BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024A15

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG21667.1|  Heat shock cognate 80                                   315   8e-100   Gossypium arboreum [tree cotton]
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 315   8e-99    Tarenaya hassleriana [spider flower]
gb|EYU33725.1|  hypothetical protein MIMGU_mgv1a002215mg                315   1e-98    Erythranthe guttata [common monkey flower]
ref|XP_010446135.1|  PREDICTED: heat shock protein 90-3-like            303   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_004135777.1|  PREDICTED: heat shock protein 90-2-like            308   3e-97    
ref|NP_001234439.1|  heat shock cognate protein 80                      310   8e-97    Solanum lycopersicum
ref|XP_010235281.1|  PREDICTED: heat shock protein 81-1-like            309   1e-96    Brachypodium distachyon [annual false brome]
ref|XP_010433476.1|  PREDICTED: heat shock protein 90-2-like            309   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010235286.1|  PREDICTED: heat shock protein 81-1-like            309   2e-96    Brachypodium distachyon [annual false brome]
ref|XP_006413166.1|  hypothetical protein EUTSA_v10024564mg             308   2e-96    Eutrema salsugineum [saltwater cress]
gb|KGN66050.1|  hypothetical protein Csa_1G569270                       308   2e-96    Cucumis sativus [cucumbers]
ref|XP_010438732.1|  PREDICTED: heat shock protein 90-2-like            308   4e-96    Camelina sativa [gold-of-pleasure]
dbj|BAG16518.1|  putative Hsp90-2                                       307   6e-96    Capsicum chinense [bonnet pepper]
ref|XP_010443242.1|  PREDICTED: heat shock protein 90-2                 307   6e-96    Camelina sativa [gold-of-pleasure]
ref|XP_009126978.1|  PREDICTED: heat shock protein 90-2-like            307   6e-96    Brassica rapa
ref|XP_006287183.1|  hypothetical protein CARUB_v10000353mg             307   7e-96    Capsella rubella
ref|XP_010483070.1|  PREDICTED: heat shock protein 90-3-like            307   7e-96    Camelina sativa [gold-of-pleasure]
ref|XP_002869603.1|  early-responsive to dehydration 8                  306   1e-95    Arabidopsis lyrata subsp. lyrata
gb|KFK25886.1|  hypothetical protein AALP_AA8G175000                    306   1e-95    Arabis alpina [alpine rockcress]
ref|XP_006413591.1|  hypothetical protein EUTSA_v10024561mg             306   2e-95    Eutrema salsugineum [saltwater cress]
gb|KFK29176.1|  hypothetical protein AALP_AA7G099100                    305   4e-95    Arabis alpina [alpine rockcress]
ref|XP_010443241.1|  PREDICTED: heat shock protein 90-3-like            305   4e-95    Camelina sativa [gold-of-pleasure]
gb|KFK40163.1|  hypothetical protein AALP_AA3G338900                    305   5e-95    Arabis alpina [alpine rockcress]
ref|XP_006280102.1|  hypothetical protein CARUB_v10025991mg             303   7e-95    
ref|XP_010483069.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    305   7e-95    
ref|XP_010483071.1|  PREDICTED: heat shock protein 90-3-like            304   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010450563.1|  PREDICTED: heat shock protein 90-3-like            304   9e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006280103.1|  hypothetical protein CARUB_v10025991mg             304   9e-95    Capsella rubella
ref|XP_009132299.1|  PREDICTED: heat shock protein 90-2-like            303   2e-94    Brassica rapa
dbj|BAF01967.1|  HEAT SHOCK PROTEIN 81-2                                288   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401391.1|  hypothetical protein EUTSA_v10012832mg             303   2e-94    Eutrema salsugineum [saltwater cress]
gb|KFK27172.1|  hypothetical protein AALP_AA8G344900                    303   2e-94    Arabis alpina [alpine rockcress]
gb|ACX37413.1|  cytosolic heat shock protein 90.1                       303   3e-94    Dactylis glomerata [cocksfoot]
gb|AAF31705.1|AF221856_1  heat-shock protein 80                         290   9e-94    Euphorbia esula [wolf's milk]
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like            301   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ86355.1|  predicted protein                                      300   3e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADF31757.1|  heat shock protein 90                                   300   5e-93    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006280101.1|  hypothetical protein CARUB_v10025990mg             300   6e-93    Capsella rubella
emb|CAJ19348.1|  heat shock protein 90                                  298   1e-92    Triticum aestivum [Canadian hard winter wheat]
gb|ADF31760.1|  heat shock protein 90                                   298   1e-92    Triticum aestivum [Canadian hard winter wheat]
gb|ABG57075.1|  heat shock protein 90                                   298   2e-92    Triticum aestivum [Canadian hard winter wheat]
gb|AHM23830.1|  heat shock protein 90                                   290   2e-92    Brassica rapa
gb|AAP87284.1|  cytosolic heat shock protein 90                         298   2e-92    Hordeum vulgare [barley]
dbj|BAJ99646.1|  predicted protein                                      298   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK38607.1|  hypothetical protein AALP_AA3G136000                    297   2e-92    Arabis alpina [alpine rockcress]
gb|AAB33937.1|  heat-shock Protein                                      298   2e-92    Arabidopsis thaliana [mouse-ear cress]
gb|EMT17245.1|  Heat shock protein 81-3                                 298   3e-92    
ref|NP_200411.1|  Heat shock protein 90-4                               297   4e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KHG19401.1|  Heat shock cognate 80                                   297   4e-92    Gossypium arboreum [tree cotton]
dbj|BAD95027.1|  heat shock protein 90                                  288   5e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AEY83982.1|  heat shock protein 80 KDa                               281   9e-92    Triticum aestivum [Canadian hard winter wheat]
gb|ACX37414.1|  cytosolic heat shock protein 90.2                       296   9e-92    Dactylis glomerata [cocksfoot]
gb|AAH08189.1|  Unknown (protein for IMAGE:3584589)                     290   1e-91    Mus musculus [mouse]
tpg|DAA40367.1|  TPA: putative heat shock protein 90 family protein     286   1e-91    
gb|KJB13948.1|  hypothetical protein B456_002G103000                    293   1e-91    Gossypium raimondii
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like      295   2e-91    Sesamum indicum [beniseed]
ref|NP_001274833.1|  Hsp90-2-like                                       295   2e-91    Solanum tuberosum [potatoes]
gb|AGA62462.1|  heat shock protein 90                                   295   3e-91    Gossypium hirsutum [American cotton]
gb|KJB22185.1|  hypothetical protein B456_004G034000                    294   4e-91    Gossypium raimondii
gb|KHG22758.1|  Heat shock cognate 80                                   295   4e-91    Gossypium arboreum [tree cotton]
gb|KHN23824.1|  Heat shock cognate protein 80                           295   4e-91    Glycine soja [wild soybean]
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80           295   4e-91    Sesamum indicum [beniseed]
gb|KJB13949.1|  hypothetical protein B456_002G103000                    295   5e-91    Gossypium raimondii
gb|EEC84770.1|  hypothetical protein OsI_31800                          280   5e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like      294   6e-91    Glycine max [soybeans]
gb|AAN61003.1|  putative heat shock protein 90                          290   6e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            293   1e-90    Phoenix dactylifera
gb|ABV89643.1|  heat shock protein 81-4                                 291   1e-90    Brassica rapa
gb|AAN31859.1|  putative heat shock protein 81-2 (HSP81-2)              293   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132342.1|  PREDICTED: heat shock protein 90-2-like            293   2e-90    Brassica rapa
ref|NP_001236599.1|  heat shock protein 90-2                            293   2e-90    
gb|KDP32613.1|  hypothetical protein JCGZ_13163                         293   3e-90    Jatropha curcas
ref|XP_006452664.1|  hypothetical protein CICLE_v10007633mg             293   3e-90    Citrus clementina [clementine]
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80           292   3e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|AGT98548.1|  heat shock protein 90                                   280   3e-90    Paeonia lactiflora [common garden peony]
gb|KJB22184.1|  hypothetical protein B456_004G033900                    292   4e-90    Gossypium raimondii
ref|NP_001240230.1|  uncharacterized protein LOC100819568               292   4e-90    Glycine max [soybeans]
ref|XP_009132345.1|  PREDICTED: heat shock protein 90-2                 292   5e-90    Brassica rapa
ref|XP_010252844.1|  PREDICTED: heat shock cognate protein 80-like      292   5e-90    Nelumbo nucifera [Indian lotus]
ref|NP_001275844.1|  HSP90 protein                                      291   7e-90    Citrus sinensis [apfelsine]
dbj|BAO20259.1|  heat shock protein                                     291   8e-90    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009758556.1|  PREDICTED: heat shock cognate protein 80-like      291   9e-90    Nicotiana sylvestris
ref|XP_009594054.1|  PREDICTED: heat shock cognate protein 80-like      291   9e-90    Nicotiana tomentosiformis
ref|XP_009785111.1|  PREDICTED: heat shock cognate protein 80           291   1e-89    Nicotiana sylvestris
ref|NP_200414.1|  heat shock protein 81-2                               291   1e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AGU99972.1|  HSP90                                                   291   1e-89    Populus tomentosa [Chinese white poplar]
ref|XP_003574727.1|  PREDICTED: heat shock protein 81-1                 291   1e-89    Brachypodium distachyon [annual false brome]
gb|KCW70450.1|  hypothetical protein EUGRSUZ_F03673                     286   1e-89    Eucalyptus grandis [rose gum]
emb|CAK22426.1|  heat shock protein 83                                  281   1e-89    Beta vulgaris [beet]
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              290   2e-89    Cicer arietinum [garbanzo]
emb|CAA67191.1|  HSP80-2                                                290   2e-89    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001190553.1|  heat shock protein 81-2                            291   2e-89    Arabidopsis thaliana [mouse-ear cress]
gb|ADU04386.1|  heat shock protein 90-1                                 290   3e-89    Nicotiana attenuata
gb|AGB76029.1|  heat shock protein 90                                   290   4e-89    Salicornia europaea [chicken-claws]
tpg|DAA61993.1|  TPA: putative heat shock protein 90 family protein     282   4e-89    
ref|NP_200412.1|  Heat shock protein 90-3                               289   5e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAL49788.1|  putative heat shock protein 90                          289   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934626.1|  PREDICTED: heat shock protein 83-like              289   5e-89    Elaeis guineensis
ref|XP_007020406.1|  Heat shock protein 81.4                            289   6e-89    Theobroma cacao [chocolate]
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2                 289   6e-89    Prunus mume [ume]
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg             289   6e-89    Prunus persica
ref|XP_011039800.1|  PREDICTED: heat shock protein 90-2                 289   6e-89    Populus euphratica
ref|XP_002299048.1|  hypothetical protein POPTR_0001s47020g             289   7e-89    Populus trichocarpa [western balsam poplar]
ref|XP_002532177.1|  heat shock protein, putative                       289   7e-89    Ricinus communis
gb|EYU31897.1|  hypothetical protein MIMGU_mgv1a002208mg                289   8e-89    Erythranthe guttata [common monkey flower]
ref|XP_006352548.1|  PREDICTED: heat shock cognate protein 80-like      288   9e-89    Solanum tuberosum [potatoes]
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2                 288   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2                 288   1e-88    Pyrus x bretschneideri [bai li]
emb|CDP13679.1|  unnamed protein product                                288   1e-88    Coffea canephora [robusta coffee]
ref|XP_002273244.1|  PREDICTED: heat shock cognate protein 80-like      288   1e-88    Vitis vinifera
gb|ABB84343.1|  heat shock protein 90                                   287   1e-88    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006344905.1|  PREDICTED: heat shock cognate protein 80-like      288   2e-88    Solanum tuberosum [potatoes]
gb|EMS59444.1|  Heat shock protein 81-3                                 288   2e-88    Triticum urartu
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like            288   2e-88    Elaeis guineensis
gb|ADF31758.1|  heat shock protein 90                                   287   2e-88    Triticum aestivum [Canadian hard winter wheat]
gb|KCW70451.1|  hypothetical protein EUGRSUZ_F03673                     285   2e-88    Eucalyptus grandis [rose gum]
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2                 288   3e-88    
ref|NP_001234436.1|  molecular chaperone Hsp90-1                        287   3e-88    Solanum lycopersicum
gb|ADF31773.1|  heat shock protein 90                                   287   3e-88    Triticum urartu
ref|XP_002307846.1|  HSP80 family protein                               287   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_011005759.1|  PREDICTED: heat shock cognate protein 80-like      287   3e-88    Populus euphratica
gb|ABW96308.1|  heat shock protein 90                                   287   3e-88    Vitis pseudoreticulata
dbj|BAJ34368.1|  unnamed protein product                                287   3e-88    Eutrema halophilum
gb|AAD11549.1|  heat shock protein 80                                   287   3e-88    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009791186.1|  PREDICTED: heat shock protein 83-like              286   3e-88    Nicotiana sylvestris
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              287   4e-88    
gb|KEH26332.1|  heat shock protein 81-2                                 287   4e-88    Medicago truncatula
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             287   4e-88    Eutrema salsugineum [saltwater cress]
ref|XP_002866122.1|  heat shock protein 81-4                            287   4e-88    
ref|XP_006373573.1|  HSP80 family protein                               286   5e-88    Populus trichocarpa [western balsam poplar]
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1                 286   5e-88    Populus euphratica
gb|ADU04387.1|  heat shock protein 90-2                                 286   5e-88    Nicotiana attenuata
ref|XP_002864424.1|  heat shock protein 81-3                            286   5e-88    
ref|XP_010276895.1|  PREDICTED: heat shock protein 83-like              286   6e-88    Nelumbo nucifera [Indian lotus]
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like            286   7e-88    Zea mays [maize]
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like            286   7e-88    Elaeis guineensis
ref|XP_008776162.1|  PREDICTED: heat shock protein 81-1                 286   7e-88    Phoenix dactylifera
ref|XP_004135593.1|  PREDICTED: heat shock cognate protein 80-like      286   8e-88    
gb|AIZ68152.1|  heat shock protein 81-1                                 286   9e-88    Ornithogalum longebracteatum [sea-onion]
gb|ADF31759.1|  heat shock protein 90                                   286   9e-88    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008811143.1|  PREDICTED: heat shock protein 81-1-like            286   9e-88    Phoenix dactylifera
emb|CAN70887.1|  hypothetical protein VITISV_005592                     286   9e-88    Vitis vinifera
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              286   9e-88    Glycine max [soybeans]
gb|KHN09298.1|  Heat shock protein 83                                   286   9e-88    Glycine soja [wild soybean]
ref|XP_010063241.1|  PREDICTED: heat shock cognate protein 80-like      286   1e-87    Eucalyptus grandis [rose gum]
ref|XP_002976693.1|  hypothetical protein SELMODRAFT_151384             286   1e-87    Selaginella moellendorffii
ref|XP_009763345.1|  PREDICTED: heat shock cognate protein 80-like      286   1e-87    Nicotiana sylvestris
dbj|BAD73667.1|  putative heat shock protein 82                         283   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002973159.1|  hypothetical protein SELMODRAFT_271009             285   2e-87    Selaginella moellendorffii
gb|ACX31585.1|  molecular chaperone Hsp90-3                             285   2e-87    Nicotiana benthamiana
gb|ADF31781.1|  heat shock protein 90                                   285   2e-87    Triticum dicoccoides [wild emmer wheat]
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like            285   2e-87    Tarenaya hassleriana [spider flower]
emb|CAA72513.1|  heat shock protein                                     285   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278894.1|  PREDICTED: heat shock protein 83                   285   2e-87    Vitis vinifera
ref|XP_003635036.1|  PREDICTED: heat shock cognate protein 80           285   2e-87    Vitis vinifera
ref|XP_002462554.1|  hypothetical protein SORBIDRAFT_02g028020          285   2e-87    Sorghum bicolor [broomcorn]
sp|A2YWQ1.1|HSP81_ORYSI  RecName: Full=Heat shock protein 81-1; S...    285   3e-87    Oryza sativa Indica Group [Indian rice]
gb|AAR12194.1|  molecular chaperone Hsp90-2                             285   3e-87    Nicotiana benthamiana
ref|XP_006659551.1|  PREDICTED: heat shock protein 81-1-like isof...    285   3e-87    
ref|XP_006659552.1|  PREDICTED: heat shock protein 81-1-like isof...    285   3e-87    
ref|XP_008801780.1|  PREDICTED: heat shock protein 83                   284   4e-87    Phoenix dactylifera
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              284   4e-87    Phoenix dactylifera
ref|XP_010103960.1|  Heat shock cognate protein 80                      285   4e-87    
emb|CAN62488.1|  hypothetical protein VITISV_029391                     284   5e-87    Vitis vinifera
ref|XP_009607645.1|  PREDICTED: heat shock cognate protein 80-like      284   5e-87    Nicotiana tomentosiformis
emb|CDY27839.1|  BnaC09g28660D                                          284   5e-87    Brassica napus [oilseed rape]
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              284   5e-87    Nicotiana tomentosiformis
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1                 284   5e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1                 284   6e-87    
ref|NP_001062159.1|  Os08g0500700                                       283   7e-87    
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            283   8e-87    Tarenaya hassleriana [spider flower]
ref|XP_004500151.1|  PREDICTED: heat shock cognate protein 80-like      283   8e-87    Cicer arietinum [garbanzo]
ref|XP_004973824.1|  PREDICTED: heat shock protein 81-1-like            283   8e-87    
gb|ADF31754.1|  heat shock protein 90                                   283   9e-87    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002444804.1|  hypothetical protein SORBIDRAFT_07g028270          283   1e-86    Sorghum bicolor [broomcorn]
ref|XP_006659553.1|  PREDICTED: heat shock protein 81-1-like            283   1e-86    
gb|ADC53691.1|  heat shock protein 90-2                                 269   1e-86    Cryptocoryne ciliata
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         283   1e-86    Jatropha curcas
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              283   1e-86    Cucumis sativus [cucumbers]
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like            283   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU25148.1|  hypothetical protein MIMGU_mgv1a002213mg                283   2e-86    Erythranthe guttata [common monkey flower]
gb|ADC53692.1|  heat shock protein 90-1                                 269   2e-86    Cryptocoryne ciliata
ref|XP_004308050.1|  PREDICTED: heat shock protein 83-like              283   2e-86    Fragaria vesca subsp. vesca
ref|NP_001063500.1|  Os09g0482100                                       283   2e-86    
dbj|BAD04054.1|  heat shock protein 90                                  283   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like            282   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001063503.1|  Os09g0482400                                       282   2e-86    
dbj|BAA00615.1|  81kDa heat-shock protein                               282   2e-86    Arabidopsis thaliana [mouse-ear cress]
prf||1908431A  heat shock protein HSP81-1                               282   2e-86 
ref|NP_200076.1|  heat shock protein 90.1                               282   3e-86    
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    282   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004974826.1|  PREDICTED: heat shock protein 81-1-like            281   3e-86    
ref|XP_002864186.1|  heat shock protein 81-1                            282   3e-86    
gb|AAA32822.1|  heat shock protein 83                                   282   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   282   4e-86    Beta vulgaris subsp. vulgaris [field beet]
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                     281   4e-86    Eucalyptus grandis [rose gum]
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    281   5e-86    Eucalyptus grandis [rose gum]
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   281   5e-86    Cucumis melo [Oriental melon]
gb|EMS66149.1|  Heat shock protein 83                                   280   6e-86    Triticum urartu
ref|NP_001170475.1|  LOC100384473                                       281   7e-86    Zea mays [maize]
gb|ADF31772.1|  heat shock protein 90                                   281   9e-86    Triticum urartu
gb|ADF31778.1|  heat shock protein 90                                   281   1e-85    Triticum dicoccoides [wild emmer wheat]
gb|EMT27103.1|  Heat shock protein 83                                   280   1e-85    
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              280   1e-85    Elaeis guineensis
emb|CAA68885.1|  heat shock protein 90A                                 280   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941080.1|  PREDICTED: heat shock protein 83                   280   1e-85    Elaeis guineensis
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like            280   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1                 280   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like            280   2e-85    Elaeis guineensis
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like            280   2e-85    Camelina sativa [gold-of-pleasure]
gb|ADF31756.1|  heat shock protein 90                                   280   2e-85    Triticum aestivum [Canadian hard winter wheat]
gb|AAD30456.1|AF123259_1  heat shock protein 90                         272   2e-85    Solanum lycopersicum
gb|AGC60019.1|  heat shock protein 90                                   280   2e-85    Saccharum hybrid cultivar SP80-3280
gb|ADF31775.1|  heat shock protein 90                                   280   2e-85    Aegilops tauschii
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg             280   2e-85    Capsella rubella
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              280   3e-85    Setaria italica
gb|ADP89125.1|  heat shock protein 90                                   279   3e-85    Cenchrus americanus [bulrush millet]
dbj|BAJ85535.1|  predicted protein                                      280   4e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   279   4e-85    Fragaria vesca subsp. vesca
dbj|BAK08691.1|  heat shock protein 90                                  279   4e-85    Chara braunii
gb|KJB81562.1|  hypothetical protein B456_013G150300                    279   4e-85    Gossypium raimondii
dbj|BAK08741.1|  heat shock protein 90                                  279   4e-85    Chara braunii
gb|KFK26865.1|  hypothetical protein AALP_AA8G303900                    279   4e-85    Arabis alpina [alpine rockcress]
ref|XP_006659612.1|  PREDICTED: heat shock protein 81-1-like            278   5e-85    Oryza brachyantha
ref|XP_002969937.1|  hypothetical protein SELMODRAFT_267300             278   5e-85    
ref|XP_008355028.1|  PREDICTED: heat shock protein 90-2                 278   5e-85    
dbj|BAH97107.1|  heat shock protein of Hsp90                            279   5e-85    Chara braunii
dbj|BAK08690.1|  heat shock protein 90                                  279   5e-85    Chara braunii
dbj|BAK08728.1|  heat shock protein 90                                  278   6e-85    Chara braunii
ref|XP_002981406.1|  hypothetical protein SELMODRAFT_271484             278   6e-85    Selaginella moellendorffii
ref|XP_006857538.1|  hypothetical protein AMTR_s00061p00036160          278   6e-85    Amborella trichopoda
gb|AHB36893.1|  heat shock protein 90                                   278   7e-85    Matricaria chamomilla var. recutita [German chamomile]
prf||1710352A  heat shock protein 83                                    278   8e-85 
ref|XP_007142446.1|  hypothetical protein PHAVU_008G281300g             278   9e-85    Phaseolus vulgaris [French bean]
ref|XP_006408893.1|  hypothetical protein EUTSA_v10002229mg             278   9e-85    
ref|XP_007142447.1|  hypothetical protein PHAVU_008G281400g             278   1e-84    Phaseolus vulgaris [French bean]
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2                 278   1e-84    Fragaria vesca subsp. vesca
dbj|BAK08742.1|  heat shock protein 90                                  277   2e-84    Chara braunii
dbj|BAK08743.1|  heat shock protein 90                                  277   2e-84    Chara braunii
gb|EPS61618.1|  hypothetical protein M569_13176                         276   4e-84    Genlisea aurea
ref|XP_010539340.1|  PREDICTED: heat shock protein 90-2-like            276   4e-84    Tarenaya hassleriana [spider flower]
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              276   4e-84    Sesamum indicum [beniseed]
ref|NP_001170480.1|  HSP protein                                        276   5e-84    Zea mays [maize]
gb|ACN36206.1|  unknown                                                 276   6e-84    Zea mays [maize]
gb|KJB81563.1|  hypothetical protein B456_013G150300                    275   6e-84    Gossypium raimondii
gb|KCW90631.1|  hypothetical protein EUGRSUZ_A02734                     275   7e-84    Eucalyptus grandis [rose gum]
ref|XP_002509852.1|  heat shock protein, putative                       276   7e-84    Ricinus communis
gb|KJB24311.1|  hypothetical protein B456_004G138600                    276   8e-84    Gossypium raimondii
ref|XP_010060433.1|  PREDICTED: heat shock protein 83-like              276   8e-84    Eucalyptus grandis [rose gum]
ref|XP_010246543.1|  PREDICTED: heat shock cognate protein 80           275   1e-83    Nelumbo nucifera [Indian lotus]
ref|XP_009383207.1|  PREDICTED: heat shock protein 81-1-like            275   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007152171.1|  hypothetical protein PHAVU_004G107700g             274   3e-83    Phaseolus vulgaris [French bean]
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          274   4e-83    Sorghum bicolor [broomcorn]
gb|AGV54249.1|  heat-shock protein                                      273   5e-83    Phaseolus vulgaris [French bean]
ref|XP_002460433.1|  hypothetical protein SORBIDRAFT_02g028050          273   6e-83    Sorghum bicolor [broomcorn]
ref|XP_003617873.1|  Heat shock protein                                 273   9e-83    Medicago truncatula
gb|AEK20869.1|  heat shock protein 90-2                                 273   1e-82    Cryptocoryne ciliata
gb|ADX06844.1|  molecular chaperone Hsp90                               272   2e-82    Nicotiana tabacum [American tobacco]
gb|AAR12193.1|  molecular chaperone Hsp90-1                             272   2e-82    Nicotiana benthamiana
gb|AFQ94045.1|  heat shock protein 90                                   272   2e-82    Lactuca sativa [cultivated lettuce]
ref|XP_004491530.1|  PREDICTED: heat shock cognate protein 80-lik...    272   2e-82    Cicer arietinum [garbanzo]
ref|XP_009591410.1|  PREDICTED: heat shock cognate protein 80           272   2e-82    Nicotiana tomentosiformis
gb|AAS79798.1|  heat shock protein 90                                   271   3e-82    Nicotiana tabacum [American tobacco]
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   271   3e-82    Brachypodium distachyon [annual false brome]
gb|ACN27969.1|  unknown                                                 271   3e-82    Zea mays [maize]
ref|NP_001135416.2|  heat shock protein 82                              271   4e-82    
ref|XP_007038814.1|  Heat shock protein 90.1 isoform 2                  267   4e-82    
gb|KDO56797.1|  hypothetical protein CISIN_1g005370mg                   268   9e-82    Citrus sinensis [apfelsine]
emb|CDY50297.1|  BnaA10g28410D                                          268   1e-81    Brassica napus [oilseed rape]
gb|AIZ68157.1|  heat shock protein 83                                   270   1e-81    Ornithogalum longebracteatum [sea-onion]
ref|XP_009413748.1|  PREDICTED: heat shock protein 83                   270   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009119805.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    270   2e-81    Brassica rapa
ref|XP_006422036.1|  hypothetical protein CICLE_v10004456mg             269   3e-81    Citrus clementina [clementine]
gb|KDO56796.1|  hypothetical protein CISIN_1g005370mg                   269   3e-81    Citrus sinensis [apfelsine]
ref|XP_002300303.1|  HSP80 family protein                               269   4e-81    Populus trichocarpa [western balsam poplar]
sp|P51819.1|HSP83_IPONI  RecName: Full=Heat shock protein 83            268   4e-81    Ipomoea nil [qian niu]
ref|XP_011035347.1|  PREDICTED: heat shock protein 83-like isofor...    266   4e-81    Populus euphratica
ref|XP_007038813.1|  Heat shock protein 90.1 isoform 1                  268   4e-81    
ref|XP_006372391.1|  hypothetical protein POPTR_0017s01160g             268   4e-81    
ref|XP_002305263.1|  hypothetical protein POPTR_0004s07190g             268   4e-81    
ref|XP_009377558.1|  PREDICTED: heat shock protein 83-like              268   4e-81    
ref|XP_011030250.1|  PREDICTED: heat shock protein 81-1-like            268   5e-81    
ref|XP_001777414.1|  predicted protein                                  268   1e-80    
ref|XP_001777383.1|  predicted protein                                  268   1e-80    
ref|XP_009368732.1|  PREDICTED: heat shock protein 83                   267   1e-80    
gb|KHG00618.1|  Heat shock 90-1 -like protein                           267   1e-80    
gb|ABX76302.1|  heat shock protein 90                                   266   2e-80    
ref|XP_011035346.1|  PREDICTED: heat shock protein 83-like isofor...    267   2e-80    
gb|ADF31779.1|  heat shock protein 90                                   266   3e-80    
gb|KDP22224.1|  hypothetical protein JCGZ_26055                         266   3e-80    
ref|XP_010089053.1|  Heat shock protein 83                              266   3e-80    
emb|CAN73318.1|  hypothetical protein VITISV_007727                     266   4e-80    
ref|XP_002274022.1|  PREDICTED: heat shock protein 83-like              266   4e-80    
gb|KJB52728.1|  hypothetical protein B456_008G274600                    266   4e-80    
ref|XP_008376647.1|  PREDICTED: heat shock protein 83 isoform X1        266   5e-80    
ref|XP_008380194.1|  PREDICTED: heat shock protein 83-like              265   6e-80    
gb|EYU19581.1|  hypothetical protein MIMGU_mgv1a002166mg                265   6e-80    
sp|P36182.1|HSP82_TOBAC  RecName: Full=Heat shock protein 82            260   7e-80    
gb|KHN16650.1|  Heat shock protein 81-3                                 263   8e-80    
ref|XP_010035175.1|  PREDICTED: heat shock protein 83                   265   1e-79    
ref|XP_010089052.1|  Heat shock protein 83                              265   1e-79    
gb|ADF31755.1|  heat shock protein 90                                   265   2e-79    
gb|AAQ08597.1|  heat shock protein                                      264   2e-79    
ref|XP_011046024.1|  PREDICTED: heat shock protein 83                   263   3e-79    
ref|XP_009607669.1|  PREDICTED: heat shock protein 82                   263   4e-79    
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            263   4e-79    
gb|AFR60309.1|  HSP90                                                   263   4e-79    
ref|XP_010261331.1|  PREDICTED: heat shock protein 83                   263   4e-79    
ref|XP_006476504.1|  PREDICTED: heat shock protein 83-like              263   4e-79    
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              263   5e-79    
gb|KJB20596.1|  hypothetical protein B456_003G155600                    263   6e-79    
gb|KDO76323.1|  hypothetical protein CISIN_1g005321mg                   263   7e-79    
ref|XP_007220219.1|  hypothetical protein PRUPE_ppa002187mg             263   7e-79    
ref|XP_001419938.1|  Heat Shock Protein 90, cytosolic                   262   1e-78    
ref|XP_008234835.1|  PREDICTED: heat shock protein 83                   262   1e-78    
gb|KHN31689.1|  Heat shock cognate protein 80                           261   1e-78    
ref|XP_009768512.1|  PREDICTED: heat shock protein 82                   261   2e-78    
ref|XP_006828794.1|  hypothetical protein AMTR_s00001p00118120          261   2e-78    
ref|XP_009375529.1|  PREDICTED: heat shock protein 83-like              261   2e-78    
gb|ADC45395.1|  HSP90-1                                                 261   2e-78    
ref|XP_001695264.1|  heat shock protein 90A                             261   3e-78    
ref|XP_001766228.1|  predicted protein                                  261   3e-78    
ref|NP_001236612.1|  heat shock protein 90-1                            261   3e-78    
ref|XP_001779443.1|  predicted protein                                  260   4e-78    
ref|XP_007040338.1|  Heat shock protein 90.1                            260   5e-78    
gb|EAY92778.1|  hypothetical protein OsI_14582                          260   7e-78    
ref|XP_006439485.1|  hypothetical protein CICLE_v10019095mg             260   8e-78    
emb|CDP05141.1|  unnamed protein product                                260   8e-78    
emb|CAE02770.2|  OSJNBb0085F13.17                                       260   8e-78    
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              260   1e-77    
ref|XP_004240717.1|  PREDICTED: heat shock protein 83-like              257   8e-77    
ref|XP_001780981.1|  predicted protein                                  257   1e-76    
gb|AAN77149.1|  fiber protein Fb9                                       241   2e-76    
ref|XP_009802902.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    256   2e-76    
ref|XP_010537148.1|  PREDICTED: heat shock protein 83                   255   4e-76    
ref|XP_011076104.1|  PREDICTED: heat shock protein 83                   255   4e-76    
ref|XP_002513649.1|  heat shock protein, putative                       255   4e-76    
ref|XP_011084460.1|  PREDICTED: heat shock protein 83-like              255   5e-76    
gb|ABK21939.1|  unknown                                                 241   7e-76    
ref|XP_003058104.1|  predicted protein                                  253   2e-75    
gb|KIY96293.1|  Heat shock protein 82                                   248   3e-75    
ref|XP_004234218.1|  PREDICTED: heat shock protein 83                   252   8e-75    
ref|XP_006362664.1|  PREDICTED: heat shock protein 83-like              252   8e-75    
ref|XP_003081563.1|  Molecular chaperone (HSP90 family) (ISS)           244   2e-74    
gb|AFK31312.1|  heat shock protein 90                                   250   2e-74    
ref|XP_008238949.1|  PREDICTED: heat shock protein 90-1-like            251   2e-74    
ref|XP_005643103.1|  HSP90-domain-containing protein                    250   3e-74    
gb|ABF61871.1|  chaperone                                               234   5e-74    
ref|XP_002499727.1|  predicted protein                                  249   6e-74    
gb|KFG42944.1|  heat shock protein HSP90                                238   8e-74    
ref|XP_005703696.1|  molecular chaperone HtpG                           248   2e-73    
ref|XP_007510316.1|  predicted protein                                  246   8e-73    
emb|CEF99333.1|  Histidine kinase-like ATPase, ATP-binding domain       245   2e-72    
gb|AEP39605.1|  heat shock protein 90                                   245   3e-72    
ref|XP_003592196.1|  Heat shock protein                                 244   4e-72    
ref|XP_676736.1|  hypothetical protein                                  233   6e-72    
ref|XP_005715129.1|  unnamed protein product                            243   2e-71    
ref|XP_729156.1|  heat shock 90 kDa protein                             232   2e-71    
ref|XP_004363302.1|  heat shock protein 90a                             241   1e-70    
gb|KJE92655.1|  heat shock protein 90a                                  241   2e-70    
ref|XP_005841337.1|  hypothetical protein GUITHDRAFT_83993              240   2e-70    
gb|ACO58580.1|  heat shock protein 90                                   231   5e-70    
ref|XP_005764796.1|  hypothetical protein EMIHUDRAFT_437342             238   6e-70    
emb|CAA34748.1|  heat shock-like protein                                228   6e-70    
ref|XP_005777261.1|  hypothetical protein EMIHUDRAFT_443778             239   7e-70    
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                   230   8e-70    
ref|XP_010928209.1|  PREDICTED: heat shock protein 90-2-like            222   1e-69    
gb|AFK31313.1|  heat shock protein 90                                   238   1e-69    
gb|ETW57274.1|  hypothetical protein PFUGPA_00763                       226   2e-69    
gb|KDD75584.1|  heat shock protein 90 Hsp90                             237   2e-69    
ref|XP_002368278.1|  heat shock protein 90                              237   2e-69    
ref|XP_010928210.1|  PREDICTED: heat shock protein 90-2-like            221   3e-69    
ref|XP_008889030.1|  heat shock protein HSP90                           237   4e-69    
ref|XP_003881046.1|  hsp90, related                                     236   4e-69    
emb|CAC29071.1|  heat shock protein 90                                  224   6e-69    
gb|AAH07989.2|  HSP90AA1 protein                                        229   1e-68    
emb|CBJ23502.1|  heat shock protein 90                                  223   2e-68    
gb|ACY66376.1|  HSP90                                                   229   2e-68    
gb|KHN43913.1|  Heat shock cognate protein 80                           230   2e-68    
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-68    
dbj|BAH71458.1|  ACYPI002010                                            223   2e-68    
gb|AAH49951.1|  Hsp90ab1 protein                                        226   2e-68    
emb|CDW75268.1|  heat shock protein 90                                  234   2e-68    
pdb|3Q6M|A  Chain A, Crystal Structure Of Human Mc-hsp90 In C2221...    229   3e-68    
gb|EJY88528.1|  Heat shock protein 90                                   234   3e-68    
dbj|BAF83423.1|  unnamed protein product                                226   4e-68    
dbj|BAE87688.1|  unnamed protein product                                226   4e-68    
dbj|BAB15121.1|  unnamed protein product                                226   4e-68    
gb|AAH44888.1|  Hsp90ab1 protein                                        226   5e-68    
gb|ADQ20111.1|  heat shock protein 90                                   234   5e-68    
gb|EDL18665.1|  mCG14932, isoform CRA_a                                 228   6e-68    
gb|EDL97505.1|  rCG27814, isoform CRA_c                                 228   6e-68    
ref|XP_005805661.1|  PREDICTED: heat shock protein HSP 90-alpha-like    234   8e-68    
dbj|BAE48212.1|  heat shock protein 90 beta                             223   1e-67    
emb|CDS46141.1|  heat shock protein 90, putative                        233   1e-67    
gb|AIY24626.1|  heat shock protein 90                                   233   1e-67    
gb|EUD73992.1|  heat shock protein 90                                   233   1e-67    
gb|ETW37561.1|  hsp90-like protein                                      226   1e-67    
gb|AAY67878.1|  heat shock protein 90                                   233   1e-67    
gb|AAH00987.1|  HSP90AA1 protein                                        229   2e-67    
emb|CDR12458.1|  heat shock protein 90, putative                        232   2e-67    
gb|KFP61130.1|  Heat shock protein HSP 90-alpha                         229   2e-67    
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              232   2e-67    
ref|XP_009702297.1|  PREDICTED: heat shock protein HSP 90-alpha         229   2e-67    
emb|CAG01828.1|  unnamed protein product                                228   3e-67    
ref|XP_008623748.1|  heat shock protein 90                              232   3e-67    
gb|ETB60437.1|  hsp90-like protein                                      232   3e-67    
ref|XP_010010145.1|  PREDICTED: heat shock protein HSP 90-beta          230   4e-67    
gb|AAC25497.1|  Hsp89-alpha-delta-N                                     228   4e-67    
gb|AAY67995.1|  HSP 90                                                  226   5e-67    
gb|AEA42008.1|  heat shock protein 90                                   231   5e-67    
gb|EJY69804.1|  Heat shock protein 90                                   231   5e-67    
ref|XP_007577309.1|  PREDICTED: heat shock protein HSP 90-alpha         231   5e-67    
ref|XP_006001581.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    231   5e-67    
gb|ACQ90225.1|  heat shock protein 90-1                                 231   5e-67    
ref|XP_008311363.1|  PREDICTED: heat shock protein HSP 90-alpha         231   5e-67    
gb|AAZ17404.1|  90 kDa heat shock protein                               224   5e-67    
gb|EGW01344.1|  Heat shock protein HSP 90-beta                          224   6e-67    
ref|XP_008396615.1|  PREDICTED: heat shock protein HSP 90-alpha         231   6e-67    
gb|AFQ23182.1|  heat shock protein 90                                   231   6e-67    
ref|XP_002291118.1|  HSP90 family member                                231   6e-67    
emb|CCI46339.1|  unnamed protein product                                231   6e-67    
ref|XP_007488498.1|  PREDICTED: heat shock protein HSP 90-alpha-like    226   7e-67    
ref|XP_007886533.1|  PREDICTED: heat shock protein HSP 90-alpha         231   7e-67    
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like              231   8e-67    
gb|EYD92886.1|  hsp90 family protein                                    220   8e-67    
ref|XP_004645488.1|  PREDICTED: heat shock protein HSP 90-alpha         229   8e-67    
gb|KFQ47178.1|  Heat shock cognate protein HSP 90-beta                  229   9e-67    
ref|XP_008627985.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    230   9e-67    
ref|XP_004408110.1|  PREDICTED: heat shock protein HSP 90-alpha-like    220   9e-67    
gb|AER28025.1|  heat shock protein 83S2                                 231   9e-67    
ref|XP_006018082.1|  PREDICTED: heat shock protein HSP 90-alpha i...    230   1e-66    
ref|XP_005417950.1|  PREDICTED: heat shock protein HSP 90-alpha i...    230   1e-66    
ref|XP_002672583.1|  predicted protein                                  230   1e-66    
ref|XP_005483288.1|  PREDICTED: heat shock protein HSP 90-alpha i...    230   1e-66    
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like    231   1e-66    
ref|XP_011369249.1|  PREDICTED: heat shock protein HSP 90-alpha         227   1e-66    
ref|XP_010152348.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   1e-66    
ref|XP_010902984.1|  PREDICTED: heat shock protein HSP 90-alpha         231   1e-66    
gb|EDL97503.1|  rCG27814, isoform CRA_a                                 228   1e-66    
ref|XP_009580794.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   1e-66    
ref|NP_001153536.1|  heat shock protein 90                              230   1e-66    
ref|XP_009953881.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   1e-66    
gb|AIC63037.1|  HSP90AA1                                                229   1e-66    
ref|XP_011250812.1|  PREDICTED: heat shock protein 83                   230   1e-66    
emb|CDY22598.1|  BnaC05g24360D                                          225   1e-66    
ref|XP_008498249.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   1e-66    
dbj|BAE39398.1|  unnamed protein product                                227   1e-66    
gb|EDL18667.1|  mCG14932, isoform CRA_c                                 229   1e-66    
gb|AAH23006.2|  HSP90AA1 protein                                        229   1e-66    
ref|XP_004083819.1|  PREDICTED: heat shock protein HSP 90-alpha         230   1e-66    
gb|AAP20179.1|  heat shock protein 90 beta                              225   2e-66    
ref|XP_011060405.1|  PREDICTED: heat shock protein 83                   230   2e-66    
ref|NP_001016282.1|  heat shock protein 90kDa alpha (cytosolic), ...    230   2e-66    
gb|KGL98099.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|XP_009889390.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
ref|NP_001274200.1|  heat shock protein 90kDa alpha (cytosolic), ...    230   2e-66    
gb|ACJ01642.1|  90 kDa heat shock protein                               230   2e-66    
gb|KFP45671.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|NP_001103255.1|  heat shock protein HSP 90-alpha                    230   2e-66    
ref|XP_005506149.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   2e-66    
gb|KFP47363.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|XP_010020311.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
gb|KFQ82066.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|XP_009099985.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
ref|XP_005417949.1|  PREDICTED: heat shock protein HSP 90-alpha i...    230   2e-66    
ref|XP_010132756.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
gb|ADE60732.1|  heat shock protein 90                                   229   2e-66    
gb|KFU89878.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|XP_009326272.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
gb|AFO84300.1|  heat shock protein 90                                   229   2e-66    
gb|KFQ77344.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|XP_009972463.1|  PREDICTED: heat shock protein HSP 90-alpha i...    230   2e-66    
ref|XP_009996302.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
gb|KFQ56441.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
ref|XP_005623992.1|  PREDICTED: heat shock protein HSP 90-alpha         228   2e-66    
ref|XP_005020783.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
ref|XP_005149613.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
gb|EOB00416.1|  Heat shock protein HSP 90-alpha                         230   2e-66    
gb|AEM65180.1|  heat shock protein 90 alpha                             230   2e-66    
ref|XP_005072380.1|  PREDICTED: heat shock protein HSP 90-beta is...    227   2e-66    
ref|XP_005047661.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   2e-66    
gb|AFN89572.1|  HSP90                                                   230   2e-66    
ref|XP_008936282.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    230   2e-66    
gb|EPY87751.1|  heat shock protein HSP 90-alpha                         229   2e-66    
ref|XP_009279122.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
ref|NP_001085598.1|  heat shock protein 90kDa alpha (cytosolic), ...    229   2e-66    
ref|XP_010393468.1|  PREDICTED: heat shock protein HSP 90-alpha         230   2e-66    
gb|KFQ27573.1|  Heat shock protein HSP 90-alpha                         229   2e-66    
gb|ADV59561.1|  heat shock protein 90                                   229   2e-66    
ref|XP_005562292.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   2e-66    
ref|XP_005341052.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   2e-66    
ref|XP_002200608.1|  PREDICTED: heat shock protein HSP 90-alpha         229   2e-66    
ref|XP_005410794.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   2e-66    
ref|XP_009953880.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   2e-66    
ref|XP_010126476.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    230   2e-66    
ref|XP_010292573.1|  PREDICTED: heat shock protein HSP 90-alpha         229   2e-66    
ref|XP_005506148.1|  PREDICTED: heat shock protein HSP 90-alpha i...    229   3e-66    
gb|AIT39270.1|  heat shock protein 90                                   229   3e-66    
ref|XP_010351937.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    229   3e-66    



>gb|KHG21667.1| Heat shock cognate 80 [Gossypium arboreum]
Length=615

 Score =   315 bits (807),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 206/214 (96%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  402  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  461

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  462  IKDVLGDKVEKVLVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  521

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  522  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  581

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  582  GLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  615



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   315 bits (806),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEK+KKE LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKQKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD +MP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDVAGEADSDMPPLEDDVDAEGSKMEEVD  699



>gb|EYU33725.1| hypothetical protein MIMGU_mgv1a002215mg [Erythranthe guttata]
Length=700

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 205/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVIYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+D    ADV+MPALE+   DAEGSKMEEVD
Sbjct  666  GLSIDDDESGEADVDMPALEEVDADAEGSKMEEVD  700



>ref|XP_010446135.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=437

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  224  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  283

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  284  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  343

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  344  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  403

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  404  GLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  437



>ref|XP_004135777.1| PREDICTED: heat shock protein 90-2-like [Cucumis sativus]
Length=611

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE L  KF+GLC V
Sbjct  398  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALVEKFDGLCKV  457

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+D+SMAGYMSSKKTM
Sbjct  458  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDNSMAGYMSSKKTM  517

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  518  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  577

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDE+AG+  D EMP LED   DAEGSKMEEVD
Sbjct  578  GLSIDEEAGE-GDSEMPPLEDADADAEGSKMEEVD  611



>ref|NP_001234439.1| heat shock cognate protein 80 [Solanum lycopersicum]
 sp|P36181.1|HSP80_SOLLC RecName: Full=Heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAB01376.1| heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAR12196.1| molecular chaperone Hsp90-2 [Solanum lycopersicum]
 prf||1909348A heat shock protein hsp80
Length=699

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 206/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  MKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDE++GD AD +MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEESGD-ADADMPALEDPEADAEGSKMEEVD  699



>ref|XP_010235281.1| PREDICTED: heat shock protein 81-1-like [Brachypodium distachyon]
Length=700

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+++EDEKKKKEELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEDTEDEKKKKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED   +A D +MPALEDDA  SKMEEVD
Sbjct  668  GLSIDEDETAEADDTDMPALEDDAGESKMEEVD  700



>ref|XP_010433476.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448245.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448246.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448248.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010491086.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=701

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 205/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  487  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  MKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  607  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  667  GLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  701



>ref|XP_010235286.1| PREDICTED: heat shock protein 81-1-like [Brachypodium distachyon]
Length=699

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 200/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL++SEDEKKKKEELK KFEGLC V
Sbjct  487  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEDSEDEKKKKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  547  IKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  607  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  666

Query  204  GLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED   +A D +MPALEDDA  SKMEEVD
Sbjct  667  GLSIDEDETAEADDTDMPALEDDAGESKMEEVD  699



>ref|XP_006413166.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
 gb|ESQ54619.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
Length=700

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 205/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  666  GLSIDDDAGEGEADADMPPLEDDAEAEGSKMEEVD  700



>gb|KGN66050.1| hypothetical protein Csa_1G569270 [Cucumis sativus]
Length=699

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE L  KF+GLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALVEKFDGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+D+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDE+AG+  D EMP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEEAGE-GDSEMPPLEDADADAEGSKMEEVD  699



>ref|XP_010438732.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=706

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 205/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  492  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  551

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  552  MKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  611

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  612  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  671

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  672  GLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  706



>dbj|BAG16518.1| putative Hsp90-2 [Capsicum chinense]
Length=699

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  546  MKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDE+ GD ADV+MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEEGGD-ADVDMPPLEDPEADAEGSKMEEVD  699



>ref|XP_010443242.1| PREDICTED: heat shock protein 90-2 [Camelina sativa]
Length=699

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_009126978.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=696

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEK KKEELK KFEGLC V
Sbjct  483  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKNKKEELKEKFEGLCKV  542

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  543  IKDILGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  602

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  603  EINPENAIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  662

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED     D EMP LED  DAEGSKMEEVD
Sbjct  663  GLSIDEDDAVEGDAEMPPLEDDADAEGSKMEEVD  696



>ref|XP_006287183.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
 gb|EOA20081.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
Length=699

 Score =   307 bits (787),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_010483070.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   307 bits (787),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_002869603.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45862.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=700

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 205/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  666  GLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  700



>gb|KFK25886.1| hypothetical protein AALP_AA8G175000 [Arabis alpina]
Length=700

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 203/215 (94%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKK+ELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKDELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+  GYMSSKKTM
Sbjct  546  MKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNTGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD EMP LEDD  AEGSKMEEVD
Sbjct  666  GLSIDDDAGETEADAEMPPLEDDAEAEGSKMEEVD  700



>ref|XP_006413591.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
 gb|ESQ55044.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
Length=700

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  666  GLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  700



>gb|KFK29176.1| hypothetical protein AALP_AA7G099100 [Arabis alpina]
Length=700

 Score =   305 bits (782),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 204/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKK KEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKNKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID+DAG+  AD +MP LEDD  AEGSKMEEVD
Sbjct  666  GLSIDDDAGETEADADMPPLEDDAEAEGSKMEEVD  700



>ref|XP_010443241.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KFK40163.1| hypothetical protein AALP_AA3G338900 [Arabis alpina]
Length=701

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 203/215 (94%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKK EELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKAEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  547  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  607  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDA-ADVEMPALED--DAEGSKMEEVD  109
            GLSID+DAG+  AD +MP LED  DAEGSKMEEVD
Sbjct  667  GLSIDDDAGETEADADMPPLEDDADAEGSKMEEVD  701



>ref|XP_006280102.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13000.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=658

 Score =   303 bits (777),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  445  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  504

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  505  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  564

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  565  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  624

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DA+GSKMEEVD
Sbjct  625  GLSIDEDDAVEADAEMPPLEDDADADGSKMEEVD  658



>ref|XP_010483069.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-3-like 
[Camelina sativa]
Length=699

 Score =   305 bits (780),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_010483071.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDTVEADAEMPLLEDDADAEGSKMEEVD  699



>ref|XP_010450563.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   304 bits (779),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALEDD--AEGSKMEEVD  109
            GLSIDED    ADVE+P LEDD  AEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADVELPPLEDDAEAEGSKMEEVD  699



>ref|XP_006280103.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13001.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=699

 Score =   304 bits (779),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DA+GSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADADGSKMEEVD  699



>ref|XP_009132299.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=699

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G+EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL ESEDEKKKKEELK KFEGLC V
Sbjct  486  GFEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLGESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>dbj|BAF01967.1| HEAT SHOCK PROTEIN 81-2 [Arabidopsis thaliana]
Length=218

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  5    GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  64

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  65   IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  124

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  125  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  184

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  185  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  218



>ref|XP_006401391.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
 dbj|BAJ33984.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42844.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
Length=699

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KFK27172.1| hypothetical protein AALP_AA8G344900 [Arabis alpina]
Length=699

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDTVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|ACX37413.1| cytosolic heat shock protein 90.1 [Dactylis glomerata]
Length=699

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED     D +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDEAPENDTDMPPLEDDAGESKMEEVD  699



>gb|AAF31705.1|AF221856_1 heat-shock protein 80 [Euphorbia esula]
Length=320

 Score =   290 bits (743),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 206/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLK+DESEDEKKKK+ELK +FEGLC V
Sbjct  107  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKIDESEDEKKKKDELKEQFEGLCKV  166

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  167  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  226

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  227  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  286

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+  D +MPALE+   DAEGSKMEEVD
Sbjct  287  GLSIDEDAGE-GDADMPALEEADADAEGSKMEEVD  320



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 200/213 (94%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEY++GQLKEF+GKKLVSATKEGLK+DESEDEKKKKE LK KFEGLC V
Sbjct  488  GYEVLFMVDAIDEYSVGQLKEFEGKKLVSATKEGLKIDESEDEKKKKETLKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT+
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTL  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  608  EINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED     D +MP+LE+ DAE SKMEEVD
Sbjct  668  GLSIDEDE-KVEDTDMPSLEEADAEESKMEEVD  699



>dbj|BAJ86355.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=700

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDA-ADVEMPALEDDAEGSKMEEVD  109
            GLSIDED   A AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDDEPAEADTDMPPLEEDAGESKMEEVD  700



>gb|ADF31757.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31766.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31780.1| heat shock protein 90 [Triticum dicoccoides]
Length=700

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 199/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDA-ADVEMPALEDDAEGSKMEEVD  109
            GLSIDED   A AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAGADTDMPPLEEDAGESKMEEVD  700



>ref|XP_006280101.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
 gb|EOA12999.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
Length=699

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 198/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSS   YMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSTGSYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMNELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>emb|CAJ19348.1| heat shock protein 90 [Triticum aestivum]
Length=658

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  446  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  505

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  506  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  565

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  566  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  625

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  626  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  658



>gb|ADF31760.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31769.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31774.1| heat shock protein 90 [Triticum urartu]
 gb|ADF31782.1| heat shock protein 90 [Triticum dicoccoides]
 gb|EMS53579.1| Heat shock protein 81-3 [Triticum urartu]
Length=700

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>gb|ABG57075.1| heat shock protein 90 [Triticum aestivum]
 gb|ABG57076.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31761.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31762.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31770.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31771.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31777.1| heat shock protein 90 [Aegilops tauschii]
 gb|ADF31783.1| heat shock protein 90 [Triticum dicoccoides]
 gb|AEK01109.1| heat shock protein 90 [Triticum aestivum]
 gb|AFH40333.1| heat shock protein 90 [Secale cereale]
Length=700

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>gb|AHM23830.1| heat shock protein 90, partial [Brassica rapa]
Length=421

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEELK KFEGLC V
Sbjct  208  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEELKEKFEGLCKV  267

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  268  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  327

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  328  EINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  387

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  388  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  421



>gb|AAP87284.1| cytosolic heat shock protein 90 [Hordeum vulgare]
Length=700

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>dbj|BAJ99646.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=700

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>gb|KFK38607.1| hypothetical protein AALP_AA3G136000 [Arabis alpina]
Length=655

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 198/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  442  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  501

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSD VVDSPCCLVTGEYGWTANMERIMKAQALRDS M GYMSSKKTM
Sbjct  502  IKDVLGDKVEKVIVSDHVVDSPCCLVTGEYGWTANMERIMKAQALRDSGMGGYMSSKKTM  561

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  562  EINPENSIMDELRKRAEADKNDKSVKDLVVLLFETALLTSGFSLDEPNTFGSRIHRMLKL  621

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEV  112
            GLSIDED    AD EMP LED  DAEGSKMEEV
Sbjct  622  GLSIDEDDTVEADTEMPPLEDDADAEGSKMEEV  654



>gb|AAB33937.1| heat-shock Protein [Arabidopsis thaliana]
Length=699

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 199/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEEL  KFEGLC V
Sbjct  486  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELNEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRV+DSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVLDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENLIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSI+ED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIEEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|EMT17245.1| Heat shock protein 81-3 [Aegilops tauschii]
Length=720

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  508  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  567

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  568  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  627

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  628  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  687

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  688  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  720



>ref|NP_200411.1| Heat shock protein 90-4 [Arabidopsis thaliana]
 sp|O03986.1|HS904_ARATH RecName: Full=Heat shock protein 90-4; Short=AtHSP90.4; AltName: 
Full=Heat shock protein 81-4; Short=HSP81-4 [Arabidopsis 
thaliana]
 emb|CAA72514.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAB09282.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAE99287.1| heat shock protein [Arabidopsis thaliana]
 gb|AED96708.1| Heat shock protein 90-4 [Arabidopsis thaliana]
Length=699

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E++DEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETDDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+DS+  GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDSNTGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSI+ED    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIEEDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|KHG19401.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 204/214 (95%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVMVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADV-EMPALED-DAEGSKMEEVD  109
            GLSIDEDAGDA    E+P LED DAEGSKMEEVD
Sbjct  666  GLSIDEDAGDADADSEIPPLEDADAEGSKMEEVD  699



>dbj|BAD95027.1| heat shock protein 90 [Arabidopsis thaliana]
Length=373

 Score =   288 bits (736),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  160  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  219

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  220  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  279

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  280  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  339

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  340  GLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  373



>gb|AEY83982.1| heat shock protein 80 KDa, partial [Triticum aestivum]
 gb|AEY83983.1| heat shock protein 80 KDa, partial [Triticum aestivum]
 gb|AEY83984.1| heat shock protein 80 KDa, partial [Triticum aestivum]
Length=212

 Score =   281 bits (719),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 197/212 (93%), Gaps = 1/212 (0%)
 Frame = -2

Query  741  YEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTVM  562
            YEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V+
Sbjct  1    YEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKVI  60

Query  561  KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTME  382
            K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTME
Sbjct  61   KEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTME  120

Query  381  INPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKLG  202
            INPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKLG
Sbjct  121  INPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKLG  180

Query  201  LSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            LSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  181  LSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  212



>gb|ACX37414.1| cytosolic heat shock protein 90.2 [Dactylis glomerata]
Length=699

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLK+D+SEDEKK+KEELK KFEGLC V
Sbjct  487  GLEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKIDDSEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  547  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  607  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  666

Query  204  GLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED   +A D +MP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDEPAEADDTDMPPLEDDAGESKMEEVD  699



>gb|AAH08189.1| Unknown (protein for IMAGE:3584589), partial [Mus musculus]
Length=491

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK EE K KFEGLC V
Sbjct  279  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKSEESKEKFEGLCKV  338

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  339  MKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTM  398

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLL ETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  399  EINPENPIMEELRKRADADKNDKSVKDLVLLLHETALLTSGFSLDDPNTFGNRIHRMLKL  458

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSID+DA    DV+MPALE+ DAE SKMEEVD
Sbjct  459  GLSIDDDAAGEVDVDMPALEEADAEESKMEEVD  491



>tpg|DAA40367.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=365

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEKK+KEELK KFEGLC V
Sbjct  154  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKKRKEELKEKFEGLCKV  213

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  214  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  273

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  274  EINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRMLKL  333

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  334  GLSIDEDEPVEAEAEMPQLEDDAGESKMEEVD  365



>gb|KJB13948.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=594

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  381  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  440

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  441  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  500

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  501  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  560

Query  204  GLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI ++     AD +MP LED D EGSKMEEVD
Sbjct  561  GLSIDEDAGDADADADMPPLEDADGEGSKMEEVD  594



>ref|XP_011097724.1| PREDICTED: heat shock cognate protein 80-like [Sesamum indicum]
Length=699

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 207/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ ADV+MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDAGE-ADVDMPPLEDADADAEGSKMEEVD  699



>ref|NP_001274833.1| Hsp90-2-like [Solanum tuberosum]
 gb|ABB55365.1| Hsp90-2-like [Solanum tuberosum]
Length=700

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 196/216 (91%), Gaps = 5/216 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEG  L   +DEKKK+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGSSLMRVKDEKKKQEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  MKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDP-NTFGNRIHRMLK  208
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETA LTSGFSL++P +   NRIHRMLK
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETAFLTSGFSLEEPKHLLANRIHRMLK  665

Query  207  LGLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            LGLSIDE++GD  D +MPALED   DAEGSKMEEVD
Sbjct  666  LGLSIDEESGD-VDADMPALEDPEADAEGSKMEEVD  700



>gb|AGA62462.1| heat shock protein 90 [Gossypium hirsutum]
Length=699

 Score =   295 bits (755),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 206/214 (96%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  666  GLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  699



>gb|KJB22185.1| hypothetical protein B456_004G034000 [Gossypium raimondii]
Length=666

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 206/214 (96%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  453  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  512

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  513  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  572

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  573  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  632

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDEDAG+A AD +MP LED DAEGSKMEEVD
Sbjct  633  GLSIDEDAGEAEADADMPPLEDADAEGSKMEEVD  666



>gb|KHG22758.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRAD DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADTDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI ++     AD +MP LED DAEGSKMEEVD
Sbjct  666  GLSIDEDAGDADADADMPPLEDADAEGSKMEEVD  699



>gb|KHN23824.1| Heat shock cognate protein 80 [Glycine soja]
Length=695

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 206/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  482  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKDKFEGLCHV  541

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  542  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  601

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  602  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  661

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ AD +MP LED   DAEGSKMEEVD
Sbjct  662  GLSIDEDAGE-ADADMPPLEDADADAEGSKMEEVD  695



>ref|XP_011089536.1| PREDICTED: heat shock cognate protein 80 [Sesamum indicum]
Length=699

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 208/215 (97%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELKAKFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKAKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ ADV+MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDAGE-ADVDMPPLEDADADAEGSKMEEVD  699



>gb|KJB13949.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=699

 Score =   295 bits (754),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI ++     AD +MP LED D EGSKMEEVD
Sbjct  666  GLSIDEDAGDADADADMPPLEDADGEGSKMEEVD  699



>gb|EEC84770.1| hypothetical protein OsI_31800 [Oryza sativa Indica Group]
Length=243

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK++EELK KFEGLC V
Sbjct  32   GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKV  91

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  92   IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  151

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKL
Sbjct  152  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKL  211

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  212  GLSIDEDESAEADADMPPLEDDAGESKMEEVD  243



>ref|XP_003544594.1| PREDICTED: heat shock cognate protein 80-like [Glycine max]
Length=700

 Score =   294 bits (753),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 206/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKDKFEGLCHV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ AD +MP LED   DAEGSKMEEVD
Sbjct  667  GLSIDEDAGE-ADADMPPLEDADADAEGSKMEEVD  700



>gb|AAN61003.1| putative heat shock protein 90 [Arabidopsis thaliana]
 gb|AAN64168.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=526

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  313  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  372

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  373  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  432

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  433  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  492

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  493  GLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  526



>ref|XP_008811147.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=701

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEY++GQLKEF+GKKLVSATKEGLKLDESEDEK KKE LK KFEGLC V
Sbjct  488  GYEVLFMVDAIDEYSVGQLKEFEGKKLVSATKEGLKLDESEDEKNKKEALKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKDVLGDKVEKVMVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KR++ DKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRMLKL
Sbjct  608  EINPENPIMEELRKRSEVDKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKL  667

Query  204  GLSIDE-DAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDE DA   AD +MP+LED +AEGSKMEEVD
Sbjct  668  GLSIDEDDATGDADTDMPSLEDAEAEGSKMEEVD  701



>gb|ABV89643.1| heat shock protein 81-4 [Brassica rapa]
Length=613

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEELK KFEGLC V
Sbjct  400  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEELKEKFEGLCKV  459

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  460  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  519

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  520  EINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  579

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  580  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  613



>gb|AAN31859.1| putative heat shock protein 81-2 (HSP81-2) [Arabidopsis thaliana]
Length=699

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  486  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_009132342.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=698

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL ESEDEKKKKEELK KFEGLC V
Sbjct  485  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLGESEDEKKKKEELKEKFEGLCKV  544

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  545  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  604

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  605  EINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  664

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  665  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  698



>ref|NP_001236599.1| heat shock protein 90-2 [Glycine max]
 gb|ACI31551.1| heat shock protein 90-2 [Glycine max]
Length=700

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 206/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G+EV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  487  GFEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCHV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ AD +MP LED   DAEGSKMEEVD
Sbjct  667  GLSIDEDAGE-ADADMPPLEDADADAEGSKMEEVD  700



>gb|KDP32613.1| hypothetical protein JCGZ_13163 [Jatropha curcas]
Length=699

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLK+DESEDEKK+KEE K KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKIDESEDEKKRKEEQKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+  D +MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDAGE-GDADMPALEDADVDAEGSKMEEVD  699



>ref|XP_006452664.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|AFF58923.1| Hsp90 [Citrus sinensis]
 gb|ESR65904.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|KDO59214.1| hypothetical protein CISIN_1g045760mg [Citrus sinensis]
Length=700

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKETLKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  547  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALE---DDAEGSKMEEVD  109
            GLSI+EDAGD AD +MP LE   DDAEGSKMEEVD
Sbjct  667  GLSIEEDAGD-ADADMPPLEDAADDAEGSKMEEVD  700



>ref|XP_010675973.1| PREDICTED: heat shock cognate protein 80 [Beta vulgaris subsp. 
vulgaris]
Length=698

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK EE K KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKSEESKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  MKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLL ETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLHETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSID+DA    DV+MPALE+ DAE SKMEEVD
Sbjct  666  GLSIDDDAAGEVDVDMPALEEADAEESKMEEVD  698



>gb|AGT98548.1| heat shock protein 90, partial [Paeonia lactiflora]
Length=302

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 200/215 (93%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDE+A+GQLKEF+GKKLVSATKEGLK DESEDEKKK E LK KFEGLC V
Sbjct  88   GIEVLYMVDAIDEHAVGQLKEFEGKKLVSATKEGLKFDESEDEKKKSEALKEKFEGLCKV  147

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  148  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  207

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL +RA+ADKNDKSVKDLV+LLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  208  EINPENSIMEELRERAEADKNDKSVKDLVVLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  267

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+  D +MPALE+   DA+GSKMEEVD
Sbjct  268  GLSIDEDAGEGDDADMPALEEADVDADGSKMEEVD  302



>gb|KJB22184.1| hypothetical protein B456_004G033900 [Gossypium raimondii]
Length=699

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 205/214 (96%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADA+KNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADAEKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDEDAG+  AD +MP LED DAEGSKMEEVD
Sbjct  666  GLSIDEDAGEGEADADMPPLEDADAEGSKMEEVD  699



>ref|NP_001240230.1| uncharacterized protein LOC100819568 [Glycine max]
 gb|ADC45396.1| HSP90-2 [Glycine max]
 gb|KHN01774.1| Heat shock cognate protein 80 [Glycine soja]
Length=699

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KF+ LC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFDNLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ AD EMP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDEDAGE-ADAEMPPLEEAEADAEGSKMEEVD  699



>ref|XP_009132345.1| PREDICTED: heat shock protein 90-2 [Brassica rapa]
Length=699

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_010252844.1| PREDICTED: heat shock cognate protein 80-like [Nelumbo nucifera]
Length=699

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 205/214 (96%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDE+ G+A AD +MP LED DAEGSKMEEVD
Sbjct  666  GLSIDEEGGEADADTDMPPLEDADAEGSKMEEVD  699



>ref|NP_001275844.1| HSP90 protein [Citrus sinensis]
 gb|AFF58924.1| Hsp90 [Citrus sinensis]
Length=700

 Score =   291 bits (746),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK KE LK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  547  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVK LVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENPIMEELRKRADADKNDKSVKGLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALE---DDAEGSKMEEVD  109
            GLSI+EDAGD AD +MP LE   DDAEGSKMEEVD
Sbjct  667  GLSIEEDAGD-ADADMPPLEDAADDAEGSKMEEVD  700



>dbj|BAO20259.1| heat shock protein [Brassica rapa subsp. chinensis]
Length=699

 Score =   291 bits (745),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENAIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_009758556.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 206/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY IGQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYCIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_009594054.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY IGQLKEF+GKKLVSATKEGLKLDESEDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYCIGQLKEFEGKKLVSATKEGLKLDESEDEKKKNEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_009785111.1| PREDICTED: heat shock cognate protein 80 [Nicotiana sylvestris]
Length=699

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 207/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>ref|NP_200414.1| heat shock protein 81-2 [Arabidopsis thaliana]
 sp|P55737.1|HS902_ARATH RecName: Full=Heat shock protein 90-2; Short=AtHSP90.2; AltName: 
Full=Heat shock protein 81-2; Short=HSP81-2; AltName: Full=Protein 
EARLY-RESPONSIVE TO DEHYDRATION 8; AltName: Full=Protein 
LOSS OF RECOGNITION OF AVRRPM1 2 [Arabidopsis thaliana]
 dbj|BAB09285.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAL32828.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAM91205.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AAN71943.1| putative heat-shock protein HSP81-2 [Arabidopsis thaliana]
 gb|AAO00895.1| Unknown protein [Arabidopsis thaliana]
 gb|AED96711.1| heat shock protein 81-2 [Arabidopsis thaliana]
 prf||1908431B heat shock protein HSP81-2
Length=699

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  486  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>gb|AGU99972.1| HSP90 [Populus tomentosa]
Length=699

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKL+E+EDEK+K+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEETEDEKQKQEELKQKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA + AD EMP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDEDAVE-ADAEMPPLEEADADAEGSKMEEVD  699



>ref|XP_003574727.1| PREDICTED: heat shock protein 81-1 [Brachypodium distachyon]
Length=699

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 200/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLKL++SEDEKK+KEELK KFEGLC V
Sbjct  487  GYEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEDSEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  547  IKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRAD DKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  607  EINPENAIMEELRKRADDDKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  666

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++A DA D +MPALEDDA  SKMEEVD
Sbjct  667  GLSIDEDEAADADDTDMPALEDDAGESKMEEVD  699



>gb|KCW70450.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=518

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE++GKKLVSATKEGLKLDESEDEKKK EELKAKFEGLC V
Sbjct  305  GYEVLYMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDESEDEKKKSEELKAKFEGLCKV  364

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  365  VKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  424

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  425  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  484

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA D  D +MP LED   +AEGSKMEEVD
Sbjct  485  GLSIDEDAPD-GDADMPPLEDAEVEAEGSKMEEVD  518



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 5/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DESE+EKKKKEE KA FE LC 
Sbjct  138  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDESEEEKKKKEEKKASFENLCK  197

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KDVLGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM  YMSSKKT
Sbjct  198  VIKDVLGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGAYMSSKKT  257

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRMLK
Sbjct  258  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLK  317

Query  207  LGLSIDE-DAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSI+E DAG+ AD  MPALE+D AE SKMEEVD
Sbjct  318  LGLSIEEDDAGEDAD--MPALEEDTAEESKMEEVD  350



>ref|XP_004516872.1| PREDICTED: heat shock protein 83-like [Cicer arietinum]
Length=699

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfeg-LCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD+  +E+KKK+E K K    LC 
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFEDLCR  545

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  546  VIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  605

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLK
Sbjct  606  MEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLK  665

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  666  LGLSIDEDETGGDDVDMPPLEEDGAEESKMEEVD  699



>emb|CAA67191.1| HSP80-2 [Triticum aestivum]
Length=700

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  488  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGE GWT NMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVIVSDRVVDSPCCLVTGENGWTPNMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADK+DKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELPKRADADKSDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDE-DAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE D     D +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDDEAPENDTDMPPLEDDAGESKMEEVD  700



>ref|NP_001190553.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AED96712.1| heat shock protein 81-2 [Arabidopsis thaliana]
Length=728

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 201/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  515  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  574

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  575  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  634

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  635  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  694

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  695  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  728



>gb|ADU04386.1| heat shock protein 90-1 [Nicotiana attenuata]
Length=699

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 207/215 (96%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KR+DADKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRSDADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED+GD ADV+MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDSGD-ADVDMPALEDPEADAEGSKMEEVD  699



>gb|AGB76029.1| heat shock protein 90 [Salicornia europaea]
Length=696

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 205/213 (96%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK EE KAKFEGLC V
Sbjct  485  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKSEESKAKFEGLCKV  544

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  545  VKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTM  604

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLL+ETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  605  EINPENPIMEELRKRADADKNDKSVKDLVLLLYETALLTSGFSLDEPNTFGNRIHRMLKL  664

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSID+DAG+  DV+MPALE+ D EGSKMEEVD
Sbjct  665  GLSIDDDAGE-VDVDMPALEEADTEGSKMEEVD  696



>tpg|DAA61993.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=429

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEKK+KEELK KFEGLC +
Sbjct  218  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKKRKEELKEKFEGLCKI  277

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  278  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  337

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG RIHRMLKL
Sbjct  338  EINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGTRIHRMLKL  397

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  398  GLSIDEDKSAEAEAEMPPLEDDAGESKMEEVD  429



>ref|NP_200412.1| Heat shock protein 90-3 [Arabidopsis thaliana]
 sp|P51818.2|HS903_ARATH RecName: Full=Heat shock protein 90-3; Short=AtHSP90.3; AltName: 
Full=HSP81.2; AltName: Full=Heat shock protein 81-3; Short=HSP81-3 
[Arabidopsis thaliana]
 dbj|BAB09283.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL32910.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL91191.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AED96709.1| heat shock protein 81-3 [Arabidopsis thaliana]
Length=699

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  486  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  699



>gb|AAL49788.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=699

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  486  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  699



>ref|XP_010934626.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
 ref|XP_010934627.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=702

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 194/213 (91%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLK+DESEDEKK+KEE KA FE LC V
Sbjct  490  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKIDESEDEKKRKEEKKAAFESLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQAL+D+SM  YMSSKKTM
Sbjct  550  MKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALKDNSMGSYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEE+ KRA+ADKNDKSVKDLVLLLFETA+LTSGFSLDDPNTF  RIHRMLKL
Sbjct  610  EINPENGIMEEMRKRAEADKNDKSVKDLVLLLFETAILTSGFSLDDPNTFAGRIHRMLKL  669

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GLSIDED     D +MPALE+D  E SKMEEVD
Sbjct  670  GLSIDEDEAAGDDTDMPALEEDGNEESKMEEVD  702



>ref|XP_007020406.1| Heat shock protein 81.4 [Theobroma cacao]
 gb|EOY11931.1| Heat shock protein 81.4 [Theobroma cacao]
Length=699

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDES+DEKKKKE LK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESDDEKKKKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ AD +MP LED   +AEGSKMEEVD
Sbjct  666  GLSIDEDAGE-ADADMPPLEDADAEAEGSKMEEVD  699



>ref|XP_008218765.1| PREDICTED: heat shock protein 90-2 [Prunus mume]
Length=699

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDE KKKEELK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEAKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+DA D  D EMP LED   DAEGSKMEEVD
Sbjct  666  GLSIDDDAVD-GDAEMPPLEDADADAEGSKMEEVD  699



>ref|XP_007208337.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
 gb|EMJ09536.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
Length=699

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDE KKKEELK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEAKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+DA D  D EMP LED   DAEGSKMEEVD
Sbjct  666  GLSIDDDAVD-GDAEMPPLEDADADAEGSKMEEVD  699



>ref|XP_011039800.1| PREDICTED: heat shock protein 90-2 [Populus euphratica]
Length=699

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEK+K+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKQKQEELKQKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA + AD EMP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDEDAVE-ADAEMPPLEEADADAEGSKMEEVD  699



>ref|XP_002299048.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
 gb|EEE83853.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
Length=699

 Score =   289 bits (739),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKL+E+EDEK+K+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEETEDEKQKQEELKQKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA + AD EMP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDEDAVE-ADAEMPPLEEAEADAEGSKMEEVD  699



>ref|XP_002532177.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30214.1| heat shock protein, putative [Ricinus communis]
Length=698

 Score =   289 bits (739),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLK+DESEDEK+KKE+LK KFEGLC V
Sbjct  485  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKIDESEDEKQKKEQLKEKFEGLCKV  544

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRD+SMAGYMSSKKTM
Sbjct  545  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDNSMAGYMSSKKTM  604

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  605  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  664

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+  D +MP LED   DAEGSKMEEVD
Sbjct  665  GLSIDEDAGE-GDGDMPPLEDAEVDAEGSKMEEVD  698



>gb|EYU31897.1| hypothetical protein MIMGU_mgv1a002208mg [Erythranthe guttata]
Length=701

 Score =   289 bits (739),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 200/215 (93%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKQKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+ SS  GYM+SKKTM
Sbjct  547  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKGSSAGGYMASKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRAD+DKNDKSVKDLVLLLFETALLTSGFSL++PNTFGNRI RMLKL
Sbjct  607  EINPENSIMDELRKRADSDKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIFRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+D G  AD++MP LE+   DA+GSKMEEVD
Sbjct  667  GLSIDDDEGGDADLDMPELEEVVADADGSKMEEVD  701



>ref|XP_006352548.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   288 bits (738),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY IGQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYCIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA D  DV+MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDASD-VDVDMPALEDPEADAEGSKMEEVD  699



>ref|XP_009362097.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDE KKKEELK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEAKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+DA +  D EMP LED   DAEGSKMEEVD
Sbjct  666  GLSIDDDAVE-GDAEMPPLEDADADAEGSKMEEVD  699



>ref|XP_009367265.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDE KKKEELK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEAKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+DA +  D EMP LED   DAEGSKMEEVD
Sbjct  666  GLSIDDDAVE-GDAEMPPLEDVDADAEGSKMEEVD  699



>emb|CDP13679.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 192/212 (91%), Gaps = 16/212 (8%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKETLKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLS   DA             DAEGSKMEEVD
Sbjct  666  GLS---DA-------------DAEGSKMEEVD  681



>ref|XP_002273244.1| PREDICTED: heat shock cognate protein 80-like [Vitis vinifera]
Length=704

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK++E LK KFEGLC V
Sbjct  491  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKQQEALKEKFEGLCKV  550

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLG+RVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  551  MKDVLGERVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  610

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KR D DKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  611  EINPENPIMEELRKRTDVDKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  670

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GL+IDE+AGD  DV+MP LE+   +AEGSKMEEVD
Sbjct  671  GLNIDEEAGD-VDVDMPPLEEADAEAEGSKMEEVD  704



>gb|ABB84343.1| heat shock protein 90 [Triticum aestivum]
Length=659

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEVIYMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKK+EELK KFEGLC V
Sbjct  452  GYEVIYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEELKEKFEGLCKV  511

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  512  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  571

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  572  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  631

Query  204  GLSIDE-DAGDAADVEMPALEDDA  136
            GLSIDE D     D +MP LEDDA
Sbjct  632  GLSIDEDDEAPENDTDMPPLEDDA  655



>ref|XP_006344905.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKL+E+EDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLEETEDEKKKHEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED+GD A+ +MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDSGD-AEADMPALEDPEVDAEGSKMEEVD  699



>gb|EMS59444.1| Heat shock protein 81-3 [Triticum urartu]
Length=700

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 203/213 (95%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKL+SATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  490  GYEVLYMVDAIDEYAVGQLKEFEGKKLLSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  550  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  610  EINPENPIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  669

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  670  GLSIDEDEIVDADADMPSLEDADAEGSKMEEVD  702



>gb|ADF31758.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31767.1| heat shock protein 90 [Triticum aestivum]
Length=700

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>gb|KCW70451.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=619

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE++GKKLVSATKEGLKLDESEDEKKK EELKAKFEGLC V
Sbjct  406  GYEVLYMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDESEDEKKKSEELKAKFEGLCKV  465

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  466  VKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  525

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  526  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  585

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA D  D +MP LED   +AEGSKMEEVD
Sbjct  586  GLSIDEDAPD-GDADMPPLEDAEVEAEGSKMEEVD  619



>ref|XP_008384610.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=720

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDE KKKEELK KFEGLC V
Sbjct  507  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDETKKKEELKEKFEGLCKV  566

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  567  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  626

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  627  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRMLKL  686

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+DA +  D EMP LED   DAEGSKMEEVD
Sbjct  687  GLSIDDDAVE-GDAEMPPLEDADADAEGSKMEEVD  720



>ref|NP_001234436.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
 gb|AAR12195.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
Length=699

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKL+E+EDEKKK+EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLEETEDEKKKQEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED GD A+ +MPALED   DAEGSKMEEVD
Sbjct  666  GLSIDEDGGD-AEADMPALEDPEADAEGSKMEEVD  699



>gb|ADF31773.1| heat shock protein 90 [Triticum urartu]
Length=700

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 198/213 (93%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_002307846.1| HSP80 family protein [Populus trichocarpa]
 gb|ABK95597.1| unknown [Populus trichocarpa]
 gb|EEE91369.1| HSP80 family protein [Populus trichocarpa]
Length=699

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 203/213 (95%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLK+DE+EDEKKK EE K KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKIDETEDEKKKSEESKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  548  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDNSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  608  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GLSIDED+GD AD +MP LED A EGSKMEEVD
Sbjct  668  GLSIDEDSGD-ADTDMPPLEDAAEEGSKMEEVD  699



>ref|XP_011005759.1| PREDICTED: heat shock cognate protein 80-like [Populus euphratica]
Length=699

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 203/213 (95%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLK+DE+EDEKKK EE K KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKIDETEDEKKKSEESKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  548  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDNSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  608  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GLSIDED+GD AD +MP LED A EGSKMEEVD
Sbjct  668  GLSIDEDSGD-ADTDMPPLEDAAEEGSKMEEVD  699



>gb|ABW96308.1| heat shock protein 90 [Vitis pseudoreticulata]
Length=699

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 188/215 (87%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK++E LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKQQEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLG+RVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  MKDVLGERVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KR + DKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRTEVDKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GL+IDE+AGD  DV+MP LE+   +AEGSKMEEVD
Sbjct  666  GLNIDEEAGD-VDVDMPPLEEADAEAEGSKMEEVD  699



>dbj|BAJ34368.1| unnamed protein product [Thellungiella halophila]
Length=705

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 191/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MPALE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPALEEDAAEESKMEEVD  705



>gb|AAD11549.1| heat shock protein 80 [Triticum aestivum]
Length=700

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 197/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFE +LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFENSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_009791186.1| PREDICTED: heat shock protein 83-like, partial [Nicotiana sylvestris]
Length=658

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKE+DGKKLVSATKEGL+L+E+E+EK+KK+E K  FE LC V
Sbjct  446  GYEVLYMVDAIDEYAIGQLKEYDGKKLVSATKEGLELEETEEEKQKKKEKKKSFENLCKV  505

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  506  IKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTM  565

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRA+ DKNDKSVKDLVLLL+ETALLTSGFSLDDPN F  RIHRMLKL
Sbjct  566  EINPDNGIMEELRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNAFAARIHRMLKL  625

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GLS++ED     D EMP LE++  E SKMEEVD
Sbjct  626  GLSVEEDEASGDDTEMPVLEEEGIEESKMEEVD  658



>ref|XP_003533977.1| PREDICTED: heat shock protein 83-like [Glycine max]
 gb|KHN42443.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 193/214 (90%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  F+ LC 
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFDELCK  545

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  546  VIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSGYMSSKKT  605

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLK
Sbjct  606  MEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLK  665

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  666  LGLSIDEDDNGGDDVDMPPLEEDGAEESKMEEVD  699



>gb|KEH26332.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfeg-LCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD+  +E+KKK+E K K    LC 
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFEDLCR  545

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            VMK++LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSMAGYMSSKKT
Sbjct  546  VMKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKT  605

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KR++ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  606  MEINPDNGIMEELRKRSEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFAGRIHRMLK  665

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED   A DV+MP LE+D AE SKMEEVD
Sbjct  666  LGLSIDEDETGADDVDMPPLEEDGAEESKMEEVD  699



>ref|XP_006401798.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
 gb|ESQ43251.1| hypothetical protein EUTSA_v10012817mg [Eutrema salsugineum]
Length=707

 Score =   287 bits (735),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 191/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  494  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCK  553

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  554  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  613

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  614  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  673

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MPALE+D AE SKMEEVD
Sbjct  674  LGLSIDEDENVEEDGDMPALEEDAAEESKMEEVD  707



>ref|XP_002866122.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42381.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 199/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+   YMSSKKTM
Sbjct  546  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNTGSYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD  699



>ref|XP_006373573.1| HSP80 family protein [Populus trichocarpa]
 gb|ERP51370.1| HSP80 family protein [Populus trichocarpa]
Length=698

 Score =   286 bits (733),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 204/214 (95%), Gaps = 3/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YM+DAIDEYA+GQLKEF+GKKLVSATKEGLK+DE+EDEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMIDAIDEYAVGQLKEFEGKKLVSATKEGLKIDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETA+LTSGFSLDDPNTFG+RIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETAMLTSGFSLDDPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALE--DDAEGSKMEEVD  109
            GLSIDED+ D AD +MP LE  DDAEGSKMEEVD
Sbjct  666  GLSIDEDSAD-ADTDMPPLEDADDAEGSKMEEVD  698



>ref|XP_011040123.1| PREDICTED: heat shock protein 81-1 [Populus euphratica]
Length=698

 Score =   286 bits (733),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 204/214 (95%), Gaps = 3/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YM+DAIDEYA+GQLKEF+GKKLVSATKEGLK+DE+EDEKK+KEELK KFEGLC V
Sbjct  486  GYEVLYMIDAIDEYAVGQLKEFEGKKLVSATKEGLKIDETEDEKKRKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGW+ANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALE--DDAEGSKMEEVD  109
            GLSIDED+ D AD +MP LE  DDAEGSKMEEVD
Sbjct  666  GLSIDEDSAD-ADTDMPPLEDADDAEGSKMEEVD  698



>gb|ADU04387.1| heat shock protein 90-2 [Nicotiana attenuata]
Length=699

 Score =   286 bits (733),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY++GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSVGQLKEFEGKKLVSATKEGLKLDESEDEKKKHEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED+GD A+ +MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDSGD-AEADMPPLEDPEADAEGSKMEEVD  699



>ref|XP_002864424.1| heat shock protein 81-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40683.1| heat shock protein 81-3 [Arabidopsis lyrata subsp. lyrata]
Length=685

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+E+EDEKKKKEELK KFEGLC V
Sbjct  472  GIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEETEDEKKKKEELKEKFEGLCKV  531

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  532  IKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  591

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  592  EINPENSIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  651

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD EMP LE+  DAEGSKMEEVD
Sbjct  652  GLSIDDDDAVEADAEMPPLEEDADAEGSKMEEVD  685



>ref|XP_010276895.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=701

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD+  +EKKKKEE    FE LC  
Sbjct  489  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDESEEKKKKEEKNKSFESLCKT  548

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM+GYMSSKKTM
Sbjct  549  IKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMSGYMSSKKTM  608

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKL
Sbjct  609  EINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKL  668

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GLSIDE+   A D +MP LEDD  E SKMEEVD
Sbjct  669  GLSIDEEETAADDTDMPPLEDDGNEESKMEEVD  701



>ref|XP_008670278.1| PREDICTED: heat shock protein 81-1-like [Zea mays]
 tpg|DAA40366.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=698

 Score =   286 bits (732),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 201/212 (95%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEKK+KEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDEPVEAEAEMPQLEDDAGESKMEEVD  698



>ref|XP_010913223.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   286 bits (732),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 203/213 (95%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++M+DAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  488  GYEVLFMIDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSL+DPNTFGNRIHRMLKL
Sbjct  608  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFGNRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  668  GLSIDEDETVDADTDMPSLEDADAEGSKMEEVD  700



>ref|XP_008776162.1| PREDICTED: heat shock protein 81-1 [Phoenix dactylifera]
Length=700

 Score =   286 bits (732),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYE+++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESE EKKKKE LK KFEGLC V
Sbjct  488  GYEILFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEHEKKKKEALKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSD VVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDHVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRA+ADKNDKSVKDLVLLLF+T+LLTSGFSL+DPNTFGNRIHRMLKL
Sbjct  608  EINPENPIMEELRKRAEADKNDKSVKDLVLLLFDTSLLTSGFSLEDPNTFGNRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  668  GLSIDEDETVDADTDMPSLEDADAEGSKMEEVD  700



>ref|XP_004135593.1| PREDICTED: heat shock cognate protein 80-like [Cucumis sativus]
Length=699

 Score =   286 bits (732),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE L  KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEALVEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQAL+D+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALKDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDE++G+  D EMP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEESGE-GDSEMPPLEDADADAEGSKMEEVD  699



>gb|AIZ68152.1| heat shock protein 81-1 [Ornithogalum saundersiae]
Length=700

 Score =   286 bits (732),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEE K KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEEQKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  IKEVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLVLLLFET+LLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVLLLFETSLLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDED   A AD +MP LED DAEGSKMEEVD
Sbjct  667  GLSIDEDETVADADTDMPPLEDADAEGSKMEEVD  700



>gb|ADF31759.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31768.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31776.1| heat shock protein 90 [Aegilops tauschii]
 gb|EMT03701.1| Heat shock protein 81-3 [Aegilops tauschii]
Length=700

 Score =   286 bits (732),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 197/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRAD DKNDKSVKDLV+LLFET+LLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADVDKNDKSVKDLVMLLFETSLLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_008811143.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=700

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 202/213 (95%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  488  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKKESLKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+MAGYMSSKKTM
Sbjct  548  VKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLF+TALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  608  EINPENPIMEELRKRADADKNDKSVKDLVLLLFDTALLTSGFSLDDPNTFGNRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDE     AD +MP+LED DAEGSKMEEVD
Sbjct  668  GLSIDEGETVDADADMPSLEDADAEGSKMEEVD  700



>emb|CAN70887.1| hypothetical protein VITISV_005592 [Vitis vinifera]
Length=690

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKE     DE+ +EKKKKEE K  FE LC 
Sbjct  477  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETXEEKKKKEEKKKSFESLCK  536

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VS+R+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  537  TIKDILGDKVEKVVVSERIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKT  596

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+NPIMEEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLK
Sbjct  597  MEINPDNPIMEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLK  656

Query  207  LGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            LGLSIDED     D EMP LE++  E SKMEEVD
Sbjct  657  LGLSIDEDEAGGDDTEMPPLEEEGNEESKMEEVD  690



>ref|XP_006599549.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=699

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfe-gLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD+  +E+KKK+E K K    LC 
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEDKKKSFDELCK  545

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+K++LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  546  VIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSGYMSSKKT  605

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLK
Sbjct  606  MEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLK  665

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  666  LGLSIDEDDNGGDDVDMPPLEEDGAEESKMEEVD  699



>gb|KHN09298.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfe-gLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD+  +E+KKK+E K K    LC 
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEDKKKSFDELCK  545

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+K++LGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  546  VIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSGYMSSKKT  605

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RIHRMLK
Sbjct  606  MEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRIHRMLK  665

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     DV+MP LE+D AE SKMEEVD
Sbjct  666  LGLSIDEDDNGGDDVDMPPLEEDGAEESKMEEVD  699



>ref|XP_010063241.1| PREDICTED: heat shock cognate protein 80-like [Eucalyptus grandis]
 gb|KCW70449.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=703

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE++GKKLVSATKEGLKLDESEDEKKK EELKAKFEGLC V
Sbjct  490  GYEVLYMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDESEDEKKKSEELKAKFEGLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  550  VKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  610  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  669

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA D  D +MP LED   +AEGSKMEEVD
Sbjct  670  GLSIDEDAPD-GDADMPPLEDAEVEAEGSKMEEVD  703



>ref|XP_002976693.1| hypothetical protein SELMODRAFT_151384 [Selaginella moellendorffii]
 gb|EFJ22362.1| hypothetical protein SELMODRAFT_151384 [Selaginella moellendorffii]
Length=704

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 204/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKEGLKL++++DEKKK EE KA FEGLC V
Sbjct  490  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDTDDEKKKFEEKKAAFEGLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  550  VKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  610  EINPDNTIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  669

Query  204  GLSIDED-AGDAADVEMPALE--DDAEGSKMEEVD  109
            GLSID+D +GDAADVEMP LE  +DAEGSKMEEVD
Sbjct  670  GLSIDDDVSGDAADVEMPPLEEGNDAEGSKMEEVD  704



>ref|XP_009763345.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY++GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSVGQLKEFEGKKLVSATKEGLKLDESEDEKKKHEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED GD A+ +MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDCGD-AEADMPPLEDPEADAEGSKMEEVD  699



>dbj|BAD73667.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD73668.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
Length=614

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  403  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  462

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  463  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  522

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  523  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  582

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  583  GLSIDEDETAEADTDMPPLEDDAGESKMEEVD  614



>ref|XP_002973159.1| hypothetical protein SELMODRAFT_271009 [Selaginella moellendorffii]
 gb|EFJ25533.1| hypothetical protein SELMODRAFT_271009 [Selaginella moellendorffii]
Length=705

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 204/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKEGLKL++++DEKKK EE KA FEGLC V
Sbjct  491  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDTDDEKKKFEEKKAAFEGLCKV  550

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  551  VKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTM  610

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  611  EINPDNSIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  670

Query  204  GLSIDED-AGDAADVEMPALE--DDAEGSKMEEVD  109
            GLSID+D +GDAADVEMP LE  +DAEGSKMEEVD
Sbjct  671  GLSIDDDVSGDAADVEMPPLEEGNDAEGSKMEEVD  705



>gb|ACX31585.1| molecular chaperone Hsp90-3 [Nicotiana benthamiana]
Length=700

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 193/216 (89%), Positives = 203/216 (94%), Gaps = 5/216 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY++GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSVGQLKEFEGKKLVSATKEGLKLDESEDEKKKHEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALE----DDAEGSKMEEVD  109
            GLSIDED GD A+ +MP LE    DDAEGSKMEEVD
Sbjct  666  GLSIDEDCGD-AEADMPPLEDTEADDAEGSKMEEVD  700



>gb|ADF31781.1| heat shock protein 90 [Triticum dicoccoides]
Length=700

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 197/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY+IGQLKEF+GKKLVSATKEGLKLD+SE+EKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDDSEEEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SM GYMSSKKTM
Sbjct  548  IKEVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMGGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFET+LLTSGF LDDPNTFG RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETSLLTSGFCLDDPNTFGTRIHRMLKL  667

Query  204  GLSI-DEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSI +++    AD +MP LE+DA  SKMEEVD
Sbjct  668  GLSIDEDEEAAEADTDMPPLEEDAGESKMEEVD  700



>ref|XP_010536759.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
 ref|XP_010536760.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 204/215 (95%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEE K KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEEQKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  606  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALEDD--AEGSKMEEVD  109
            GLSID++AG+   D +MP LEDD  AEGSKMEEVD
Sbjct  666  GLSIDDEAGETEGDADMPPLEDDAEAEGSKMEEVD  700



>emb|CAA72513.1| heat shock protein [Arabidopsis thaliana]
Length=699

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 199/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV+YMVDAID YAIGQLKEF+GKKLVSATKEGLKLDE+EDEKKKKEELK KFEGLC V
Sbjct  486  GIEVLYMVDAIDGYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  546  IKDLLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  606  EINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D    AD +MP LED  DAEGSKMEEVD
Sbjct  666  GLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD  699



>ref|XP_002278894.1| PREDICTED: heat shock protein 83 [Vitis vinifera]
Length=703

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  490  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFESLCK  549

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VS+R+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  550  TIKDILGDKVEKVVVSERIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKT  609

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+NPIMEEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLK
Sbjct  610  MEINPDNPIMEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGARIHRMLK  669

Query  207  LGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            LGLSIDED     D EMP LE++  E SKMEEVD
Sbjct  670  LGLSIDEDEAGGDDTEMPPLEEEGNEESKMEEVD  703



>ref|XP_003635036.1| PREDICTED: heat shock cognate protein 80 [Vitis vinifera]
Length=699

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 202/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK+E LK KFEGLC V
Sbjct  486  GIEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM+KL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMMKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED G  AD +MP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDED-GPEADTDMPPLEEADADAEGSKMEEVD  699



>ref|XP_002462554.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
 gb|EER99075.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
Length=699

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEKK+KEELK KF+GLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKKRKEELKEKFDGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRA+ADKNDKSVKDLV+LLFET+LLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENPIMDELRKRAEADKNDKSVKDLVMLLFETSLLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD EMP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDESAEADAEMPPLEDDAGESKMEEVD  699



>sp|A2YWQ1.1|HSP81_ORYSI RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Indica Group]
 sp|Q0J4P2.2|HSP81_ORYSJ RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Japonica Group]
 emb|CAA77978.1| heat shock protein 82 (HSP82) [Oryza sativa]
 dbj|BAD08818.1| heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD08897.1| heat shock protein 82 [Oryza sativa Japonica Group]
 gb|EAZ07512.1| hypothetical protein OsI_29768 [Oryza sativa Indica Group]
 gb|ADM86854.1| 82kDa heat shock protein [Oryza sativa Japonica Group]
Length=699

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDETAEADTDMPPLEDDAGESKMEEVD  699



>gb|AAR12194.1| molecular chaperone Hsp90-2 [Nicotiana benthamiana]
Length=699

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 203/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY++GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSVGQLKEFEGKKLVSATKEGLKLDESEDEKKKHEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDTSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED GD A+ +MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDCGD-AEADMPPLEDPEADAEGSKMEEVD  699



>ref|XP_006659551.1| PREDICTED: heat shock protein 81-1-like isoform X1 [Oryza brachyantha]
Length=699

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDETAEADTDMPPLEDDAGESKMEEVD  699



>ref|XP_006659552.1| PREDICTED: heat shock protein 81-1-like isoform X2 [Oryza brachyantha]
Length=699

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDETAEADTDMPPLEDDAGESKMEEVD  699



>ref|XP_008801780.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=703

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 196/215 (91%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL+ESEDEKKKKEE KA FE LC V
Sbjct  490  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEESEDEKKKKEEKKAAFESLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+ M+ YMSSKKTM
Sbjct  550  MKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNGMSSYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSL+DPNTF  RIHRMLKL
Sbjct  610  EINPENGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFAGRIHRMLKL  669

Query  204  GLSIDED--AGDAADVEMPALEDDA-EGSKMEEVD  109
            GLSIDED  AGD  D ++P LE+D  E SKMEEVD
Sbjct  670  GLSIDEDEAAGD-GDTDLPDLEEDGNEESKMEEVD  703



>ref|XP_008797179.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=701

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+ QLKE+DGKKLVSATKEGLKL++SE+EKKKKEE KA FE LC V
Sbjct  490  GYEVLFMVDAIDEYAVTQLKEYDGKKLVSATKEGLKLEDSEEEKKKKEEKKAAFEPLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDS+M+ YMSSKKTM
Sbjct  550  MKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSTMSAYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKL
Sbjct  610  EINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAGRIHRMLKL  669

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GL+IDED     D EMP LE+D  E SKMEEVD
Sbjct  670  GLNIDEDET-GEDAEMPTLEEDGNEESKMEEVD  701



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 200/214 (93%), Gaps = 4/214 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKL+ESEDEK+ KE  K KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEESEDEKQTKEAQKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEV  112
            GLSIDEDA +  D +MP LED   +AEGSKMEE+
Sbjct  666  GLSIDEDAVE-GDADMPPLEDADAEAEGSKMEEL  698



>emb|CAN62488.1| hypothetical protein VITISV_029391 [Vitis vinifera]
Length=699

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 201/215 (93%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK+E LK KFEGLC V
Sbjct  486  GIEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKQEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRM+KL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMMKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED G  AD  MP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDED-GPEADXXMPPLEEADADAEGSKMEEVD  699



>ref|XP_009607645.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 202/215 (94%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEY++GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYSVGQLKEFEGKKLVSATKEGLKLDESEDEKKKHEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDED GD  + +MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDCGD-GETDMPPLEDPEADAEGSKMEEVD  699



>emb|CDY27839.1| BnaC09g28660D [Brassica napus]
Length=705

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ DKNDKSVKDLV+LLFETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEVDKNDKSVKDLVMLLFETALLTSGFSLDEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MPALE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPALEEDAAEESKMEEVD  705



>ref|XP_009628903.1| PREDICTED: heat shock protein 83-like [Nicotiana tomentosiformis]
Length=703

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYAIGQLKE+DGKKLVSATKEGLKL+E+E+EK+KKEE K  FE LC V
Sbjct  491  GYEVLFMVDAIDEYAIGQLKEYDGKKLVSATKEGLKLEETEEEKQKKEEKKKSFENLCKV  550

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  551  IKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTM  610

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPN F  RIHRMLKL
Sbjct  611  EINPDNGIMEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNAFAARIHRMLKL  670

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI+ED     D EMP LE+   E SKMEEVD
Sbjct  671  GLSIEEDEASGDDTEMPVLEEVGKEESKMEEVD  703



>ref|XP_009417329.1| PREDICTED: heat shock protein 81-1 [Musa acuminata subsp. malaccensis]
Length=699

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KE LK KFEGLC V
Sbjct  488  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKETLKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  608  EINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED     D +MP LED DAE SKMEEVD
Sbjct  668  GLSIDEDE-KVEDTDMPTLEDADAEESKMEEVD  699



>ref|XP_008652859.1| PREDICTED: heat shock protein 81-1 [Zea mays]
 tpg|DAA61991.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDE+EDEKK+KEELK KFEGLC +
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDETEDEKKRKEELKEKFEGLCKI  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG RIHRMLKL
Sbjct  608  EINPENPIMDELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    A+ EMP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDKSAEAEAEMPPLEDDAGESKMEEVD  699



>ref|NP_001062159.1| Os08g0500700 [Oryza sativa Japonica Group]
 dbj|BAF24073.1| Os08g0500700, partial [Oryza sativa Japonica Group]
Length=694

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 190/212 (90%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  483  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  542

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  543  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  602

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  603  EINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  662

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  663  GLSIDEDETAEADTDMPPLEDDAGESKMEEVD  694



>ref|XP_010545291.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRAD DKNDKSVKDLV LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENPIMDELRKRADEDKNDKSVKDLVHLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALEDDAE--GSKMEEVD  109
            GLSID++AG+    +MP LEDDAE  GSKMEEVD
Sbjct  667  GLSIDDEAGETEADDMPPLEDDAEADGSKMEEVD  700



>ref|XP_004500151.1| PREDICTED: heat shock cognate protein 80-like [Cicer arietinum]
Length=699

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 205/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKL+E+EDEKKK+EELK KF+GLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEETEDEKKKQEELKEKFDGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADAD+NDKSVKDLVLLLFET+LLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMEELRKRADADRNDKSVKDLVLLLFETSLLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDAG+ A+ +MP LE+   DAEGSKMEEVD
Sbjct  666  GLSIDEDAGE-AEADMPPLEEADADAEGSKMEEVD  699



>ref|XP_004973824.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=698

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKK++EELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKRQEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDETPEADTDMPPLEDDAGESKMEEVD  698



>gb|ADF31754.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31763.1| heat shock protein 90 [Triticum aestivum]
Length=707

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 196/214 (92%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +E+E+EKK+KEE KA FEGLC 
Sbjct  494  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCK  553

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            ++KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  554  IIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  613

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  614  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  673

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  674  LGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  707



>ref|XP_002444804.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
 gb|EES14299.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
Length=698

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDEAPEADTDMPPLEDDAGESKMEEVD  698



>ref|XP_006659553.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=699

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  608  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDE+    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEEETAEADTDMPPLEDDAGESKMEEVD  699



>gb|ADC53691.1| heat shock protein 90-2 [Cryptocoryne ciliata]
Length=236

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 203/214 (95%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLK+F+GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  23   GYEVLFMVDAIDEYAVGQLKDFEGKKLVSATKEGLKLDESEDEKKKKETLKEKFEGLCKV  82

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  83   VKDILGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  142

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  143  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  202

Query  204  GLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI +EDA   AD +MP+LED D EGSKMEEVD
Sbjct  203  GLSIDEEDAPADADADMPSLEDADGEGSKMEEVD  236



>gb|KDP25390.1| hypothetical protein JCGZ_20546 [Jatropha curcas]
Length=706

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 193/214 (90%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+ QLKE+DGKKLVSATKEGL+L+E E+EKKKKEE K  FE LC  
Sbjct  493  GYEVLYMVDAIDEYAVTQLKEYDGKKLVSATKEGLQLEEPEEEKKKKEEKKKSFENLCKT  552

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSKK M
Sbjct  553  IKEVLGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKIM  612

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+NPIM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKL
Sbjct  613  EINPDNPIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKL  672

Query  204  GLSIDED-AGDAADVEMPALEDDA-EGSKMEEVD  109
            GL IDED +G+  D++MPALE+   E SKMEEVD
Sbjct  673  GLGIDEDESGEQEDIDMPALEEGGNEESKMEEVD  706



>ref|XP_004140753.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004157188.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 gb|KGN57413.1| hypothetical protein Csa_3G183950 [Cucumis sativus]
Length=703

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkld-esedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD E+E+EKKKKEE K  FE LC 
Sbjct  490  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCK  549

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSKKT
Sbjct  550  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGAYMSSKKT  609

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  610  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  669

Query  207  LGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            LGLSIDE+  +  D +MPALE+DA E SKMEEVD
Sbjct  670  LGLSIDEEENEGDDADMPALEEDATEESKMEEVD  703



>ref|XP_009390627.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 198/214 (93%), Gaps = 3/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDES+DEK +KE LK KFEGLC V
Sbjct  488  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESDDEKTRKEALKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  608  EINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED--DAEGSKMEEVD  109
            GLSIDED     D +MP LED  DAE SKMEEVD
Sbjct  668  GLSIDEDE-KVEDTDMPTLEDAADAEESKMEEVD  700



>gb|EYU25148.1| hypothetical protein MIMGU_mgv1a002213mg [Erythranthe guttata]
Length=700

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKAFESLCK  545

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  546  VIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGSYMSSKKT  605

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF +RIHRMLK
Sbjct  606  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFASRIHRMLK  665

Query  207  LGLSIDE-DAGDAADVEMPALEDDA-EGSKMEEVD  109
            LGLSIDE +     DVEMP LE++  E SKMEEVD
Sbjct  666  LGLSIDEVEEESGEDVEMPGLEEEGNEESKMEEVD  700



>gb|ADC53692.1| heat shock protein 90-1 [Cryptocoryne ciliata]
Length=254

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 203/214 (95%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLK+++GKKLVSATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  41   GYEVLFMVDAIDEYAVGQLKDYEGKKLVSATKEGLKLDESEDEKKKKETLKEKFEGLCKV  100

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIM+AQALRDSSMAGYMSSKKTM
Sbjct  101  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMRAQALRDSSMAGYMSSKKTM  160

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  161  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  220

Query  204  GLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI ++DA   AD +MP LED DAEGSKMEEVD
Sbjct  221  GLSIDEDDAPADADADMPTLEDADAEGSKMEEVD  254



>ref|XP_004308050.1| PREDICTED: heat shock protein 83-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkld-esedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD E+E+EK+KKEE K  FE LC 
Sbjct  488  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKQKKEEKKKSFENLCK  547

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGDR+EK +VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSKKT
Sbjct  548  TIKDILGDRIEKAVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGSYMSSKKT  607

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF +RI+RMLK
Sbjct  608  MEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFASRINRMLK  667

Query  207  LGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            LGLSIDED     D +MP LED AE SKMEEVD
Sbjct  668  LGLSIDEDEAAVEDADMPELEDAAEESKMEEVD  700



>ref|NP_001063500.1| Os09g0482100 [Oryza sativa Japonica Group]
 sp|Q69QQ6.1|HSP82_ORYSJ RecName: Full=Heat shock protein 81-2; Short=HSP81-2; AltName: 
Full=Heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD33406.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25414.1| Os09g0482100 [Oryza sativa Japonica Group]
Length=699

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK++EELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDESAEADADMPPLEDDAGESKMEEVD  699



>dbj|BAD04054.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|EAZ09522.1| hypothetical protein OsI_31797 [Oryza sativa Indica Group]
Length=699

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK++EELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDESAEADADMPPLEDDAGESKMEEVD  699



>ref|XP_009420064.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=698

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKL+SATKEGLKLDESEDEKK+ E LK KFEGLC V
Sbjct  487  GYEVLFMVDAIDEYAVGQLKEFEGKKLLSATKEGLKLDESEDEKKRTEVLKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDL LLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  607  EINPENPIMEELRKRADADKNDKSVKDLTLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED   A D +MP LE+ DAE SKMEEVD
Sbjct  667  GLSIDEDE-KAEDTDMPPLEEADAEESKMEEVD  698



>ref|NP_001063503.1| Os09g0482400 [Oryza sativa Japonica Group]
 ref|NP_001175894.1| Os09g0482610 [Oryza sativa Japonica Group]
 sp|Q07078.2|HSP83_ORYSJ RecName: Full=Heat shock protein 81-3; Short=HSP81-3; AltName: 
Full=Gravity-specific protein GSC 381 [Oryza sativa Japonica 
Group]
 dbj|BAD33409.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25417.1| Os09g0482400 [Oryza sativa Japonica Group]
 gb|ACJ54894.1| heat shock protein [Oryza sativa Japonica Group]
 dbj|BAG88166.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94622.1| Os09g0482610 [Oryza sativa Japonica Group]
Length=699

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK++EELK KFEGLC V
Sbjct  488  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IM+EL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTFG RIHRMLKL
Sbjct  608  EINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  668  GLSIDEDESAEADADMPPLEDDAGESKMEEVD  699



>dbj|BAA00615.1| 81kDa heat-shock protein [Arabidopsis thaliana]
Length=700

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  546

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  547  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  606

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  607  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  666

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  667  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  700



>prf||1908431A heat shock protein HSP81-1
Length=705

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>ref|NP_200076.1| heat shock protein 90.1 [Arabidopsis thaliana]
 dbj|BAA98082.1| heat-shock protein [Arabidopsis thaliana]
 gb|AAM91104.1| AT5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AAN46890.1| At5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AED96244.1| heat shock protein 90.1 [Arabidopsis thaliana]
Length=705

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>sp|P27323.3|HS901_ARATH RecName: Full=Heat shock protein 90-1; Short=AtHSP90.1; AltName: 
Full=Heat shock protein 81-1; Short=HSP81-1; AltName: Full=Heat 
shock protein 83 [Arabidopsis thaliana]
Length=700

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  546

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  547  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  606

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  607  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  666

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  667  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  700



>ref|XP_004974826.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=643

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDE+EDEKK++EELK KFEGLC V
Sbjct  432  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKRQEELKEKFEGLCKV  491

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  492  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  551

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLD+PNTFG+RIHRMLKL
Sbjct  552  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDEPNTFGSRIHRMLKL  611

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    A+ +MP LEDDA  SKMEEVD
Sbjct  612  GLSIDEDETTEAETDMPPLEDDAGESKMEEVD  643



>ref|XP_002864186.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40445.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGAMPELEEDAAEESKMEEVD  705



>gb|AAA32822.1| heat shock protein 83 [Arabidopsis thaliana]
Length=705

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 198/215 (92%), Gaps = 5/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkld-esedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD ESE+EKKKKEE KA FE LC 
Sbjct  491  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDESEEEKKKKEEKKASFENLCK  550

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KDVLGD+VEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRDSSM  YMSSKKT
Sbjct  551  VIKDVLGDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMGAYMSSKKT  610

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRMLK
Sbjct  611  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLK  670

Query  207  LGLSIDE-DAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSI+E DAG+ AD  MPALE+D AE SKMEEVD
Sbjct  671  LGLSIEEDDAGEDAD--MPALEEDVAEESKMEEVD  703



>gb|KCW79839.1| hypothetical protein EUGRSUZ_C01179 [Eucalyptus grandis]
Length=691

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 204/217 (94%), Gaps = 6/217 (3%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELKAKFE LC V
Sbjct  476  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKAEELKAKFEDLCKV  535

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  536  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  595

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  596  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  655

Query  204  GLSIDEDAGDAADVEMPALED-----DAEGSKMEEVD  109
            GLSIDEDAG+  D +MP LED     +AEGSKMEEVD
Sbjct  656  GLSIDEDAGE-GDADMPPLEDAEAEAEAEGSKMEEVD  691



>ref|XP_010047845.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like 
[Eucalyptus grandis]
Length=702

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 204/217 (94%), Gaps = 6/217 (3%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK EELKAKFE LC V
Sbjct  487  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKAEELKAKFEDLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  547  IKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALED-----DAEGSKMEEVD  109
            GLSIDEDAG+  D +MP LED     +AEGSKMEEVD
Sbjct  667  GLSIDEDAGE-GDADMPPLEDAEAEAEAEGSKMEEVD  702



>ref|XP_008439282.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=703

 Score =   281 bits (720),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE++GKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  490  GYEVLFMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDDETEEEKKKKEEKKKSFENLCK  549

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV++SDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSKKT
Sbjct  550  TIKDILGDKVEKVVISDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGAYMSSKKT  609

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  610  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  669

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDE+  +  D +MPALE+D AE SKMEEVD
Sbjct  670  LGLSIDEEENEGDDADMPALEEDAAEESKMEEVD  703



>gb|EMS66149.1| Heat shock protein 83 [Triticum urartu]
Length=658

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 195/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +E+E+EKK++EE KA FEGLC 
Sbjct  445  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRREEKKAAFEGLCK  504

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  505  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  564

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRMLK
Sbjct  565  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLK  624

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  625  LGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  658



>ref|NP_001170475.1| LOC100384473 [Zea mays]
 gb|ACO35045.1| heat shock protein 90 [Zea mays]
Length=697

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  546  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG RIHRMLKL
Sbjct  606  EINPDNAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGGRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  666  GLSIDEDEAPEADTDMPPLEDDAGESKMEEVD  697



>gb|ADF31772.1| heat shock protein 90 [Triticum urartu]
Length=712

 Score =   281 bits (718),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 195/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +E+E+EKK++EE KA FEGLC 
Sbjct  499  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRREEKKAAFEGLCK  558

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  559  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  618

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRMLK
Sbjct  619  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLK  678

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  679  LGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  712



>gb|ADF31778.1| heat shock protein 90 [Triticum dicoccoides]
Length=712

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 174/214 (81%), Positives = 195/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +E+E+EKK+KEE KA FEGLC 
Sbjct  499  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCK  558

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  559  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  618

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSL+DPNTF  RIHRMLK
Sbjct  619  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLK  678

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+   +  D +MPALE++ AE SKMEEVD
Sbjct  679  LGLNIDDQDAEEEDADMPALEEEGAEESKMEEVD  712



>gb|EMT27103.1| Heat shock protein 83 [Aegilops tauschii]
Length=679

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfeg-LCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLDE  +E+KK++E K      LC 
Sbjct  465  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCK  524

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  525  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  584

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  585  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  644

Query  207  LGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+ A  +  D +MPALE++ AE SKMEEVD
Sbjct  645  LGLNIDDQADAEEEDADMPALEEEGAEESKMEEVD  679



>ref|XP_010934628.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=701

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEY + QLKE+DGKKLVSATKEGLKL++SE+EKKKKEE KA FE LC V
Sbjct  490  GYEVLFMVDAIDEYVVTQLKEYDGKKLVSATKEGLKLEDSEEEKKKKEEKKAAFEPLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKD+LGDRVEKV+VS+R+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  550  MKDILGDRVEKVVVSERIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IM+EL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLDDPNTF  RIHRMLKL
Sbjct  610  EINPDNGIMDELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDDPNTFAGRIHRMLKL  669

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GL+IDE+     D EMPALE+D  E SKMEEVD
Sbjct  670  GLNIDEEET-GEDAEMPALEEDVNEESKMEEVD  701



>emb|CAA68885.1| heat shock protein 90A [Arabidopsis thaliana]
Length=704

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  491  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  550

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  551  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  610

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IME+L KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  611  MEINPDNGIMEDLRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  670

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  671  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  704



>ref|XP_010941080.1| PREDICTED: heat shock protein 83 [Elaeis guineensis]
Length=702

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL+ESEDEKKK+EE KA FE LC V
Sbjct  490  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEESEDEKKKREEKKAAFESLCKV  549

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  550  MKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTM  609

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN I+EEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG RIHRMLKL
Sbjct  610  EINPENGIIEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGGRIHRMLKL  669

Query  204  GLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            GLSIDED     D +MPALE+D  E SKMEEVD
Sbjct  670  GLSIDEDEAAGEDTDMPALEEDGNEESKMEEVD  702



>ref|XP_010445119.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=706

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYAIGQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  493  GYEVLYMVDAIDEYAIGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCK  552

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  553  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  612

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRMLK
Sbjct  613  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLK  672

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  673  LGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  706



>ref|XP_010482633.1| PREDICTED: heat shock protein 90-1 [Camelina sativa]
Length=705

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYAIGQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAIGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  705



>ref|XP_010913224.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 203/213 (95%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKL+SATKEGLKLDESEDEKKKKE LK KFEGLC V
Sbjct  488  GYEVLFMVDAIDEYAVGQLKEFEGKKLMSATKEGLKLDESEDEKKKKEALKEKFEGLCKV  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  548  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+NPIM+EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSL+DPNTFG+RIHRMLKL
Sbjct  608  EINPDNPIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFGSRIHRMLKL  667

Query  204  GLSIDEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSIDED    AD +MP+LED DAEGSKMEEVD
Sbjct  668  GLSIDEDETVDADTDMPSLEDADAEGSKMEEVD  700



>ref|XP_010442803.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=705

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYAIGQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAIGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  705



>gb|ADF31756.1| heat shock protein 90 [Triticum aestivum]
 gb|ADF31765.1| heat shock protein 90 [Triticum aestivum]
Length=713

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +E+E+EKK+KEE KA FEGLC 
Sbjct  499  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCK  558

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  559  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  618

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  619  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  678

Query  207  LGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+ A  +  D +MPALE++ AE SKMEEVD
Sbjct  679  LGLNIDDQADAEEEDADMPALEEEGAEESKMEEVD  713



>gb|AAD30456.1|AF123259_1 heat shock protein 90 [Solanum lycopersicum]
Length=406

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYAIGQLKE+DGKKLVS TKE     DESE+EKKKKEE K  FE LC 
Sbjct  193  GYEVLFMVDAIDEYAIGQLKEYDGKKLVSVTKEGLKLDDESEEEKKKKEEKKQSFESLCK  252

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQAL+D+SM+ YMSS+KT
Sbjct  253  VIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALKDNSMSSYMSSEKT  312

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N I+EEL KRA+ DKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  313  MEINPDNGIVEELRKRAEVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLK  372

Query  207  LGLSIDEDAGDAADV-EMPALEDDAEGSKMEEVD  109
            LGLSIDE+     DV +MP LED  E SKMEEVD
Sbjct  373  LGLSIDEEEEAGVDVDDMPPLEDVGEESKMEEVD  406



>gb|AGC60019.1| heat shock protein 90 [Saccharum hybrid cultivar SP80-3280]
Length=698

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+ IHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSPIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    AD +MP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDEAPEADTDMPPLEDDAGESKMEEVD  698



>gb|ADF31775.1| heat shock protein 90 [Aegilops tauschii]
Length=713

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +E+E+EKK+KEE KA FEGLC 
Sbjct  499  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCK  558

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  559  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  618

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  619  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  678

Query  207  LGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+ A  +  D +MPALE++ AE SKMEEVD
Sbjct  679  LGLNIDDQADAEEEDADMPALEEEGAEESKMEEVD  713



>ref|XP_006280097.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
 gb|EOA12995.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
Length=705

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYAIGQLKE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAIGQLKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D  MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGGMPELEEDAAEESKMEEVD  705



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKE     ++ E+ KK++EE K +FE LC 
Sbjct  496  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEDDEEAKKRREERKKQFEDLCK  555

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+K++LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YM+SKKT
Sbjct  556  VIKEILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMASKKT  615

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+AD+NDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  616  MEINPDNGIMEELRKRAEADRNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLK  675

Query  207  LGLSIDEDAGDAADVEMPAL-EDDAEGSKMEEVD  109
            LGL+IDE+A    D +MPAL E  AE SKMEEVD
Sbjct  676  LGLNIDEEAAPEDDADMPALDEGAAEESKMEEVD  709



>gb|ADP89125.1| heat shock protein 90 [Cenchrus americanus]
 gb|ADP89126.1| heat shock protein 90 [Cenchrus americanus]
Length=698

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  487  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED    A+ +MP LE+DA  SKMEEVD
Sbjct  667  GLSIDEDETAEAETDMPPLEEDAGESKMEEVD  698



>dbj|BAJ85535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfeg-LCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLDE  +E+KK++E K      LC 
Sbjct  502  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKRKEEKKAAFEGLCK  561

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM  YMSSKKT
Sbjct  562  TIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGAYMSSKKT  621

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTF  RIHRML+
Sbjct  622  MEINPENGIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFAARIHRMLR  681

Query  207  LGLSIDEDA-GDAADVEMPALEDD-AEGSKMEEVD  109
            LGL+ID+ A  +  D +MP+LE++ AE SKMEEVD
Sbjct  682  LGLNIDDQADAEEEDADMPSLEEEGAEESKMEEVD  716



>ref|XP_004308051.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=703

 Score =   279 bits (714),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkld-esedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKLD E+E+EK KKEE K  FE LC 
Sbjct  492  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKTKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGDRVEKV+VSDR+VDSPCCLVTGEYGW+ANMERIMKAQALRD+SM  YMSSKKT
Sbjct  552  TIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDNSMGAYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLD+PNTF +RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFASRIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            LGLSI+ED     D +MP LED AE SKMEEVD
Sbjct  672  LGLSIEEDET-VEDADMPELEDAAEESKMEEVD  703



>dbj|BAK08691.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08734.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08735.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD+++++KKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTDEDKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SKKTM
Sbjct  548  MKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>gb|KJB81562.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=699

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 204/214 (95%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KE LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADV-EMPALED-DAEGSKMEEVD  109
            GLSIDEDAGDA    EMP LED DAEGSKMEEVD
Sbjct  666  GLSIDEDAGDADADSEMPPLEDADAEGSKMEEVD  699



>dbj|BAK08741.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD++E+EKKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTEEEKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SKKTM
Sbjct  548  MKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>gb|KFK26865.1| hypothetical protein AALP_AA8G303900 [Arabis alpina]
Length=705

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQ KE+DGKKLVSATKE     DE+E+EKKKKEE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQWKEYDGKKLVSATKEGLKLEDETEEEKKKKEEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD++EKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKT
Sbjct  552  TIKDILGDKIEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSL++PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPELEEDVAEESKMEEVD  705



>ref|XP_006659612.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=686

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  475  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  534

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAG MSSKKTM
Sbjct  535  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGDMSSKKTM  594

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  595  EINPENAIMEELRKRADADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  654

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED     D +MP LEDDA  SKMEEVD
Sbjct  655  GLSIDEDEAAEVDTDMPPLEDDAGESKMEEVD  686



>ref|XP_002969937.1| hypothetical protein SELMODRAFT_267300 [Selaginella moellendorffii]
 gb|EFJ29061.1| hypothetical protein SELMODRAFT_267300 [Selaginella moellendorffii]
Length=691

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 4/216 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKEGLKL++++DEKKK EE KA FEGLC V
Sbjct  476  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDTDDEKKKFEEKKAAFEGLCKV  535

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  536  IKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTM  595

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  596  EINPDNSIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  655

Query  204  GLSIDED--AGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D  AG  ADV+MP LE+  DAEGSKMEEVD
Sbjct  656  GLSIDDDVGAGADADVDMPPLEEGADAEGSKMEEVD  691



>ref|XP_008355028.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=694

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 199/215 (93%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            G EV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDE KKKEELK KFEGLC V
Sbjct  481  GXEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEAKKKEELKEKFEGLCKV  540

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  541  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  600

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KR DADKNDKSVKDLVLLLFET LLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  601  EINPENPIMEELRKRXDADKNDKSVKDLVLLLFETXLLTSGFSLDDPNTFGNRIHRMLKL  660

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSID+D  +  D +MP LED   DAEGSKMEEVD
Sbjct  661  GLSIDDDTVE-GDADMPPLEDADADAEGSKMEEVD  694



>dbj|BAH97107.1| heat shock protein of Hsp90 [Chara braunii]
 dbj|BAK08668.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08669.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08670.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08671.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08672.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08673.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08674.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08675.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08676.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08677.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08678.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08679.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08680.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08681.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08682.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08683.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08684.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08685.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08686.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08687.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08688.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08689.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08692.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08694.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08695.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08696.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08697.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08698.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08699.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08700.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08701.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08702.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08703.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08704.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08705.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08706.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08707.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08708.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08709.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08710.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08711.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08712.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08713.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08714.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08715.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08716.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08717.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08718.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08719.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08720.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08721.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08722.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08723.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08724.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08725.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08726.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08727.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08729.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08730.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08731.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08732.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08733.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08736.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08737.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08738.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08739.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08740.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08832.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08833.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08834.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08835.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08836.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08837.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08838.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08839.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08840.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD++E++KKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTEEDKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SKKTM
Sbjct  548  MKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>dbj|BAK08690.1| heat shock protein 90 [Chara braunii]
 dbj|BAK08693.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD++E++KKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTEEDKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SKKTM
Sbjct  548  MKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAATEEGSRMEEVD  701



>dbj|BAK08728.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD++E++KKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTEEDKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SKKTM
Sbjct  548  MKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>ref|XP_002981406.1| hypothetical protein SELMODRAFT_271484 [Selaginella moellendorffii]
 gb|EFJ17594.1| hypothetical protein SELMODRAFT_271484 [Selaginella moellendorffii]
Length=704

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 4/216 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKEGLKL++++DEKKK EE KA FEGLC V
Sbjct  489  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDTDDEKKKFEEKKAAFEGLCKV  548

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKTM
Sbjct  549  IKDILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTM  608

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRADADKNDK+VKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  609  EINPDNSIMEELRKRADADKNDKAVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  668

Query  204  GLSIDED--AGDAADVEMPALED--DAEGSKMEEVD  109
            GLSID+D  AG  ADV+MP LE+  DAEGSKMEEVD
Sbjct  669  GLSIDDDVGAGADADVDMPPLEEGADAEGSKMEEVD  704



>ref|XP_006857538.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
 gb|ERN19005.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
Length=699

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKE++GKKLVSATKEGLKLDESEDEKKKKE L AKFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDESEDEKKKKESLMAKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KD+LGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS+M+GYMSSKKTM
Sbjct  546  IKDILGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSNMSGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRAD DKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENAIMEELRKRADVDKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDA-ADVEMPALED-DAEGSKMEEVD  109
            GLSIDED   A  D +MP LED DAEGSKMEEVD
Sbjct  666  GLSIDEDDTAAEQDSDMPPLEDIDAEGSKMEEVD  699



>gb|AHB36893.1| heat shock protein 90 [Matricaria chamomilla var. recutita]
Length=698

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 200/215 (93%), Gaps = 5/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKL+E++DEK K+E LK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLEETDDEKAKQEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MKDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  MKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLD+PNTFGNRIHRMLKL
Sbjct  606  EINPENSIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPAL---EDDAEGSKMEEVD  109
            GLSI EDA D  D ++PAL   E+DAE SKMEEVD
Sbjct  666  GLSIYEDAAD-EDADVPALEEAENDAE-SKMEEVD  698



>prf||1710352A heat shock protein 83
Length=705

 Score =   278 bits (712),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     DE+E+EKKK+EE K  FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSP CLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKT
Sbjct  552  TIKEILGDKVEKVVVSDRIVDSPSCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ADKNDKSVKDLV+LL+ETALLTSGFSLD+PNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLK  671

Query  207  LGLSIDEDAGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDED     D +MP LE+D AE SKMEEVD
Sbjct  672  LGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD  705



>ref|XP_007142446.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
 gb|ESW14440.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
Length=699

 Score =   278 bits (711),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KF+GLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKDKFDGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA   AD +MP LED   DAEGSKMEEVD
Sbjct  666  GLSIDEDA-ADADADMPPLEDVDADAEGSKMEEVD  699



>ref|XP_006408893.1| hypothetical protein EUTSA_v10002229mg [Eutrema salsugineum]
 gb|ESQ50346.1| hypothetical protein EUTSA_v10002229mg [Eutrema salsugineum]
Length=683

 Score =   278 bits (710),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 199/215 (93%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYAIGQLKEF+GKKLVSATKEGLKL+ESEDEKKKKEELK KFEGLC V
Sbjct  469  GYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLEESEDEKKKKEELKEKFEGLCKV  528

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM GYMSSKKTM
Sbjct  529  IKEVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTM  588

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKND SVKDLVLLLFETALLTSGFSLD+PNTFG+RI+RMLKL
Sbjct  589  EINPENSIMEELRKRAEADKNDMSVKDLVLLLFETALLTSGFSLDEPNTFGSRIYRMLKL  648

Query  204  GLSI-DEDAGDAADVEMPALE--DDAEGSKMEEVD  109
            GLSI D+D    AD EMP LE  DDA+ SKMEEVD
Sbjct  649  GLSIDDDDDACEADAEMPPLEDDDDAQDSKMEEVD  683



>ref|XP_007142447.1| hypothetical protein PHAVU_008G281400g [Phaseolus vulgaris]
 gb|ESW14441.1| hypothetical protein PHAVU_008G281400g [Phaseolus vulgaris]
Length=698

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 204/215 (95%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KF+GLC V
Sbjct  485  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKDKFDGLCKV  544

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  545  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  604

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIM+EL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  605  EINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  664

Query  204  GLSIDEDAGDAADVEMPALED---DAEGSKMEEVD  109
            GLSIDEDA   AD +MP LED   DAEGSKMEEVD
Sbjct  665  GLSIDEDA-ADADADMPPLEDVDADAEGSKMEEVD  698



>ref|XP_004294900.1| PREDICTED: heat shock protein 90-2 [Fragaria vesca subsp. vesca]
Length=697

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 3/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKE++GKKLVSATKEGLKLDE+EDE KKKEELK KFEGLC V
Sbjct  485  GYEVLFMVDAIDEYAVGQLKEYEGKKLVSATKEGLKLDETEDEAKKKEELKEKFEGLCKV  544

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGDRVEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  545  VKDVLGDRVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  604

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  605  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  664

Query  204  GLSIDEDAGDAADVEMPALED-DAEG-SKMEEVD  109
            GLSID+DA +  D +MP LED DAE  SKMEEVD
Sbjct  665  GLSIDDDAVE-GDADMPPLEDIDAEAESKMEEVD  697



>dbj|BAK08742.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD++E+EKKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTEEEKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LG++VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQALRDSSM+ YM+SKKTM
Sbjct  548  MKEILGEKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQALRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>dbj|BAK08743.1| heat shock protein 90 [Chara braunii]
Length=701

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 196/215 (91%), Gaps = 4/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVD IDEYA+GQLKE+DGKKLVSATKEGLKLD++E+EKKKKEE+K +FE LC +
Sbjct  488  GYEVLFMVDPIDEYAVGQLKEYDGKKLVSATKEGLKLDDTEEEKKKKEEIKKEFESLCKL  547

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            MK++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIM+AQ LRDSSM+ YM+SKKTM
Sbjct  548  MKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMRAQTLRDSSMSSYMTSKKTM  607

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            E+NPEN IM+EL KRADAD++DK+VKDLV+LLFETALLTSGFSLDDPN F +RIHRM+KL
Sbjct  608  EVNPENAIMKELKKRADADRSDKTVKDLVMLLFETALLTSGFSLDDPNMFASRIHRMIKL  667

Query  204  GLSIDEDAGDAADVEMPALEDDA---EGSKMEEVD  109
            GLSIDEDA    D +MP LED+A   EGS+MEEVD
Sbjct  668  GLSIDEDAA-GEDEDMPPLEDEAAAEEGSRMEEVD  701



>gb|EPS61618.1| hypothetical protein M569_13176 [Genlisea aurea]
Length=701

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 203/216 (94%), Gaps = 4/216 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDES+DEKKKKEELK KFEGLC V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESDDEKKKKEELKTKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  665

Query  204  GLSIDEDA-GDAADVEMPAL---EDDAEGSKMEEVD  109
            GLSIDE+  G   D +MPAL   + DA+GSKMEEVD
Sbjct  666  GLSIDEEGDGVEVDPDMPALADDDADADGSKMEEVD  701



>ref|XP_010539340.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 201/215 (93%), Gaps = 3/215 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYAIGQLKEF+GKKLVSATKEGLKLDESEDEKKKKEELK KFE LC V
Sbjct  486  GYEVLFMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDESEDEKKKKEELKEKFENLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPI++EL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  606  EINPENPILDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSRIHRMLKL  665

Query  204  GLSI-DEDAGDAADVEMPALEDD--AEGSKMEEVD  109
            GLSI DED     D +MP LE+D  AEGSKMEEVD
Sbjct  666  GLSIDDEDDAVEGDSDMPPLEEDAEAEGSKMEEVD  700



>ref|XP_011080917.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=704

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkl-desedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKEGLKL +ESE+EK+KKEE K  FE LC 
Sbjct  491  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEESEEEKEKKEEKKKSFENLCK  550

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
            V+KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKKT
Sbjct  551  VIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKT  610

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+ DKNDKSVKDLVLLL+ETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  611  MEINPDNGIMEELRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLK  670

Query  207  LGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            LGLSID+D     D EMPALE+DA E SKMEEVD
Sbjct  671  LGLSIDDDETATDDTEMPALEEDANEESKMEEVD  704



>ref|NP_001170480.1| HSP protein [Zea mays]
 gb|ACO72989.1| HSP protein [Zea mays]
 gb|AFW65179.1| putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 200/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEY+IGQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  487  GYEVLFMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED     AD +MP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDEEAPEADTDMPPLEDDAGESKMEEVD  699



>gb|ACN36206.1| unknown [Zea mays]
Length=699

 Score =   276 bits (705),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 200/213 (94%), Gaps = 1/213 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEY+IGQLKEF+GKKLVSATKEGLKLDESEDEKK+KEELK KFEGLC V
Sbjct  487  GYEVLFMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEKFEGLCKV  546

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K+VLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSM+GYMSSKKTM
Sbjct  547  IKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTM  606

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPEN IMEEL KRA+ADKNDKSVKDLV+LLFETALLTSGFSLDDPNTFG+RIHRMLKL
Sbjct  607  EINPENAIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFGSRIHRMLKL  666

Query  204  GLSIDED-AGDAADVEMPALEDDAEGSKMEEVD  109
            GLSIDED     AD +MP LEDDA  SKMEEVD
Sbjct  667  GLSIDEDEEAPEADTDMPPLEDDAGESKMEEVD  699



>gb|KJB81563.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=684

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 184/214 (86%), Gaps = 17/214 (8%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+YMVDAIDEYA+GQLKEF+GKKLVSATKE LK                     C V
Sbjct  486  GYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEALKEKFEGL---------------CKV  530

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRD+SMAGYMSSKKTM
Sbjct  531  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTM  590

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL
Sbjct  591  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKL  650

Query  204  GLSIDEDAGDAADV-EMPALED-DAEGSKMEEVD  109
            GLSIDEDAGDA    EMP LED DAEGSKMEEVD
Sbjct  651  GLSIDEDAGDADADSEMPPLEDADAEGSKMEEVD  684



>gb|KCW90631.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=691

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 187/215 (87%), Gaps = 5/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     +E+E+EKKKKEE    FE LC 
Sbjct  479  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKKKEEKIKSFENLCK  538

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSKKT
Sbjct  539  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGSYMSSKKT  598

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+A+KNDKSVKDL +LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  599  MEINPDNGIMEELRKRAEAEKNDKSVKDLTMLLFETALLTSGFSLDDPNTFAARIHRMLK  658

Query  207  LGLSIDED-AGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDE  AGD AD  MP LE+  AE SKMEEVD
Sbjct  659  LGLSIDEGAAGDDAD--MPPLEEGVAEESKMEEVD  691



>ref|XP_002509852.1| heat shock protein, putative [Ricinus communis]
 gb|EEF51239.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   276 bits (705),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV+ MVDAIDEYA+  LKE+DGKKLVSATKEGL+L+ESE+EK+KKEE    F+  C  
Sbjct  492  GYEVLLMVDAIDEYAVTHLKEYDGKKLVSATKEGLQLEESEEEKQKKEEKMKSFDNFCKK  551

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +K++LGDRVEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRDSSM+ YMSSKK M
Sbjct  552  IKEILGDRVEKVMVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSAYMSSKKIM  611

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINP+N IMEEL KRA+ADKNDKSVKDLVLLLFETALLTSGFSLDDPNTF  RIHRMLKL
Sbjct  612  EINPDNSIMEELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFAARIHRMLKL  671

Query  204  GLSIDEDAGDAADVEMPALEDDAEGSKMEEVD  109
            GL I+ED   A  +EMP LE++   SKMEEVD
Sbjct  672  GLGIEEDEAGAEYIEMPVLEEENAESKMEEVD  703



>gb|KJB24311.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=704

 Score =   276 bits (705),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV++MVDAIDEYA+GQLKE+DGKKLVSATKE     +ESEDEKKK+EE K  FE LC 
Sbjct  491  GYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEESEDEKKKREEKKKSFENLCK  550

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +K++LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM+ YMSSKKT
Sbjct  551  TIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMSAYMSSKKT  610

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IME L KRA+ DKNDKSVKDLVLLL+ETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  611  MEINPDNGIMEALRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLK  670

Query  207  LGLSIDEDAGDAADVEMPALEDDA-EGSKMEEVD  109
            LGLSIDED     DV+MP+LE++  E SKMEEVD
Sbjct  671  LGLSIDEDETAVDDVDMPSLEEETNEESKMEEVD  704



>ref|XP_010060433.1| PREDICTED: heat shock protein 83-like [Eucalyptus grandis]
 gb|KCW90632.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=704

 Score =   276 bits (705),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 187/215 (87%), Gaps = 5/215 (2%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATke-glkldesedekkkkeelkakfegLCT  568
            GYEV+YMVDAIDEYA+GQLKE+DGKKLVSATKE     +E+E+EKKKKEE    FE LC 
Sbjct  492  GYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDEETEEEKKKKEEKIKSFENLCK  551

Query  567  VMKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKT  388
             +KD+LGD+VEKV+VSDR+VDSPCCLVTGEYGWTANMERIMKAQALRD+SM  YMSSKKT
Sbjct  552  TIKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMGSYMSSKKT  611

Query  387  MEINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLK  208
            MEINP+N IMEEL KRA+A+KNDKSVKDL +LLFETALLTSGFSLDDPNTF  RIHRMLK
Sbjct  612  MEINPDNGIMEELRKRAEAEKNDKSVKDLTMLLFETALLTSGFSLDDPNTFAARIHRMLK  671

Query  207  LGLSIDED-AGDAADVEMPALEDD-AEGSKMEEVD  109
            LGLSIDE  AGD AD  MP LE+  AE SKMEEVD
Sbjct  672  LGLSIDEGAAGDDAD--MPPLEEGVAEESKMEEVD  704



>ref|XP_010246543.1| PREDICTED: heat shock cognate protein 80 [Nelumbo nucifera]
Length=699

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 200/214 (93%), Gaps = 2/214 (1%)
 Frame = -2

Query  744  GYEVIYMVDAIDEYAIGQLKEFDGKKLVSATkeglkldesedekkkkeelkakfegLCTV  565
            GYEV++MVDAIDEYA+GQLKEF+GKKLVSATKEGLKLDESEDEKKK E LK KFEGLC V
Sbjct  486  GYEVLFMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKKNEALKEKFEGLCKV  545

Query  564  MKDVLGDRVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  385
            +KDVLGD+VEKV+VSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM
Sbjct  546  IKDVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTM  605

Query  384  EINPENPIMEELCKRADADKNDKSVKDlvlllfetalLTSGFSLDDPNTFGNRIHRMLKL  205
            EINPENPIMEEL KRADADKNDKSVKDLVLLLFETALLTSGFSL+DPNTFGNRIHRMLKL
Sbjct  606  EINPENPIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLEDPNTFGNRIHRMLKL  665

Query  204  GLSI-DEDAGDAADVEMPALED-DAEGSKMEEVD  109
            GLSI ++     AD +MP LED DAEGSKMEEVD
Sbjct  666  GLSIDEDGGDADADADMPPLEDADAEGSKMEEVD  699



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420