALLTTASGAAGVF  248

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGVQE  273
            ++   S     V       G + +   ++   +G +  +            PF   GV+E
Sbjct  249  SLSFGSEFKSFVLEFTCEKGVVSL-VDDQLTVNGVATEI------------PFEGVGVKE  295

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFV--EGTRDIAVLEAMLESGKREG  129
            E+K F   I           GE     V  E   D+ VLE M  SG+  G
Sbjct  296  EVKAFGESI---------VNGELNKKLVPDEALADLEVLEMMFRSGEDGG  336



>gb|KIW21209.1| hypothetical protein PV08_01789 [Exophiala spinifera]
Length=340

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/230 (27%), Positives = 111/230 (48%), Gaps = 31/230 (13%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRR--NFFG  615
            W VAEN R+  +F    + +   G  +     +Q +++G            WR+     G
Sbjct  130  WGVAENVRYTNSFLHAAEAVKPKGRQLTFRCRMQTMVQGGKYFETS-----WRKVPTHQG  184

Query  614  GFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            GF+LD GVH+ A LR+++G +  + S+SA ++ + + LPP D + A+ + + G  G  ++
Sbjct  185  GFLLDGGVHFTAALRLMLGKDNPLVSISAHSALLQEHLPPVDTVEAIAKSKKGAVGTISI  244

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
               + +    W V   NG + + R NK       V++   D ++        GV  E++ 
Sbjct  245  SFGTTAKGSEWTVAAENGFVSISR-NK-------VTI---DDKVDEIEDERTGVPPEVRA  293

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            +    +LA  K  E +     S  E   D+ ++EAML SG++ GA V+++
Sbjct  294  WGE--ALAAGKANEQQ-----SPEEALADLELVEAMLRSGEQGGAPVKLQ  336



>gb|KIW03136.1| hypothetical protein PV09_05778 [Verruconis gallopava]
Length=345

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 111/226 (49%), Gaps = 26/226 (12%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFIL  603
            W+VAEN+RF  +F    + I ++G ++  QV     ++    +F++ WR+     GGF+L
Sbjct  126  WSVAENWRFLRSFDRAAEEIKKLGKIIGFQVRHFTKVDKDWKFFNTDWRKTPTHQGGFLL  185

Query  602  DMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            D GVH +AGLR L+      +  VSA T+ +++ LPP D I+A+ + E+G SG   +   
Sbjct  186  DGGVHLIAGLRQLLEAGNERLKHVSAFTNSIEEYLPPVDTINAIVKTESGISGTLQISFG  245

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC----GVQEELK  264
            +      W V   NG + V           SV   M DG  K    P      GV  E++
Sbjct  246  TTLRGNEWTVACENGVVSVIDVLD------SVVTVMVDG--KKTILPLANEKTGVPPEVR  297

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTR-DIAVLEAMLESGKREG  129
             +    +LAN    + + EP     E  R D+ ++E +L SG++ G
Sbjct  298  VW--GKALANGTALKAQ-EP-----ESARADLEIIELILRSGEKGG  335



>gb|EJU01365.1| NADP-binding protein [Dacryopinax sp. DJM-731 SS1]
Length=363

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 103/226 (46%), Gaps = 25/226 (11%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            IW VAEN+  EP F   K  I+  +IG +    +     M  SN +  + WR    + GG
Sbjct  135  IWRVAENWEVEPTFRFIKSSISAGKIGAIQTFSLTSISYMPPSNKWLGTPWRAKPTYQGG  194

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            F+LD GVH  A LR ++     S+    +  ++ L P D I A  +  +G  G F++   
Sbjct  195  FLLDGGVHQAAFLRTVLPSPTVSLCGYATLQNEHLAPHDCIHAALKCADGAQGFFSLNAG  254

Query  431  SRSPKIVWR-------VVGLNGTLEVERGNKDGKHGYSVSLYM---GDGQIKSFFYPFCG  282
            +      W        ++G  G++EV+   K+GK      L     G+ + ++F  P CG
Sbjct  255  ASG----WEGRGGGTMILGKEGSVEVQFFEKEGKQWIRAVLRAGKKGEQKEETFESPSCG  310

Query  281  VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  144
            V EE K F      AN K     G PR +      D+A+++A L S
Sbjct  311  VAEEQKFFF---EAANGKKENDFGNPRGTL----EDVALIQAALTS  349



>ref|XP_008045096.1| oxidoreductase family protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW51984.1| oxidoreductase family protein [Trametes versicolor FP-101664 
SS1]
Length=368

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 111/241 (46%), Gaps = 27/241 (11%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            +W VAEN+  EP +   ++ I +  IG +      +   ++ ++ ++++ WR   ++ GG
Sbjct  137  VWRVAENFEAEPGYRAARRAIEDGKIGKVAFYNACVVNYIDENSKWYNTPWRTVPDYQGG  196

Query  611  FILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM---  441
            F+LD GVH +A LR+++   + +VSA  S     LPP D I+A+ +  +G  G+  +   
Sbjct  197  FLLDGGVHTIASLRVVLPSALQTVSAFASLAKDILPPQDTINAIVRNVDGSHGLVELTWG  256

Query  440  ---VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-------FFYP  291
               V  ++       V G  G LE+ R N  G    +V     D   KS           
Sbjct  257  APTVTRAKQAGNNITVTGTEGWLEITRAN--GVMRIAVHTITRDKDGKSTGETEEVIEEK  314

Query  290  FCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
              G+Q E+++FL     A     +   +PR + V    D+A +EA L S      LV + 
Sbjct  315  EVGIQREIESFLR----ATDGSDDGVDDPRSTLV----DVAFIEAALNSNGAPVDLVALA  366

Query  110  K  108
            K
Sbjct  367  K  367



>gb|KIY44168.1| NAD(P)-binding protein, partial [Fistulina hepatica ATCC 64428]
Length=357

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 116/245 (47%), Gaps = 27/245 (11%)
 Frame = -1

Query  797  NMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSW  633
            N T KP   IW VAEN+  EP++ E  + I +  IGD+   +      ++S N Y+ + W
Sbjct  123  NETYKPKGLIWRVAENFEAEPSYREAARAITDGKIGDVKLFKATKVTYVDSDNNYYQTPW  182

Query  632  RR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  459
            R   ++ GGF+LD GVH +A LR ++   + S+SA  S   + L P D I+A+ +     
Sbjct  183  RTIPDYQGGFLLDGGVHTIAALRTILPEPLDSLSAFASLNKEILAPHDTINAIVR-AGAA  241

Query  458  SGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP  291
             G+    FA  V ++ P  ++ + G  G + V + +++ +         G    +    P
Sbjct  242  HGIVELSFANPVRAQPPSTLFTITGTKGWITVSKNDRELRTVIRYHDAAGLEVEEDVDSP  301

Query  290  FCGVQEELKTFLSDISLANTKGGECK---GEPRLSFVEGTRDIAVLEAMLESGKREGALV  120
              GV  E+  F+  +     KG       G+P    +   RD+A +EA L S    GA +
Sbjct  302  LSGVAIEIVAFVEAV-----KGDSAALQIGDP----LGALRDVAFIEAALRSN---GAQI  349

Query  119  QVKKF  105
             +++ 
Sbjct  350  DLRQL  354



>gb|KIL66602.1| hypothetical protein M378DRAFT_74962 [Amanita muscaria Koide 
BX008]
Length=377

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 112/246 (46%), Gaps = 31/246 (13%)
 Frame = -1

Query  797  NMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssSW  633
            N   KP   IW VAEN+  EP + +  +++ E  IGD++  + +IE  +   + Y+ + W
Sbjct  137  NDKYKPRGLIWKVAENFEAEPGYRKAAELVREGRIGDLIQFKAVIEAHVTQESKYYKTPW  196

Query  632  RR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF----QL  471
            R   ++ GGF+LD GVH  A +R+++   +T +S+  S   + L P D+  A+     Q+
Sbjct  197  RTVPDYQGGFLLDGGVHAAAVIRIVLPSAITHISSFASLNKEYLAPHDSFHAIVKAGPQI  256

Query  470  ENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ------I  309
                S  FA    S +    +   G  G L + +G +  K G  + +     +       
Sbjct  257  HGTASFTFAWPTKSAASSEDFIFTGTKGWLSITKGTE--KRGVKLKIVTRKSENSDEETE  314

Query  308  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGT-RDIAVLEAMLESGKRE  132
            +     F GV  EL  FL        K  E K E  L    G  +D+A +EA L S    
Sbjct  315  EVIEEAFNGVTAELVNFL--------KAVEGKDELGLGDPAGALKDVAFIEAALNS---N  363

Query  131  GALVQV  114
            GA++ +
Sbjct  364  GAVINI  369



>gb|EHK44528.1| hypothetical protein TRIATDRAFT_300680 [Trichoderma atroviride 
IMI 206040]
Length=350

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 109/229 (48%), Gaps = 23/229 (10%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            T K  +A+AEN RF P+F       A+ G + N  V +   +   N +++++WR+  ++ 
Sbjct  131  TSKATFAIAENVRFYPSFFYAAGEAAKFGKVHNFSVRVLWRVEPDNKWYNTAWRKTPDYQ  190

Query  617  GGFILDMGVHYVAGLRMLVGCEVT---SVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD GVH+ A  R+L+  E     SV A T+ + + LPP D ++A+ + ++G SG F
Sbjct  191  GGFLLDAGVHWAAATRLLLAGEQNKPESVQAFTAQMCEHLPPIDTLNAIVKTQSGGSGSF  250

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPFCGVQE  273
                 S      W      G++++         G +V++   DG+  +K F     GV E
Sbjct  251  QHSAGSLLQAFEWSFSYEKGSVKIV--------GETVTVKPLDGEESVKEFSRT-NGVTE  301

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
            E+  +   I        + K  P  +  +   D+  +E M  SG   G+
Sbjct  302  EVAAWAQSII-------DGKVNPLQTPEQALADLEFMEKMFTSGDENGS  343



>gb|EHK24126.1| hypothetical protein TRIVIDRAFT_45259 [Trichoderma virens Gv29-8]
Length=350

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 106/227 (47%), Gaps = 19/227 (8%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFF  618
            + K   A+AEN RF P+F       A++G + N  V +   +   N +++++WR+  ++ 
Sbjct  131  STKATLAIAENIRFFPSFAYAASEAAKLGKVHNFSVRVLWRIEPDNKWYNTTWRQKPDYQ  190

Query  617  GGFILDMGVHYVAGLRMLVGCEVT---SVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  447
            GGF+LD GVH+ A  R+L+  +     +V A T+ + + LPP D ++A+ + ++G +GVF
Sbjct  191  GGFLLDAGVHWAAATRLLLTGDENKPETVQAFTAQMCEHLPPIDTVNAIIKTQSGATGVF  250

Query  446  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  267
                 S      W      GT+++           +V    G+  +K F     GV EE+
Sbjct  251  QNSAGSLLQAFEWSFSYEKGTIKI------AGETVTVQPAGGEEHVKEFTRT-NGVSEEV  303

Query  266  KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
              +   I        + K  P  +  +   D+  +E M  SG   G+
Sbjct  304  AAWAQSIV-------DGKVNPLQTPEQALADLEFVEKMFTSGDENGS  343



>ref|XP_007824029.2| oxidoreductase [Metarhizium robertsii ARSEF 23]
 gb|EXU97793.1| GFO/IDH/MOCA family protein [Metarhizium robertsii]
 gb|EFY96779.2| oxidoreductase [Metarhizium robertsii ARSEF 23]
Length=351

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 98/225 (44%), Gaps = 19/225 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  612
            +PI AVAEN RF P           +G + +  V + G     N Y+ +SWR      GG
Sbjct  130  RPILAVAENVRFAPRLLYAAGQAGALGRVTHFSVRVAGLTGPDNKYYGTSWRARPAHQGG  189

Query  611  FILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            F+LD GVH+ A  R+ +   G    +V A T      L P D ++AL + E+G  G +  
Sbjct  190  FLLDGGVHHAAATRLFLRGEGDAPAAVRAYTGLTRGHLAPMDTVTALVRTESGAVGTYCH  249

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG-QIKSFFYPFCGVQEELK  264
               + +    W V    G +  +        G  V++   DG ++++ F    GV+EE+ 
Sbjct  250  SAGTLASAFEWDVACERGAVRSD--------GDLVTVTGEDGTKVETRFERTSGVREEVD  301

Query  263  TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             +   I      GGE    P  S  E   D+  LEAM  SG   G
Sbjct  302  AWAGSIL---DGGGEAA--PMQSAREALADLEFLEAMFASGAEGG  341



>gb|KIW39301.1| hypothetical protein PV06_09085 [Exophiala oligosperma]
Length=340

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 111/230 (48%), Gaps = 31/230 (13%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRR--NFFG  615
            W VAEN R+  +F    + +   G  +     +Q +++G            WR+     G
Sbjct  130  WGVAENVRYTSSFVHAAEAVRPKGRQLTFRCRMQTMVQGGKYFETS-----WRKVPTHQG  184

Query  614  GFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            GF+LD GVH+ A LR+++G +  + S+SA ++ + + LPP D + A  + + G  G  ++
Sbjct  185  GFLLDGGVHFTAALRLMLGKDNPLVSISAHSALLQEHLPPVDTVEATAKSKKGAVGTISI  244

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
               + +    W V   NG + + + NK       V++   D ++        GV  E++ 
Sbjct  245  SFGTTAKGSEWTVATENGFVSISK-NK-------VTI---DDKVDEIEDERTGVPPEVRA  293

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            +    +LA  K  E +     S  E   D+ ++EAML SG+++GA ++++
Sbjct  294  WGE--ALAAGKVNELQ-----SPEEALADLELIEAMLRSGEQDGAPIKLQ  336



>gb|KIW42674.1| hypothetical protein PV06_06200 [Exophiala oligosperma]
Length=341

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/243 (28%), Positives = 116/243 (48%), Gaps = 39/243 (16%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDM-----MNVQVIIEGsmnssnpyfssSWRRN-  624
            K IWA+ EN+RF          + EIG       MN+  +++     ++ ++ + WR+  
Sbjct  119  KSIWAIGENFRFICPVVCGHSKLKEIGGQVTTFSMNLFALVD----ENDKFYQTEWRKTP  174

Query  623  -FFGGFILDMGVHYVAGLRML---VGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
             + GGF+LD GVH+VAG+R L   VG +++S++A T+ ++  L P D +  + +  +G S
Sbjct  175  EYQGGFLLDGGVHFVAGVRHLLSAVGEDISSLAAYTALLEPKLAPVDTVHGILRTTSGRS  234

Query  455  GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGK---HGYSVSLYMGDGQIKSF-----  300
            G F +   +             G  E+      G       SV +   D   K       
Sbjct  235  GSFNVSFGTE----------FKGGFEIFAATNKGSVTVTPVSVKVVRKDADGKKVEEEES  284

Query  299  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  120
            F    GV+ E++ F + I ++ T       +PR S  +   D+ VL+ +LESG+++GA+ 
Sbjct  285  FAFGAGVKSEVEAFAASI-VSGTP------DPRQSPQQALGDLIVLQGLLESGEQKGAVK  337

Query  119  QVK  111
             VK
Sbjct  338  AVK  340



>ref|XP_007733422.1| hypothetical protein A1O3_05105 [Capronia epimyces CBS 606.96]
 gb|EXJ84437.1| hypothetical protein A1O3_05105 [Capronia epimyces CBS 606.96]
Length=330

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 108/230 (47%), Gaps = 31/230 (13%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRRN--FFG  615
            WAVAEN+R+  +F      +   G  +     +Q ++EG            WR+     G
Sbjct  120  WAVAENFRYLNSFDYAAAAVKTKGRQLTFRCRMQTLVEGGKYFETS-----WRKTPTHQG  174

Query  614  GFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            GF+LD GVH VA LR+++G +  + ++SA ++ + + LPP D + A  + +NG  G  +M
Sbjct  175  GFLLDGGVHTVAALRLMLGKDNPLVTLSAHSAQLQEHLPPVDTVEATGKTKNGAVGTISM  234

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
               + +    W +    G++ + R          V++   DG+ +       GV  E++ 
Sbjct  235  SFGTTAKGSEWNIGSEKGSVSISRDQ--------VTV---DGKTEKVEDEGTGVAPEVRK  283

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  111
            +  +  +A T         R S  E   D+ ++E ML SG++ G  ++++
Sbjct  284  W-GEALVAGTSN------ERQSPEEALADLELIEVMLRSGEQGGVPIKLE  326



>gb|KIH93169.1| hypothetical protein SPBR_02922 [Sporothrix brasiliensis 5110]
Length=369

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 112/247 (45%), Gaps = 33/247 (13%)
 Frame = -1

Query  794  MTQKPIWAVAENYRFEPAFTECK-KMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--  624
            + +KPIWAVAENYR+  +    + K+ A  GD+++  ++    + +   YF+++WR+N  
Sbjct  125  LPRKPIWAVAENYRYMQSLQLAEAKLRALGGDLVSFSLVSNKFVRTDGNYFNTAWRKNPT  184

Query  623  FFGGFILDMGVHYVAGLRMLVGC----------EVTSVSAMTSHVDKTLPPPDNISALFQ  474
              GGF+LD GVHYVA LR L+            ++T V+   + + + LPP D + A+  
Sbjct  185  HPGGFLLDGGVHYVAALRSLLRAAPGGNTNNNNKITKVAGTMAQLLEILPPADTLRAIAF  244

Query  473  LENGCSGVFAM------------VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  330
             + G SGV  M             V++    + WR+  +  T    R   D    +   L
Sbjct  245  TQGGASGVVTMSFGTEFGPPLDIAVTTTEGMVTWRMKSVTVT---TRNAADPFKPHETVL  301

Query  329  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  150
               +           GV+ E          A+   G+   + R S VE   D+ +LEAM 
Sbjct  302  DCSETNPSFPADEATGVKAEFAA-----FAASIAAGQNTVDARQSPVEALEDLRLLEAMF  356

Query  149  ESGKREG  129
            E+G   G
Sbjct  357  ETGAAGG  363



>gb|KIX08304.1| hypothetical protein Z518_02960 [Rhinocladiella mackenziei CBS 
650.93]
Length=334

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 107/233 (46%), Gaps = 32/233 (14%)
 Frame = -1

Query  800  TNMTQKPI-WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssS  636
            T M  K + W VAEN R+  +F      +   G  +     +Q ++EG            
Sbjct  115  TEMVGKNVTWGVAENVRYTNSFDHAADAVQTKGRQLTFRCRMQTLVEGGKYFETS-----  169

Query  635  WRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLE  468
            WR+     GGF+LD GVH+VAGLR+++G    + S+SA ++ + + LPP D + A  + +
Sbjct  170  WRKVPTHQGGFLLDGGVHFVAGLRLMLGKHNPLVSLSAHSAQLQEHLPPVDTVEATAKSK  229

Query  467  NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  288
             G  G  ++   + +    W V    G + + R NK       V++   D + +      
Sbjct  230  KGTIGTISISFGTTAKGSEWTVGCDKGFVSLTR-NK-------VTI---DDKTEEIEDEK  278

Query  287  CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  129
             GV  E++ +   ++   T        PR S  E   D+ ++EAML SG++ G
Sbjct  279  TGVPPEIRKWGEALAAGTTN-------PRQSPEEALADLELIEAMLRSGEQGG  324



>ref|XP_008716792.1| hypothetical protein HMPREF1541_04224 [Cyphellophora europaea 
CBS 101466]
 gb|ETN42283.1| hypothetical protein HMPREF1541_04224 [Cyphellophora europaea 
CBS 101466]
Length=340

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 66/125 (53%), Gaps = 13/125 (10%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRRN  624
            T+K  W+V ENYR+  A+    + +  +G  +     +Q ++ G            WR+N
Sbjct  125  TKKVTWSVGENYRYLNAWNHAAEQVKAMGKQLTFRCRMQTLVSGGKYFETE-----WRKN  179

Query  623  --FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCS  456
                GGF+LD GVH  AGLR+L+G E  + ++SA T+ +   LPP D I A+ + +NG  
Sbjct  180  PTHQGGFLLDGGVHQTAGLRLLMGRENPLVTLSAHTAQLQPHLPPVDTIEAVAKAKNGAV  239

Query  455  GVFAM  441
            G   +
Sbjct  240  GTITI  244



>ref|XP_007911759.1| putative oxidoreductase nad-binding rossmann fold protein [Togninia 
minima UCRPA7]
 gb|EOO03539.1| putative oxidoreductase nad-binding rossmann fold protein [Togninia 
minima UCRPA7]
Length=358

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 105/221 (48%), Gaps = 19/221 (9%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFG--GFIL  603
            WA+AE  RF P F        ++G ++     +   +   N Y ++ WR++     GFIL
Sbjct  136  WAIAEQVRFVPKFAWAAAEARKLGKVIGFHFKVFFHIGLDNKYLATEWRKSPTHPYGFIL  195

Query  602  DMGVHYVAGLRMLVGCEV-TSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSR  426
            D GVH++A  R+L+G +   SV A +S     LPP D +S + + ++G  G F     + 
Sbjct  196  DGGVHWIASARLLLGDDTPQSVIAYSSLAQDYLPPVDTVSGVIKTKSGAIGTFNASCGTT  255

Query  425  SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC-GVQEELKTFLSD  249
                 + V   NG++ +E     G  G+   +   DG+ +     F  GV+EE+  +   
Sbjct  256  LSSNEYSVACENGSVTIE-----GDKGW---IRYKDGRKEERELEFVGGVKEEIAAWAE-  306

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
               A T G   K  P  +  E  +D+ +LEAML+SG   GA
Sbjct  307  ---ALTSG---KPNPLQTPEEALKDLELLEAMLKSGDANGA  341



>ref|XP_007794424.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
 gb|EMR66479.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
Length=350

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 112/228 (49%), Gaps = 27/228 (12%)
 Frame = -1

Query  779  IWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFI  606
            I A+AEN+RF   +    + I ++G +    V +   M  SN Y+ +SWR    + GGF+
Sbjct  133  ILAIAENFRFMDGWKHGAEEIKKLGRVTGFVVRMNSMMKESNKYYQTSWRMKPEYQGGFL  192

Query  605  LDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVS  432
            LD GVH+ A LR L+G E  V S+ A TS V   LPP D+I+A+ +L++G  G + + V 
Sbjct  193  LDGGVHFTAALRRLLGEENTVKSLIAQTSLVSSHLPPVDSINAVLKLKSGAVGSYIVSVG  252

Query  431  SRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS----FFYPFCGVQEELK  264
            +      + +    G ++ E  NK       V +  G G+  +     +    GV+ E++
Sbjct  253  TTMNAFEFHIACEQGVVKAET-NK-------VVVVKGIGEDATTEEKAWERNTGVKNEVQ  304

Query  263  TFLSDISLANTKGGECKGEPRL--SFVEGTRDIAVLEAMLESGKREGA  126
             +   I           G+P L  S  +   D+ +LE ML SG  +GA
Sbjct  305  AWAEGI---------ASGKPNLEQSPEQALADLELLEKMLTSGDNDGA  343



>ref|XP_003047008.1| hypothetical protein NECHADRAFT_95358 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU41295.1| hypothetical protein NECHADRAFT_95358 [Nectria haematococca mpVI 
77-13-4]
Length=342

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 101/221 (46%), Gaps = 18/221 (8%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR--RNFFGGFIL  603
            +++AENYRF P +        ++G + +  V     +   N ++S+ WR    + GG +L
Sbjct  129  FSLAENYRFIPKYIYAADQAKKLGKVDHFNVKFFCLLPPDNLWYSTPWRGQAQYQGGPLL  188

Query  602  DMGVHYVAGLRMLV--GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSS  429
            D GVHY A  R+ +       SVSA+TS   K LPP D ++AL + ++G SG       S
Sbjct  189  DGGVHYAAATRLFLQGDSSAASVSALTSLTQKHLPPADTVNALVKTKSGTSGTVQFSFGS  248

Query  428  RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSD  249
            +     W      GT++V  GN        V    G+  +K  F    GV EE+  +   
Sbjct  249  QIEASEWDFGLERGTVKVS-GNT-----VIVKPAGGEAVVKE-FPETSGVSEEIAAWAES  301

Query  248  ISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
            +          K  P  S  EG  D+  +E ML S +++GA
Sbjct  302  LV-------SGKQNPLQSAEEGMADVEFVEIMLRSAEKDGA  335



>ref|XP_006969500.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR44524.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETR97389.1| NAD(P)-binding protein [Trichoderma reesei RUT C-30]
Length=340

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 106/225 (47%), Gaps = 19/225 (8%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGG  612
            K  +AVAEN RF P+F       A+ G + N  V +   +   N +++++WR+  ++ GG
Sbjct  123  KATFAVAENIRFYPSFAYAASEAAKFGRVNNFTVRVLWRIEPDNKWYNTAWRKTPDYQGG  182

Query  611  FILDMGVHYVAGLRMLV-GCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            F+LD GVH+ A  R+L+ G E T  +V A T+   + LPP D ++A+ + ++G +GVF  
Sbjct  183  FLLDGGVHWAAATRLLLTGDENTPDAVQAFTALTCEHLPPIDTVNAIIKTKSGTAGVFQN  242

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
               S      W      G ++V           +V    G+ Q+K F     GV EE+  
Sbjct  243  SAGSLLQAFEWNFSYEKGAIKV------AGETVTVQPAGGEEQVKQFDRT-NGVSEEVAA  295

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  126
            +   +        + K  P  +  +   D+  +E M  SG   G+
Sbjct  296  WAQSLV-------DGKINPLQTPEQALADLEFMEKMFRSGDENGS  333



>gb|KIV93979.1| hypothetical protein PV10_05146 [Exophiala mesophila]
Length=341

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 98/222 (44%), Gaps = 31/222 (14%)
 Frame = -1

Query  776  WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSWRR--NFFG  615
            WAVAEN R+  +F +    +   G  +     +Q ++ G            WR+     G
Sbjct  134  WAVAENQRYLDSFEKAANAVKTKGRQLTFRLRMQTLVTGGKYFETS-----WRKVPTHQG  188

Query  614  GFILDMGVHYVAGLRMLV--GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  441
            GF+LD GVH+VAGLR L+  G  + ++SA ++ +   LPP D + A  + +NG  G  ++
Sbjct  189  GFLLDGGVHFVAGLRYLLGKGNPIVTISAHSAQLQDHLPPVDTVEATARTKNGAIGTLSI  248

Query  440  VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKT  261
               + +    W +           G +DG      S    DG  + F     GV  E++ 
Sbjct  249  SFGTTAKGTEWTI-----------GAEDGVVSIIDSDLTIDGNKQDFTNERSGVPPEVRA  297

Query  260  FLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  135
            +   ++  +        + R +  E   D+ ++EAML SG +
Sbjct  298  WGEALAAGSI-------DARQTPEEALADLELIEAMLVSGGK  332



>emb|CDM31202.1| NAD(P)-binding domain [Penicillium roqueforti FM164]
Length=346

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 112/242 (46%), Gaps = 39/242 (16%)
 Frame = -1

Query  791  TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnp-------yfssSW  633
            T K  WAVAEN+R+   F    + + ++G + N +V +   M+  N           ++W
Sbjct  125  TSKVFWAVAENFRYITKFLFAAEQVQKLGKVQNFRVNVHSLMDKENKYFPTDYIELDTAW  184

Query  632  RRN--FFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLEN  465
            R+   + GGF+LD GVH  A LR+++G  E  S+ +  S + K  LPP D + A+ + ++
Sbjct  185  RKTPEYQGGFLLDGGVHMTAALRLILGPTERLSILSAQSQLQKPFLPPVDTVDAVAKTKS  244

Query  464  GCSGVFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIKSFFY  294
            G +GV ++   S     ++      G  TL  +    +G KH         DG+      
Sbjct  245  GATGVISLSWGSSFNDQIFEFACEKGVVTLNFDDVTVNGEKHHVEF-----DGR------  293

Query  293  PFCGVQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREGALV  120
               GV  E+  F   I           G+P  R S  E   D+ +LE ML SG+++G  V
Sbjct  294  ---GVLPEVAAFADSI---------VNGKPDSRQSPEEALADLEILEQMLRSGEKDGEKV  341

Query  119  QV  114
            Q+
Sbjct  342  QL  343



>ref|XP_001227364.1| hypothetical protein CHGG_09437 [Chaetomium globosum CBS 148.51]
 gb|EAQ85423.1| hypothetical protein CHGG_09437 [Chaetomium globosum CBS 148.51]
Length=714

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 110/233 (47%), Gaps = 26/233 (11%)
 Frame = -1

Query  785  KPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWRRN--FFG  615
            KP+W VAEN+R+  +     + + E+G +++  ++   GS+ + N YF+++WR+   + G
Sbjct  129  KPLWGVAENWRYMESLRYAAERVREVGGELVTFKLHKYGSVKADNKYFNTAWRKTPEYQG  188

Query  614  GFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  444
            GF+LD GVH+VAGLR L+   G E+  +   +  +D+ L P D + A+    N  SG   
Sbjct  189  GFLLDGGVHFVAGLRFLLEAAGQEIKQLVGFSGLLDEKLIPVDTVQAVALTGNRKSGTII  248

Query  443  MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS---VSLYMGDGQIKSFFYPFCGVQE  273
            +   +                EVE     G   ++   V      G+ K  F    GV E
Sbjct  249  ITFGTE----------FKSGTEVEVVTTKGAVSWNPVEVKTVTSKGEEKKEFPSSNGVTE  298

Query  272  ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  114
            E+  F   I+       +       S  E  +D+ +L+ +LESG  EGA+  V
Sbjct  299  EVAAFGEAINAGQINNLQ-------SPQEALKDLEILQRLLESGAGEGAVKSV  344



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195