BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF024A02

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007011772.1|  TRS120 isoform 1                                   273   5e-81   
gb|KJB07659.1|  hypothetical protein B456_001G035900                    268   4e-79   Gossypium raimondii
ref|XP_006450337.1|  hypothetical protein CICLE_v10007276mg             266   1e-78   
gb|KDO46778.1|  hypothetical protein CISIN_1g045708mg                   266   1e-78   Citrus sinensis [apfelsine]
ref|XP_006483432.1|  PREDICTED: uncharacterized protein LOC102615624    266   1e-78   Citrus sinensis [apfelsine]
ref|XP_009618490.1|  PREDICTED: trafficking protein particle comp...    262   2e-77   Nicotiana tomentosiformis
ref|NP_001237873.1|  uncharacterized protein LOC100305609               243   8e-77   
ref|XP_009618489.1|  PREDICTED: trafficking protein particle comp...    261   8e-77   Nicotiana tomentosiformis
ref|XP_009618488.1|  PREDICTED: trafficking protein particle comp...    261   9e-77   Nicotiana tomentosiformis
ref|XP_011074995.1|  PREDICTED: trafficking protein particle comp...    261   1e-76   Sesamum indicum [beniseed]
ref|XP_009778820.1|  PREDICTED: uncharacterized protein LOC104228...    260   1e-76   Nicotiana sylvestris
ref|XP_010322725.1|  PREDICTED: uncharacterized protein LOC101266...    259   2e-76   
ref|XP_010648709.1|  PREDICTED: trafficking protein particle comp...    260   2e-76   Vitis vinifera
ref|XP_010648710.1|  PREDICTED: trafficking protein particle comp...    260   2e-76   Vitis vinifera
ref|XP_009778818.1|  PREDICTED: trafficking protein particle comp...    259   4e-76   Nicotiana sylvestris
ref|XP_009778819.1|  PREDICTED: trafficking protein particle comp...    259   4e-76   Nicotiana sylvestris
ref|XP_004241792.1|  PREDICTED: trafficking protein particle comp...    259   5e-76   Solanum lycopersicum
ref|XP_010244785.1|  PREDICTED: trafficking protein particle comp...    256   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010244786.1|  PREDICTED: trafficking protein particle comp...    256   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_002515463.1|  conserved hypothetical protein                     256   6e-75   
emb|CDP18799.1|  unnamed protein product                                253   5e-74   Coffea canephora [robusta coffee]
ref|XP_006353665.1|  PREDICTED: trafficking protein particle comp...    253   6e-74   Solanum tuberosum [potatoes]
ref|XP_008394133.1|  PREDICTED: uncharacterized protein LOC103456...    249   5e-73   
ref|XP_009355811.1|  PREDICTED: trafficking protein particle comp...    249   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_008394132.1|  PREDICTED: trafficking protein particle comp...    249   2e-72   
gb|EYU32374.1|  hypothetical protein MIMGU_mgv1a000384mg                249   2e-72   Erythranthe guttata [common monkey flower]
gb|KJB65886.1|  hypothetical protein B456_010G117200                    248   2e-72   Gossypium raimondii
gb|KJB65887.1|  hypothetical protein B456_010G117200                    248   2e-72   Gossypium raimondii
gb|KJB65888.1|  hypothetical protein B456_010G117200                    248   3e-72   Gossypium raimondii
ref|XP_009355810.1|  PREDICTED: trafficking protein particle comp...    249   3e-72   Pyrus x bretschneideri [bai li]
ref|XP_007161157.1|  hypothetical protein PHAVU_001G047300g             248   4e-72   Phaseolus vulgaris [French bean]
emb|CBI21099.3|  unnamed protein product                                246   7e-72   Vitis vinifera
gb|KDP33546.1|  hypothetical protein JCGZ_07117                         247   7e-72   Jatropha curcas
ref|XP_002324891.2|  hypothetical protein POPTR_0018s02220g             245   2e-71   
ref|XP_008219551.1|  PREDICTED: trafficking protein particle comp...    244   3e-71   Prunus mume [ume]
ref|XP_003623310.1|  hypothetical protein MTR_7g069440                  234   4e-71   
ref|XP_011036637.1|  PREDICTED: trafficking protein particle comp...    245   6e-71   Populus euphratica
ref|XP_006595493.1|  PREDICTED: uncharacterized protein LOC100305...    245   6e-71   Glycine max [soybeans]
ref|XP_011036636.1|  PREDICTED: trafficking protein particle comp...    245   6e-71   Populus euphratica
ref|XP_007225443.1|  hypothetical protein PRUPE_ppa000412mg             245   7e-71   Prunus persica
ref|XP_010265703.1|  PREDICTED: trafficking protein particle comp...    244   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_011458837.1|  PREDICTED: trafficking protein particle comp...    243   1e-70   Fragaria vesca subsp. vesca
ref|XP_008219549.1|  PREDICTED: trafficking protein particle comp...    244   1e-70   Prunus mume [ume]
ref|XP_003550201.1|  PREDICTED: trafficking protein particle comp...    244   1e-70   Glycine max [soybeans]
ref|XP_008219550.1|  PREDICTED: trafficking protein particle comp...    244   2e-70   Prunus mume [ume]
ref|XP_004498769.1|  PREDICTED: trafficking protein particle comp...    243   3e-70   Cicer arietinum [garbanzo]
ref|XP_011458836.1|  PREDICTED: trafficking protein particle comp...    242   6e-70   Fragaria vesca subsp. vesca
ref|XP_004290928.1|  PREDICTED: trafficking protein particle comp...    242   6e-70   Fragaria vesca subsp. vesca
gb|KEH39853.1|  transporter TRS120                                      242   7e-70   Medicago truncatula
ref|XP_010519641.1|  PREDICTED: trafficking protein particle comp...    241   1e-69   Tarenaya hassleriana [spider flower]
gb|KHG29759.1|  Trafficking particle complex subunit 9                  241   1e-69   Gossypium arboreum [tree cotton]
ref|XP_010048925.1|  PREDICTED: trafficking protein particle comp...    241   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010048924.1|  PREDICTED: trafficking protein particle comp...    241   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010665754.1|  PREDICTED: trafficking protein particle comp...    241   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010105451.1|  hypothetical protein L484_003461                   240   3e-69   Morus notabilis
ref|XP_002309653.2|  hypothetical protein POPTR_0006s27580g             238   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010942155.1|  PREDICTED: trafficking protein particle comp...    236   7e-68   
emb|CDX97076.1|  BnaC09g45490D                                          236   8e-68   
ref|XP_006399603.1|  hypothetical protein EUTSA_v10012483mg             236   9e-68   Eutrema salsugineum [saltwater cress]
gb|KFK37733.1|  hypothetical protein AALP_AA3G022200                    236   9e-68   Arabis alpina [alpine rockcress]
ref|XP_009122000.1|  PREDICTED: trafficking protein particle comp...    235   2e-67   Brassica rapa
emb|CDX69788.1|  BnaA10g21370D                                          233   8e-67   
ref|XP_008452884.1|  PREDICTED: transport protein particle subuni...    233   1e-66   Cucumis melo [Oriental melon]
ref|XP_011039615.1|  PREDICTED: trafficking protein particle comp...    233   2e-66   Populus euphratica
ref|XP_009381560.1|  PREDICTED: trafficking protein particle comp...    232   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871450.1|  hypothetical protein ARALYDRAFT_487936             231   4e-66   
ref|XP_006286929.1|  hypothetical protein CARUB_v10000071mg             228   5e-66   
ref|XP_008784808.1|  PREDICTED: trafficking protein particle comp...    231   6e-66   Phoenix dactylifera
ref|XP_006286927.1|  hypothetical protein CARUB_v10000071mg             229   7e-66   
ref|NP_196665.1|  protein TRS120                                        230   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286928.1|  hypothetical protein CARUB_v10000071mg             229   3e-65   Capsella rubella
ref|XP_004145518.1|  PREDICTED: uncharacterized protein LOC101217047    229   4e-65   Cucumis sativus [cucumbers]
ref|XP_010453144.1|  PREDICTED: trafficking protein particle comp...    229   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010491799.1|  PREDICTED: trafficking protein particle comp...    228   8e-65   
ref|XP_010491797.1|  PREDICTED: trafficking protein particle comp...    228   9e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010419658.1|  PREDICTED: trafficking protein particle comp...    227   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006848818.1|  hypothetical protein AMTR_s00026p00150010          226   6e-64   
ref|XP_010453143.1|  PREDICTED: uncharacterized protein LOC104735118    206   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002446750.1|  hypothetical protein SORBIDRAFT_06g021740          221   3e-62   
tpg|DAA37075.1|  TPA: hypothetical protein ZEAMMB73_993824              218   2e-61   
ref|XP_008669201.1|  PREDICTED: trafficking protein particle comp...    218   2e-61   Zea mays [maize]
gb|EMS61444.1|  hypothetical protein TRIUR3_09999                       213   9e-60   Triticum urartu
dbj|BAJ94931.1|  predicted protein                                      212   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS63566.1|  hypothetical protein M569_11217                         212   2e-59   Genlisea aurea
gb|EMT13211.1|  hypothetical protein F775_03305                         212   3e-59   
ref|XP_010227185.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    209   4e-58   
ref|XP_004976133.1|  PREDICTED: trafficking protein particle comp...    207   2e-57   Setaria italica
ref|XP_004976134.1|  PREDICTED: trafficking protein particle comp...    207   2e-57   
gb|AES79528.2|  transporter TRS120                                      197   2e-57   Medicago truncatula
ref|NP_001053234.1|  Os04g0502200                                       206   3e-57   
gb|EEC77580.1|  hypothetical protein OsI_16530                          206   5e-57   Oryza sativa Indica Group [Indian rice]
emb|CAH67557.1|  H0311C03.11                                            206   6e-57   Oryza sativa [red rice]
ref|XP_006653574.1|  PREDICTED: trafficking protein particle comp...    204   1e-56   
gb|EEE61278.1|  hypothetical protein OsJ_15360                          202   1e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009362330.1|  PREDICTED: uncharacterized protein LOC103952471    181   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_007011773.1|  Trafficking protein particle complex subunit...    168   6e-44   
ref|XP_001774293.1|  predicted protein                                  152   2e-38   
gb|EYU32375.1|  hypothetical protein MIMGU_mgv1a000384mg                145   7e-36   Erythranthe guttata [common monkey flower]
emb|CAE01639.1|  OSJNBa0029H02.30                                       145   7e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001777714.1|  predicted protein                                  144   3e-35   
ref|XP_009762936.1|  PREDICTED: uncharacterized protein LOC104214912    124   4e-31   Nicotiana sylvestris
ref|XP_002962206.1|  hypothetical protein SELMODRAFT_77626              126   3e-29   
ref|XP_002965121.1|  hypothetical protein SELMODRAFT_83253              124   1e-28   
gb|AFW58779.1|  hypothetical protein ZEAMMB73_746167                  98.2    7e-21   
ref|XP_002980237.1|  hypothetical protein SELMODRAFT_444472             101   1e-20   
ref|XP_008664222.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...  97.4    2e-19   
ref|XP_002963095.1|  hypothetical protein SELMODRAFT_165701           74.7    8e-12   



>ref|XP_007011772.1| TRS120 isoform 1 [Theobroma cacao]
 gb|EOY29391.1| TRS120 isoform 1 [Theobroma cacao]
Length=1201

 Score =   273 bits (698),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSSVMDVLLPDPLTFGF LA+NGS    ++D+PKE +      A K+ 
Sbjct  1021  ELNIKDAIQAALQSSVMDVLLPDPLTFGFRLARNGSENASKLDLPKELNTSIQPSASKNF  1080

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             VIAH+MTPMEVLVRNNTKETIK++LS+TCRDVAGENCVEG K TVLWAGVL+GI MEVPP
Sbjct  1081  VIAHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGENCVEGTKATVLWAGVLSGITMEVPP  1140

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQE KH FS+YFLVPGEYTL+AAA IDDAN++LRARA++ S DE IFCRGPPFH+ V+GT
Sbjct  1141  LQESKHCFSLYFLVPGEYTLVAAAVIDDANDVLRARAKSKSPDEPIFCRGPPFHVHVDGT  1200



>gb|KJB07659.1| hypothetical protein B456_001G035900 [Gossypium raimondii]
Length=1200

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
             ELN KDAIQAALQSSVMDVLLPDPLTFGF LA+NGS    ++D+PKE D     +A K+S
Sbjct  1020  ELNCKDAIQAALQSSVMDVLLPDPLTFGFRLARNGSENAAKLDLPKESDTSIQHIASKNS  1079

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             VIAH+MTP EVLVRNNTKETIK++LS+TCRDVAG N +EG K TV+WAGVL+GI MEVPP
Sbjct  1080  VIAHDMTPFEVLVRNNTKETIKMNLSVTCRDVAGANSIEGAKATVIWAGVLSGITMEVPP  1139

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E KH FS+YFLVPGEYTL+AAA IDDAN++LRARA++ SSDE IFCRGPPFH+ VNGT
Sbjct  1140  LEETKHGFSLYFLVPGEYTLVAAAVIDDANDVLRARAKSESSDEPIFCRGPPFHVHVNGT  1199



>ref|XP_006450337.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
 gb|ESR63577.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
Length=1193

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 150/177 (85%), Gaps = 3/177 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDA+QAALQSSVMDVLLPDPLTFGF L K GS E D   E D+ N+S   K SV+A
Sbjct  1019  ELNIKDAVQAALQSSVMDVLLPDPLTFGFRLVKKGS-EQDA--ELDLPNDSSGPKGSVLA  1075

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE IK+SLSITCRDVAGENC+EG K TVLW+GVLN I MEVPPLQE
Sbjct  1076  HDMTPMEVLVRNNTKEMIKMSLSITCRDVAGENCIEGTKPTVLWSGVLNEITMEVPPLQE  1135

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA IDDAN ILRARAR  S DE IFCRGPPFH+RV+GT
Sbjct  1136  SKHCFSLYFLVPGEYTLVAAAVIDDANNILRARARTDSPDEPIFCRGPPFHVRVSGT  1192



>gb|KDO46778.1| hypothetical protein CISIN_1g045708mg [Citrus sinensis]
Length=1196

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 150/177 (85%), Gaps = 3/177 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDA+QAALQSSVMDVLLPDPLTFGF L K GS E D   E D+ N+S   K SV+A
Sbjct  1022  ELNIKDAVQAALQSSVMDVLLPDPLTFGFRLVKKGS-EQDA--ELDLPNDSSGPKGSVLA  1078

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE IK+SLSITCRDVAGENC+EG K TVLW+GVLN I MEVPPLQE
Sbjct  1079  HDMTPMEVLVRNNTKEMIKMSLSITCRDVAGENCIEGTKPTVLWSGVLNEITMEVPPLQE  1138

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA IDDAN ILRARAR  S DE IFCRGPPFH+RV+GT
Sbjct  1139  SKHCFSLYFLVPGEYTLVAAAVIDDANNILRARARTDSPDEPIFCRGPPFHVRVSGT  1195



>ref|XP_006483432.1| PREDICTED: uncharacterized protein LOC102615624 [Citrus sinensis]
Length=1196

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 150/177 (85%), Gaps = 3/177 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDA+QAALQSSVMDVLLPDPLTFGF L K GS E D   E D+ N+S   K SV+A
Sbjct  1022  ELNIKDAVQAALQSSVMDVLLPDPLTFGFRLVKKGS-EQDA--ELDLPNDSSGPKGSVLA  1078

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE IK+SLSITCRDVAGENC+EG K TVLW+GVLN I MEVPPLQE
Sbjct  1079  HDMTPMEVLVRNNTKEMIKMSLSITCRDVAGENCIEGTKPTVLWSGVLNEITMEVPPLQE  1138

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA IDDAN ILRARAR  S DE IFCRGPPFH+RV+GT
Sbjct  1139  SKHCFSLYFLVPGEYTLVAAAVIDDANNILRARARTDSPDEPIFCRGPPFHVRVSGT  1195



>ref|XP_009618490.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X3 [Nicotiana tomentosiformis]
Length=1023

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 6/180 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF   KN      E+++ +E D+Q      K S
Sbjct  846   ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGKNTLQDFAELNLDEESDIQGTR---KGS  902

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             + AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  903   LRAHDMTPVEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATVLWAGVLSGVTMEVPP  962

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFCRGPPFHIRV+GT
Sbjct  963   LKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFCRGPPFHIRVDGT  1022



>ref|NP_001237873.1| uncharacterized protein LOC100305609 [Glycine max]
 gb|ACU13379.1| unknown [Glycine max]
Length=228

 Score =   243 bits (619),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 149/181 (82%), Gaps = 7/181 (4%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSL----ACKS  503
            ELNIK+AIQAALQ+SVMDVLLPDPLTFGF L ++GS   +  K +  +++ L      K 
Sbjct  50   ELNIKEAIQAALQTSVMDVLLPDPLTFGFRLDRDGS---ESGKPYSEKDSDLVESPGSKG  106

Query  502  SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVP  323
            SV+AHEMTPMEVLVRNNTK+ IK+SL+ITCR VAGENCV+G K TVLW GVL+ I ME+P
Sbjct  107  SVVAHEMTPMEVLVRNNTKDMIKMSLNITCRGVAGENCVDGTKATVLWTGVLSDITMEIP  166

Query  322  PLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
            PLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E IFCRGPP+H+RV G
Sbjct  167  PLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAEPIFCRGPPYHVRVLG  226

Query  142  T  140
            T
Sbjct  227  T  227



>ref|XP_009618489.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana tomentosiformis]
Length=1185

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 6/180 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF   KN      E+++ +E D+Q      K S
Sbjct  1008  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGKNTLQDFAELNLDEESDIQGTR---KGS  1064

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             + AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  1065  LRAHDMTPVEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATVLWAGVLSGVTMEVPP  1124

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFCRGPPFHIRV+GT
Sbjct  1125  LKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFCRGPPFHIRVDGT  1184



>ref|XP_009618488.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana tomentosiformis]
Length=1188

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 6/180 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF   KN      E+++ +E D+Q      K S
Sbjct  1011  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGKNTLQDFAELNLDEESDIQGTR---KGS  1067

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             + AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  1068  LRAHDMTPVEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATVLWAGVLSGVTMEVPP  1127

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFCRGPPFHIRV+GT
Sbjct  1128  LKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFCRGPPFHIRVDGT  1187



>ref|XP_011074995.1| PREDICTED: trafficking protein particle complex subunit 9 [Sesamum 
indicum]
Length=1196

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 155/182 (85%), Gaps = 8/182 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDV---PKEFDMQNNSLACKS-  503
             EL+IKDAIQAALQ+SVMDVLLPDPLTFGF LAK+ S        PK+ DMQ   + C S 
Sbjct  1017  ELDIKDAIQAALQASVMDVLLPDPLTFGFRLAKSSSNNSANLNPPKQADMQ---VYCASG  1073

Query  502   -SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEV  326
              S+IAH+MTPMEVLVRNNT+ETIK++LS+TC+DVAGENC+EGDK TVLW GVL GI ME+
Sbjct  1074  GSIIAHDMTPMEVLVRNNTRETIKINLSVTCKDVAGENCIEGDKATVLWEGVLTGIIMEI  1133

Query  325   PPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVN  146
             PPLQEI+H FS+YFL+PGEYT+ AAA IDDANE+LRARAR +SSDE IFCRGPPFH+RVN
Sbjct  1134  PPLQEIRHIFSLYFLIPGEYTMSAAAVIDDANEVLRARARTNSSDEPIFCRGPPFHVRVN  1193

Query  145   GT  140
             GT
Sbjct  1194  GT  1195



>ref|XP_009778820.1| PREDICTED: uncharacterized protein LOC104228113 isoform X3 [Nicotiana 
sylvestris]
Length=1023

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 153/180 (85%), Gaps = 6/180 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF   +N      E+++ +E D+Q      K S
Sbjct  846   ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGQNTLQDFAELNLDEESDIQGTR---KGS  902

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             + AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  903   LRAHDMTPIEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATVLWAGVLSGVTMEVPP  962

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA S DESIFCRGPP+HIRV+GT
Sbjct  963   LKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARAKSCDESIFCRGPPYHIRVDGT  1022



>ref|XP_010322725.1| PREDICTED: uncharacterized protein LOC101266526 isoform X2 [Solanum 
lycopersicum]
Length=927

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
            ELNIKDAIQAALQSS+MDVLLPDPLTFGF    N S         +  N   A K SV A
Sbjct  750  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGNNTSQNSSDLNMDEGSNIQGARKGSVKA  809

Query  490  HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
            H+ TP+EVLVRNNTKE I++SLSITCRD+AGENCVEGDK TVLWAGVLNGI MEVPPL+E
Sbjct  810  HDTTPVEVLVRNNTKEMIRVSLSITCRDIAGENCVEGDKATVLWAGVLNGITMEVPPLKE  869

Query  310  IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFCRGPPFHIRVNGT
Sbjct  870  YRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFCRGPPFHIRVNGT  926



>ref|XP_010648709.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Vitis vinifera]
Length=1206

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 4/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQ+SVMD+LLPDPLTFGF L+KNG+    ++D PKE ++Q  S + K S
Sbjct  1027  ELNIKDAIQAALQTSVMDILLPDPLTFGFKLSKNGAGHAAKLDSPKESNVQVPSTS-KGS  1085

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V+AH+MTPMEVLVRNNT E IK+  SI CRDVAG NCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  1086  VLAHDMTPMEVLVRNNTMEMIKMRFSIRCRDVAGANCVEGDKATVLWAGVLSGVTMEVPP  1145

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQE+KH FS+YFLVPGEYTL+AAA IDD N+ILRARAR+ SS+E IFCRGPPFH+RV GT
Sbjct  1146  LQEVKHSFSLYFLVPGEYTLVAAAVIDDPNDILRARARSVSSNEPIFCRGPPFHVRVIGT  1205



>ref|XP_010648710.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Vitis vinifera]
Length=1202

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 4/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQ+SVMD+LLPDPLTFGF L+KNG+    ++D PKE ++Q  S + K S
Sbjct  1023  ELNIKDAIQAALQTSVMDILLPDPLTFGFKLSKNGAGHAAKLDSPKESNVQVPSTS-KGS  1081

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V+AH+MTPMEVLVRNNT E IK+  SI CRDVAG NCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  1082  VLAHDMTPMEVLVRNNTMEMIKMRFSIRCRDVAGANCVEGDKATVLWAGVLSGVTMEVPP  1141

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQE+KH FS+YFLVPGEYTL+AAA IDD N+ILRARAR+ SS+E IFCRGPPFH+RV GT
Sbjct  1142  LQEVKHSFSLYFLVPGEYTLVAAAVIDDPNDILRARARSVSSNEPIFCRGPPFHVRVIGT  1201



>ref|XP_009778818.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana sylvestris]
Length=1188

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 153/180 (85%), Gaps = 6/180 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF   +N      E+++ +E D+Q      K S
Sbjct  1011  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGQNTLQDFAELNLDEESDIQGTR---KGS  1067

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             + AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  1068  LRAHDMTPIEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATVLWAGVLSGVTMEVPP  1127

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA S DESIFCRGPP+HIRV+GT
Sbjct  1128  LKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARAKSCDESIFCRGPPYHIRVDGT  1187



>ref|XP_009778819.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana sylvestris]
Length=1185

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 153/180 (85%), Gaps = 6/180 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF   +N      E+++ +E D+Q      K S
Sbjct  1008  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGQNTLQDFAELNLDEESDIQGTR---KGS  1064

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             + AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TVLWAGVL+G+ MEVPP
Sbjct  1065  LRAHDMTPIEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATVLWAGVLSGVTMEVPP  1124

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA S DESIFCRGPP+HIRV+GT
Sbjct  1125  LKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARAKSCDESIFCRGPPYHIRVDGT  1184



>ref|XP_004241792.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Solanum lycopersicum]
Length=1185

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF    N S         +  N   A K SV A
Sbjct  1008  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGNNTSQNSSDLNMDEGSNIQGARKGSVKA  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+ TP+EVLVRNNTKE I++SLSITCRD+AGENCVEGDK TVLWAGVLNGI MEVPPL+E
Sbjct  1068  HDTTPVEVLVRNNTKEMIRVSLSITCRDIAGENCVEGDKATVLWAGVLNGITMEVPPLKE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFCRGPPFHIRVNGT
Sbjct  1128  YRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFCRGPPFHIRVNGT  1184



>ref|XP_010244785.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Nelumbo nucifera]
Length=1204

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
             ELNIKDA+Q ALQ+SVMD+LLPDPLTFGF LA+NG+    +ID PKE D++ +S   K S
Sbjct  1024  ELNIKDAVQGALQTSVMDILLPDPLTFGFRLARNGNGSVAKIDSPKESDIRISSSGEKGS  1083

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V AHEMTP+EVLVRNNTKE I++SLSITCRDVAGE+C+EG+K TVLWAGVL+ I +EVPP
Sbjct  1084  VPAHEMTPLEVLVRNNTKEIIRMSLSITCRDVAGESCIEGNKATVLWAGVLSEICVEVPP  1143

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQEI H FS+YFLVPGEYTL+AAA I DAN+ILRARA+  S DE IFCRG PFHIRV G+
Sbjct  1144  LQEISHSFSLYFLVPGEYTLVAAAVIADANDILRARAKTDSPDEPIFCRGSPFHIRVVGS  1203



>ref|XP_010244786.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Nelumbo nucifera]
Length=1180

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
             ELNIKDA+Q ALQ+SVMD+LLPDPLTFGF LA+NG+    +ID PKE D++ +S   K S
Sbjct  1000  ELNIKDAVQGALQTSVMDILLPDPLTFGFRLARNGNGSVAKIDSPKESDIRISSSGEKGS  1059

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V AHEMTP+EVLVRNNTKE I++SLSITCRDVAGE+C+EG+K TVLWAGVL+ I +EVPP
Sbjct  1060  VPAHEMTPLEVLVRNNTKEIIRMSLSITCRDVAGESCIEGNKATVLWAGVLSEICVEVPP  1119

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQEI H FS+YFLVPGEYTL+AAA I DAN+ILRARA+  S DE IFCRG PFHIRV G+
Sbjct  1120  LQEISHSFSLYFLVPGEYTLVAAAVIADANDILRARAKTDSPDEPIFCRGSPFHIRVVGS  1179



>ref|XP_002515463.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46912.1| conserved hypothetical protein [Ricinus communis]
Length=1195

 Score =   256 bits (654),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 148/177 (84%), Gaps = 5/177 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQ+SVMDVLLPDPLTFGF L K+     +VP+E +M  +S   K SV+A
Sbjct  1023  ELNIKDAIQAALQTSVMDVLLPDPLTFGFRLVKS-----NVPRESEMPVDSSGSKGSVMA  1077

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEV+VRNNTKE I++SLSITCRDVAG NCVEG K TVLWAGVLNGI MEVP LQE
Sbjct  1078  HDMTPMEVVVRNNTKEMIRMSLSITCRDVAGHNCVEGSKATVLWAGVLNGIIMEVPALQE  1137

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS++FLVPGEYTL+AAA I DAN++LR RAR  S+DE IFCRGPPFHIR+ GT
Sbjct  1138  SKHCFSLHFLVPGEYTLVAAAVIADANDVLRTRARTDSADEPIFCRGPPFHIRIIGT  1194



>emb|CDP18799.1| unnamed protein product [Coffea canephora]
Length=1204

 Score =   253 bits (647),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVPKEFDMQNNSLACKSS  500
             ELNIKDA+Q ALQSSVMDVLLPDPLTFGF LAK+      ++D  +  D Q +S  C S+
Sbjct  1024  ELNIKDAMQTALQSSVMDVLLPDPLTFGFRLAKDNVDHRVKLDSTETCDAQPHSAVCNST  1083

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V+AH+MTPMEVLVRNNTKE + +SL+ITCRDVAG+NC EG+K TVLW GVL+ I MEVPP
Sbjct  1084  VVAHDMTPMEVLVRNNTKEMVGISLNITCRDVAGQNCFEGEKATVLWTGVLSSINMEVPP  1143

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQE+KH FS+YFLVPGEYTLLAAA I+DANEILRARA++++ DE IFCRG PFH++V+GT
Sbjct  1144  LQEVKHSFSLYFLVPGEYTLLAAAVIEDANEILRARAKSNTHDEPIFCRGAPFHLQVSGT  1203



>ref|XP_006353665.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Solanum tuberosum]
Length=1185

 Score =   253 bits (646),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQSS+MDVLLPDPLTFGF    N S +       +  N   A K SV A
Sbjct  1009  ELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGNNTSQDFADLNLDEGSNIQGARKGSVRA  1068

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTP+EVLVRNNTKE I++SLSITCRD+AGENCV+GDK TVLWAGVLNG+ MEVPPL+E
Sbjct  1069  HDMTPVEVLVRNNTKEMIRVSLSITCRDIAGENCVKGDKATVLWAGVLNGVTMEVPPLKE  1128

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S  ESIFCRGPPFHIRVNGT
Sbjct  1129  YRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARATSC-ESIFCRGPPFHIRVNGT  1184



>ref|XP_008394133.1| PREDICTED: uncharacterized protein LOC103456233 isoform X2 [Malus 
domestica]
Length=981

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPKEFDMQNNSLACKSSV  497
            ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG +PE      + + Q +  A K SV
Sbjct  802  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAPENSGSHAQANFQVHPSAAKGSV  861

Query  496  IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
            +AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL++GVL+GI +EVPPL
Sbjct  862  LAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVLYSGVLSGITVEVPPL  921

Query  316  QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
            +EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  922  EEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  980



>ref|XP_009355811.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Pyrus x bretschneideri]
Length=981

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP--EIDVPKEFDMQNNSLACKSSV  497
            ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG          E + Q +  A K SV
Sbjct  802  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAIEHSGSHTEHNFQVHPSAAKGSV  861

Query  496  IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
            +AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL++GVL+GI +EVPPL
Sbjct  862  LAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVLYSGVLSGITVEVPPL  921

Query  316  QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
            +EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  922  EEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  980



>ref|XP_008394132.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Malus domestica]
Length=1202

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPKEFDMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG +PE      + + Q +  A K SV
Sbjct  1023  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAPENSGSHAQANFQVHPSAAKGSV  1082

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL++GVL+GI +EVPPL
Sbjct  1083  LAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVLYSGVLSGITVEVPPL  1142

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             +EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  1143  EEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  1201



>gb|EYU32374.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1197

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 5/181 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP----EIDVPKEFDMQNNSLACKS  503
             EL+IKDAIQAALQ+SV+DVLLPDPLTFGF LAK+ S     + + PK+ DM N S   + 
Sbjct  1017  ELDIKDAIQAALQASVLDVLLPDPLTFGFRLAKSTSDLSIMKQNSPKKTDMVN-SCGTEG  1075

Query  502   SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVP  323
             S++AH+MT MEVLVRNNTK  I+++LS+TC+DVAGENC+EGDK TVLW GVL GI MEVP
Sbjct  1076  SIVAHDMTAMEVLVRNNTKGAIRINLSVTCKDVAGENCIEGDKATVLWEGVLTGITMEVP  1135

Query  322   PLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             PLQEI+H FS+YFL+PGEYT+ AAA I DANE+LRARAR +S D+ IFCRGPPF +RVNG
Sbjct  1136  PLQEIRHIFSLYFLIPGEYTMAAAAVIKDANEVLRARARTNSFDDPIFCRGPPFRVRVNG  1195

Query  142   T  140
             T
Sbjct  1196  T  1196



>gb|KJB65886.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=1044

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE---IDVPKEFDMQNNSLACKSS  500
             ELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D PKE  +        SS
Sbjct  864   ELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSPKESSINIQPSMSNSS  923

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             VI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TVLWAGVL+GI +EVPP
Sbjct  924   VIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATVLWAGVLSGITIEVPP  983

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE IFCRGPPFH+RV GT
Sbjct  984   LEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEPIFCRGPPFHVRVIGT  1043



>gb|KJB65887.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=997

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE---IDVPKEFDMQNNSLACKSS  500
            ELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D PKE  +        SS
Sbjct  817  ELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSPKESSINIQPSMSNSS  876

Query  499  VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
            VI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TVLWAGVL+GI +EVPP
Sbjct  877  VIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATVLWAGVLSGITIEVPP  936

Query  319  LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
            L+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE IFCRGPPFH+RV GT
Sbjct  937  LEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEPIFCRGPPFHVRVIGT  996



>gb|KJB65888.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=1024

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE---IDVPKEFDMQNNSLACKSS  500
             ELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D PKE  +        SS
Sbjct  844   ELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSPKESSINIQPSMSNSS  903

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             VI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TVLWAGVL+GI +EVPP
Sbjct  904   VIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATVLWAGVLSGITIEVPP  963

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE IFCRGPPFH+RV GT
Sbjct  964   LEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEPIFCRGPPFHVRVIGT  1023



>ref|XP_009355810.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Pyrus x bretschneideri]
Length=1202

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP--EIDVPKEFDMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG          E + Q +  A K SV
Sbjct  1023  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAIEHSGSHTEHNFQVHPSAAKGSV  1082

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL++GVL+GI +EVPPL
Sbjct  1083  LAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVLYSGVLSGITVEVPPL  1142

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             +EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  1143  EEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  1201



>ref|XP_007161157.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
 gb|ESW33151.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
Length=1196

 Score =   248 bits (634),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 148/177 (84%), Gaps = 2/177 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIK+AIQAALQ+SVMDVLLPDPLTFGF L ++ S       E D ++ S   K SVIA
Sbjct  1021  ELNIKEAIQAALQTSVMDVLLPDPLTFGFRLVRDDSESKKT--EPDKESESAVSKGSVIA  1078

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HEMTPMEVLVRNNTK+ +K+SL+ITCRDVAGENCV+G K TVLW GVL+ IAME+PPLQ+
Sbjct  1079  HEMTPMEVLVRNNTKDMLKMSLNITCRDVAGENCVDGTKATVLWTGVLSDIAMEIPPLQQ  1138

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E IFCRGPP+H+RV GT
Sbjct  1139  IKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAEPIFCRGPPYHVRVLGT  1195



>emb|CBI21099.3| unnamed protein product [Vitis vinifera]
Length=1056

 Score =   246 bits (629),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 143/177 (81%), Gaps = 15/177 (8%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQ+SVMD+LLPDPLTFGF L+KN      VP            K SV+A
Sbjct  894   ELNIKDAIQAALQTSVMDILLPDPLTFGFKLSKN------VPS---------TSKGSVLA  938

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNT E IK+  SI CRDVAG NCVEGDK TVLWAGVL+G+ MEVPPLQE
Sbjct  939   HDMTPMEVLVRNNTMEMIKMRFSIRCRDVAGANCVEGDKATVLWAGVLSGVTMEVPPLQE  998

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             +KH FS+YFLVPGEYTL+AAA IDD N+ILRARAR+ SS+E IFCRGPPFH+RV GT
Sbjct  999   VKHSFSLYFLVPGEYTLVAAAVIDDPNDILRARARSVSSNEPIFCRGPPFHVRVIGT  1055



>gb|KDP33546.1| hypothetical protein JCGZ_07117 [Jatropha curcas]
Length=1193

 Score =   247 bits (631),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQ+SVMDVLLPDPLTF F L +N     +  +E D  ++    K SV A
Sbjct  1021  ELNIKDAIQAALQTSVMDVLLPDPLTFNFRLTRN-----NFTQEPDRADDFSEPKGSVRA  1075

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEV+VRNNTKETI +SLSITCRDVAGENCVEG K TVLWAGVL+GI+MEVPPLQE
Sbjct  1076  HDMTPMEVIVRNNTKETITMSLSITCRDVAGENCVEGTKATVLWAGVLHGISMEVPPLQE  1135

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              +H FS++FLVPGEYTL+AAA I+DAN+ILR RAR  S+DE IFCRGPPFHI V GT
Sbjct  1136  SRHSFSLHFLVPGEYTLVAAAVIEDANDILRTRARTESADEPIFCRGPPFHISVIGT  1192



>ref|XP_002324891.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
 gb|EEF03456.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
Length=1087

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 144/177 (81%), Gaps = 9/177 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAAL++S MDVLLPDPLTFGF L +N             ++     K SV+A
Sbjct  919   ELNIKDAIQAALKTSAMDVLLPDPLTFGFRLVRN---------NLSQESGDSRPKGSVVA  969

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE I++SL+ITCRDVAGENCVEG K TVLW+GVLNGI +EVPPLQE
Sbjct  970   HDMTPMEVLVRNNTKEMIRMSLNITCRDVAGENCVEGTKATVLWSGVLNGITIEVPPLQE  1029

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA I+DAN++LRARA+ +S +E IFCRGPPFH+RV GT
Sbjct  1030  SKHSFSLYFLVPGEYTLIAAALIEDANDLLRARAKTNSPEEPIFCRGPPFHVRVIGT  1086



>ref|XP_008219551.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X3 [Prunus mume]
Length=980

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKEF-DMQNNSLACKSSV  497
            ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE        ++Q +S A K SV
Sbjct  801  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHNSPNVQVHSAAAKGSV  860

Query  496  IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
            +AHEMTPMEV+VRNNTKE IK+SL ITCRDVAGENCVEG K TVL +GVL+GI +EVP L
Sbjct  861  LAHEMTPMEVVVRNNTKEKIKMSLGITCRDVAGENCVEGTKATVLCSGVLSGITVEVPSL  920

Query  316  QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
            QEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  921  QEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  979



>ref|XP_003623310.1| hypothetical protein MTR_7g069440 [Medicago truncatula]
Length=438

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 3/178 (2%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN--GSPEIDVPKEFDMQNNSLACKSSV  497
            ELNIKDAIQAAL +SVMDVLLPDPLTFGF L ++   S  +D  KE D+   S A KSSV
Sbjct  260  ELNIKDAIQAALLTSVMDVLLPDPLTFGFKLVRDESDSDNLDPVKESDLPE-SPASKSSV  318

Query  496  IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
            +AHEMT M V+VRNNTK+TIK++L+ITCRDVAGENCV+G K+TVLW GVL+ I +E+PPL
Sbjct  319  LAHEMTSMVVVVRNNTKDTIKINLNITCRDVAGENCVDGTKSTVLWTGVLSEITVEIPPL  378

Query  316  QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             +IKH F ++FLVPGEYTLLAAA IDDAN+ILRARARA+SS E IFCRGPP+H+RV G
Sbjct  379  HQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARARATSSAEPIFCRGPPYHLRVLG  436



>ref|XP_011036637.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Populus euphratica]
Length=1183

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 144/177 (81%), Gaps = 9/177 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAAL++S MDVLLPDPLTFGF L +N             ++     K SV+A
Sbjct  1015  ELNIKDAIQAALKTSAMDVLLPDPLTFGFRLVRN---------NLSQESGDSKPKGSVLA  1065

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE I++SL+ITCRDVAGENCVEG K TVLW+GVLNGI +EVPPLQE
Sbjct  1066  HDMTPMEVLVRNNTKEMIRMSLNITCRDVAGENCVEGTKATVLWSGVLNGITIEVPPLQE  1125

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA I+DAN++LRARA+ +S +E IFCRGPPFH+RV GT
Sbjct  1126  SKHSFSLYFLVPGEYTLIAAALIEDANDLLRARAKTNSPEEPIFCRGPPFHVRVIGT  1182



>ref|XP_006595493.1| PREDICTED: uncharacterized protein LOC100305609 isoform X1 [Glycine 
max]
Length=1200

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 7/181 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSL----ACKS  503
             ELNIK+AIQAALQ+SVMDVLLPDPLTFGF L ++GS   +  K +  +++ L      K 
Sbjct  1022  ELNIKEAIQAALQTSVMDVLLPDPLTFGFRLDRDGS---ESGKPYSEKDSDLVESPGSKG  1078

Query  502   SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVP  323
             SV+AHEMTPMEVLVRNNTK+ IK+SL+ITCRDVAGENCV+G K TVLW GVL+ I ME+P
Sbjct  1079  SVVAHEMTPMEVLVRNNTKDMIKMSLNITCRDVAGENCVDGTKATVLWTGVLSDITMEIP  1138

Query  322   PLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             PLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E IFCRGPP+H+RV G
Sbjct  1139  PLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAEPIFCRGPPYHVRVLG  1198

Query  142   T  140
             T
Sbjct  1199  T  1199



>ref|XP_011036636.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Populus euphratica]
Length=1187

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 144/177 (81%), Gaps = 9/177 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAAL++S MDVLLPDPLTFGF L +N             ++     K SV+A
Sbjct  1019  ELNIKDAIQAALKTSAMDVLLPDPLTFGFRLVRN---------NLSQESGDSKPKGSVLA  1069

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE I++SL+ITCRDVAGENCVEG K TVLW+GVLNGI +EVPPLQE
Sbjct  1070  HDMTPMEVLVRNNTKEMIRMSLNITCRDVAGENCVEGTKATVLWSGVLNGITIEVPPLQE  1129

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA I+DAN++LRARA+ +S +E IFCRGPPFH+RV GT
Sbjct  1130  SKHSFSLYFLVPGEYTLIAAALIEDANDLLRARAKTNSPEEPIFCRGPPFHVRVIGT  1186



>ref|XP_007225443.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
 gb|EMJ26642.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
Length=1200

 Score =   245 bits (625),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKEF-DMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE        ++Q +S A K SV
Sbjct  1021  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHNSPNVQVHSAAAKGSV  1080

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENCVEG K TVL +GVL+GI +EVP L
Sbjct  1081  LAHEMTPMEVVVRNNTKEKIKMSLSITCRDVAGENCVEGTKATVLCSGVLSGINVEVPSL  1140

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             QEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  1141  QEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  1199



>ref|XP_010265703.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Nelumbo nucifera]
Length=1204

 Score =   244 bits (623),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI---DVPKEFDMQNNSLACKSS  500
             EL+IKDAIQAALQ+SVMD+LLPDPLTFGF L++NGS ++   D  KE D+  +S   K S
Sbjct  1024  ELSIKDAIQAALQTSVMDILLPDPLTFGFRLSENGSQQVAMLDSSKESDIPVSSSVSKGS  1083

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V+AHEM PMEVLVRNNTKE I++SLSITCRDVAGENC+EG K+TVLWAGVL+ I +EV P
Sbjct  1084  VLAHEMIPMEVLVRNNTKEIIRMSLSITCRDVAGENCIEGSKSTVLWAGVLSEIQVEVSP  1143

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             LQEIKH FS+YFL+PGEYTL AAA I+DAN++LRARAR  S DE IFC GPPFHIRV G+
Sbjct  1144  LQEIKHSFSLYFLLPGEYTLAAAAVINDANDVLRARARTDSPDEPIFCCGPPFHIRVIGS  1203



>ref|XP_011458837.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X3 [Fragaria vesca subsp. vesca]
Length=978

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPKEFDMQNNSLACKSSV  497
            ELNIKDA+QAALQ+SVMDVLLPDPLTFGF L+++G  PE ID  ++ + + NS A K SV
Sbjct  799  ELNIKDAVQAALQTSVMDVLLPDPLTFGFRLSRSGPGPENIDSHEKSNDEVNSSASKGSV  858

Query  496  IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
            +AHEMTPMEV+VRNNTKE IK+SL++ CRDVAGE+CVE  K TVL +GVL+GI +E+PPL
Sbjct  859  MAHEMTPMEVMVRNNTKELIKMSLNVVCRDVAGEDCVECAKATVLCSGVLSGITVEIPPL  918

Query  316  QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
            +EIKH FS+YFLVPGEYTL+AAA I+DA +ILRARAR +SSDE IFC GPP+H+RV GT
Sbjct  919  EEIKHSFSLYFLVPGEYTLIAAAMIEDATDILRARARTTSSDEPIFCHGPPYHVRVVGT  977



>ref|XP_008219549.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Prunus mume]
Length=1201

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKEF-DMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE        ++Q +S A K SV
Sbjct  1022  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHNSPNVQVHSAAAKGSV  1081

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SL ITCRDVAGENCVEG K TVL +GVL+GI +EVP L
Sbjct  1082  LAHEMTPMEVVVRNNTKEKIKMSLGITCRDVAGENCVEGTKATVLCSGVLSGITVEVPSL  1141

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             QEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  1142  QEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  1200



>ref|XP_003550201.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Glycine max]
Length=1198

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 7/181 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSL----ACKS  503
             ELNIK+AI AALQ+SVMDVLLPDPLTFGF L ++GS   +  K +  +++ L    A K 
Sbjct  1020  ELNIKEAILAALQTSVMDVLLPDPLTFGFRLVRDGS---ESGKPYSDKDSELVESPASKG  1076

Query  502   SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVP  323
             SVIAHEMTPMEVLVRNNTK+ IK+SL+ITCRDVAGENCV+G K TVLW GVL+ I ME+P
Sbjct  1077  SVIAHEMTPMEVLVRNNTKDMIKMSLNITCRDVAGENCVDGTKATVLWTGVLSDITMEIP  1136

Query  322   PLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             PLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E IFCRGPP+H+RV G
Sbjct  1137  PLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAEPIFCRGPPYHVRVLG  1196

Query  142   T  140
             T
Sbjct  1197  T  1197



>ref|XP_008219550.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Prunus mume]
Length=1200

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKEF-DMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE        ++Q +S A K SV
Sbjct  1021  ELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHNSPNVQVHSAAAKGSV  1080

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SL ITCRDVAGENCVEG K TVL +GVL+GI +EVP L
Sbjct  1081  LAHEMTPMEVVVRNNTKEKIKMSLGITCRDVAGENCVEGTKATVLCSGVLSGITVEVPSL  1140

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             QEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE IFCRGPP+H+RV GT
Sbjct  1141  QEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPIFCRGPPYHVRVVGT  1199



>ref|XP_004498769.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Cicer arietinum]
Length=1188

 Score =   243 bits (620),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 149/178 (84%), Gaps = 3/178 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG--SPEIDVPKEFDMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTFGF L +NG  S   D  KE D+   S A K SV
Sbjct  1010  ELNIKDAIQAALQTSVMDVLLPDPLTFGFRLVRNGFESDNPDPVKESDLPE-SPASKGSV  1068

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPM V VRNNTK+TI++SL+ITCRDVAGENCV+G K+TVLW GVL+ I ME+PPL
Sbjct  1069  LAHEMTPMVVAVRNNTKDTIQMSLNITCRDVAGENCVDGTKSTVLWTGVLSDITMEIPPL  1128

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             QEI H F ++FLVPGEYTLLAAA IDDAN+ILRARARA+S+ E IFCRGPP+H+RV G
Sbjct  1129  QEINHSFCLHFLVPGEYTLLAAAVIDDANDILRARARATSAAEPIFCRGPPYHLRVLG  1186



>ref|XP_011458836.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X1 [Fragaria vesca subsp. vesca]
Length=1199

 Score =   242 bits (618),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPKEFDMQNNSLACKSSV  497
             ELNIKDA+QAALQ+SVMDVLLPDPLTFGF L+++G  PE ID  ++ + + NS A K SV
Sbjct  1020  ELNIKDAVQAALQTSVMDVLLPDPLTFGFRLSRSGPGPENIDSHEKSNDEVNSSASKGSV  1079

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SL++ CRDVAGE+CVE  K TVL +GVL+GI +E+PPL
Sbjct  1080  MAHEMTPMEVMVRNNTKELIKMSLNVVCRDVAGEDCVECAKATVLCSGVLSGITVEIPPL  1139

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             +EIKH FS+YFLVPGEYTL+AAA I+DA +ILRARAR +SSDE IFC GPP+H+RV GT
Sbjct  1140  EEIKHSFSLYFLVPGEYTLIAAAMIEDATDILRARARTTSSDEPIFCHGPPYHVRVVGT  1198



>ref|XP_004290928.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X2 [Fragaria vesca subsp. vesca]
Length=1198

 Score =   242 bits (618),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPKEFDMQNNSLACKSSV  497
             ELNIKDA+QAALQ+SVMDVLLPDPLTFGF L+++G  PE ID  ++ + + NS A K SV
Sbjct  1019  ELNIKDAVQAALQTSVMDVLLPDPLTFGFRLSRSGPGPENIDSHEKSNDEVNSSASKGSV  1078

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPMEV+VRNNTKE IK+SL++ CRDVAGE+CVE  K TVL +GVL+GI +E+PPL
Sbjct  1079  MAHEMTPMEVMVRNNTKELIKMSLNVVCRDVAGEDCVECAKATVLCSGVLSGITVEIPPL  1138

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             +EIKH FS+YFLVPGEYTL+AAA I+DA +ILRARAR +SSDE IFC GPP+H+RV GT
Sbjct  1139  EEIKHSFSLYFLVPGEYTLIAAAMIEDATDILRARARTTSSDEPIFCHGPPYHVRVVGT  1197



>gb|KEH39853.1| transporter TRS120 [Medicago truncatula]
Length=1183

 Score =   242 bits (617),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE--IDVPKEFDMQNNSLACKSSV  497
             ELNIKDAIQAAL +SVMDVLLPDPLTFGF L K+GS    ID  KE D+   S A KSSV
Sbjct  1005  ELNIKDAIQAALLTSVMDVLLPDPLTFGFKLVKDGSDSDNIDPVKESDLPE-SPASKSSV  1063

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AHEMTPM V+VRNNTK+ IK++L+ITCRDVAGENCV+G K+TVLW GVL+ + +E+PPL
Sbjct  1064  LAHEMTPMVVVVRNNTKDMIKMNLNITCRDVAGENCVDGTKSTVLWTGVLSEVTIEIPPL  1123

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             Q+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARARA+SS E IFCRGPP+H+RV G
Sbjct  1124  QQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARARATSSAEPIFCRGPPYHLRVLG  1181



>ref|XP_010519641.1| PREDICTED: trafficking protein particle complex subunit 9 [Tarenaya 
hassleriana]
Length=1188

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 140/176 (80%), Gaps = 9/176 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQ+SVMDVLLPDPLTFGF L ++GS           Q  SLA K SV A
Sbjct  1019  ELNIKDAIQAALQTSVMDVLLPDPLTFGFRLVRHGS---------GRQPESLASKGSVSA  1069

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
              EMTPMEVLVRNNT E IKLSLS+TCRDVAG+NCVEG   TVLWAG L+ I MEVPPL+E
Sbjct  1070  LEMTPMEVLVRNNTSEAIKLSLSVTCRDVAGQNCVEGADATVLWAGALSEITMEVPPLEE  1129

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             I+H FSMYFLVPGEYT++AAA I+DAN +LRARAR  S +E IFCRGPPFH+ V G
Sbjct  1130  IRHGFSMYFLVPGEYTMVAAAVIEDANNVLRARARTESPEEPIFCRGPPFHVCVTG  1185



>gb|KHG29759.1| Trafficking particle complex subunit 9 [Gossypium arboreum]
Length=1200

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 144/180 (80%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE---IDVPKEFDMQNNSLACKSS  500
             ELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D PKE  +        S 
Sbjct  1020  ELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSPKESSINIQPSMSNSY  1079

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             VI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TVLWAGVL+GI +EVPP
Sbjct  1080  VIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATVLWAGVLSGITIEVPP  1139

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE I CRGPPFH+RV GT
Sbjct  1140  LEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEPISCRGPPFHVRVIGT  1199



>ref|XP_010048925.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Eucalyptus grandis]
Length=1198

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI---DVPKEFDMQNNSLACKSS  500
             ELNIKD IQ ALQSSVMDVLLPDPLTFGF L ++GS +    D+P    +Q    A +  
Sbjct  1018  ELNIKDTIQKALQSSVMDVLLPDPLTFGFRLVRDGSSDAAVPDMPMASMIQVEKTASEGC  1077

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             ++A+E+TPMEVLVRNNTKETI++ LSITCRDVAGENC EG   TVLW+GVLNGI MEVPP
Sbjct  1078  MMANEVTPMEVLVRNNTKETIRMCLSITCRDVAGENCTEGANATVLWSGVLNGITMEVPP  1137

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E KH FS+YFLVPGEYTL+AA+ I+DAN+ILRARA+A S DE I CRGPPFH+ V GT
Sbjct  1138  LKETKHLFSLYFLVPGEYTLVAASVIEDANDILRARAKADSPDEPICCRGPPFHVCVMGT  1197



>ref|XP_010048924.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Eucalyptus grandis]
 gb|KCW81340.1| hypothetical protein EUGRSUZ_C02726 [Eucalyptus grandis]
Length=1202

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI---DVPKEFDMQNNSLACKSS  500
             ELNIKD IQ ALQSSVMDVLLPDPLTFGF L ++GS +    D+P    +Q    A +  
Sbjct  1022  ELNIKDTIQKALQSSVMDVLLPDPLTFGFRLVRDGSSDAAVPDMPMASMIQVEKTASEGC  1081

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             ++A+E+TPMEVLVRNNTKETI++ LSITCRDVAGENC EG   TVLW+GVLNGI MEVPP
Sbjct  1082  MMANEVTPMEVLVRNNTKETIRMCLSITCRDVAGENCTEGANATVLWSGVLNGITMEVPP  1141

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             L+E KH FS+YFLVPGEYTL+AA+ I+DAN+ILRARA+A S DE I CRGPPFH+ V GT
Sbjct  1142  LKETKHLFSLYFLVPGEYTLVAASVIEDANDILRARAKADSPDEPICCRGPPFHVCVMGT  1201



>ref|XP_010665754.1| PREDICTED: trafficking protein particle complex subunit 9 [Beta 
vulgaris subsp. vulgaris]
Length=1185

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 143/177 (81%), Gaps = 9/177 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDA+QAALQ+SVMDVLLPDPLTF F LA++G                   +S V+A
Sbjct  1017  ELNIKDAMQAALQTSVMDVLLPDPLTFAFRLAQDG---------LGANPQRSETESLVLA  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H MTPMEVLVRNNTKE IK++L+ITCRDVAGENC+EG K TVLWAGVLNGI++EVPPLQE
Sbjct  1068  HNMTPMEVLVRNNTKELIKMNLNITCRDVAGENCLEGSKATVLWAGVLNGISLEVPPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             IKH FSMYFLVPGEYTL+AA+ I+DANEILRARAR+ S  E IFCRGPP H+RV G+
Sbjct  1128  IKHPFSMYFLVPGEYTLVAASLINDANEILRARARSDSPTEPIFCRGPPVHLRVCGS  1184



>ref|XP_010105451.1| hypothetical protein L484_003461 [Morus notabilis]
 gb|EXC04752.1| hypothetical protein L484_003461 [Morus notabilis]
Length=1203

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVP--KEFDMQNNSLACKSSV  497
             ELNIKDAIQAALQ+SVMDVLLPDPLTFGF L  + S   D+   K+   Q  S A K SV
Sbjct  1024  ELNIKDAIQAALQTSVMDVLLPDPLTFGFRLLGSISKPDDLGSFKKSTTQVQSPALKGSV  1083

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPL  317
             +AH++TPMEV+VRNNTK+ I++SLSITCRDVAGENC+EG K TVL AGVL+GI MEVPPL
Sbjct  1084  VAHDVTPMEVVVRNNTKDRIRMSLSITCRDVAGENCMEGAKATVLLAGVLSGIRMEVPPL  1143

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             QE+KH FS+ FLVPGEYTL+AAA IDDA++ILRARAR  S DE I CRGPP+H+RV GT
Sbjct  1144  QEVKHSFSLNFLVPGEYTLVAAAMIDDASDILRARARTDSPDEPILCRGPPYHVRVVGT  1202



>ref|XP_002309653.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
 gb|EEE93176.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
Length=1183

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 141/177 (80%), Gaps = 9/177 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELN KDAIQ+AL++S MDVLLPDPLTFGF L +N             ++N    K SV+A
Sbjct  1015  ELNTKDAIQSALKTSAMDVLLPDPLTFGFRLVRN---------NLSQESNDSRPKGSVLA  1065

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTKE I++SLSITCRDVAGENCVE  K TVLW+GVLNGI +E PPL+E
Sbjct  1066  HDMTPMEVLVRNNTKEMIRMSLSITCRDVAGENCVEDTKATVLWSGVLNGITIEAPPLKE  1125

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              KH FS+YFLVPGEYTL+AAA ++DAN+ILRARA+ +S DE IFCRGPPF +RV GT
Sbjct  1126  SKHSFSLYFLVPGEYTLVAAAVVEDANDILRARAKTNSPDEPIFCRGPPFRVRVIGT  1182



>ref|XP_010942155.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
 ref|XP_010942156.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
Length=1207

 Score =   236 bits (603),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 144/187 (77%), Gaps = 11/187 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI----------DVPKEFDMQNN  521
             ELNIKDA Q ALQ+SVMD+LLPDPLTFGF LAKNG+ +I          D P    +  N
Sbjct  1021  ELNIKDATQPALQASVMDILLPDPLTFGFRLAKNGA-QINGFSEESIISDDPPSQCVNGN  1079

Query  520   SLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNG  341
              + CK  + AHEMT MEVLVRNNT+E I++SLS+TCRDVAGENC EG+  TVLWAGVLN 
Sbjct  1080  VIKCKGCISAHEMTHMEVLVRNNTREMIQMSLSVTCRDVAGENCTEGNNATVLWAGVLND  1139

Query  340   IAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPF  161
             I +EVPPL+E+KH FS+YFLVPGEYTLLAA+ I+DA ++LRARAR  S DE IFCRG PF
Sbjct  1140  IPLEVPPLEEVKHAFSLYFLVPGEYTLLAASIINDATDVLRARARTDSPDEPIFCRGSPF  1199

Query  160   HIRVNGT  140
             H+ V GT
Sbjct  1200  HVYVVGT  1206



>emb|CDX97076.1| BnaC09g45490D [Brassica napus]
Length=1183

 Score =   236 bits (602),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 9/176 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NGS         + +  S   K SV++
Sbjct  1014  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNGS---------EKKAQSPLSKGSVLS  1064

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1065  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWAGALSGISMEVAPLQE  1124

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1125  TRHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVTG  1180



>ref|XP_006399603.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
 gb|ESQ41056.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
Length=1187

 Score =   236 bits (602),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 143/176 (81%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG     +  + + +  S + K SV++
Sbjct  1014  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNG-----LETDSETKTQSPSSKGSVLS  1068

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC +G   TVLWAG L+GI+MEV PLQE
Sbjct  1069  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCADGADATVLWAGALSGISMEVAPLQE  1128

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1129  TRHRFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVTG  1184



>gb|KFK37733.1| hypothetical protein AALP_AA3G022200 [Arabis alpina]
Length=1187

 Score =   236 bits (602),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 143/176 (81%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NGS E D     + +  S + K SV++
Sbjct  1014  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNGS-ETDS----ETKAQSPSSKGSVLS  1068

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1069  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWAGALSGISMEVAPLQE  1128

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+Y LVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1129  TRHRFSLYILVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVTG  1184



>ref|XP_009122000.1| PREDICTED: trafficking protein particle complex subunit 9 [Brassica 
rapa]
Length=1183

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 9/176 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG+         + +  S   K SV++
Sbjct  1014  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNGA---------ETKAQSPLSKGSVLS  1064

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1065  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWAGALSGISMEVAPLQE  1124

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1125  TRHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVTG  1180



>emb|CDX69788.1| BnaA10g21370D [Brassica napus]
Length=1183

 Score =   233 bits (595),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 9/176 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S         + +  S   K SV++
Sbjct  1014  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNDS---------ETKAQSPLSKGSVLS  1064

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1065  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWAGALSGISMEVAPLQE  1124

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1125  TRHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTTSPNEPIFCRGPPFHVRVTG  1180



>ref|XP_008452884.1| PREDICTED: transport protein particle subunit trs120 [Cucumis 
melo]
Length=1196

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 4/177 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAI AALQSS+MDVLLPDPLTFGF    N        KE D   +S++ +SS+ A
Sbjct  1023  ELNIKDAILAALQSSMMDVLLPDPLTFGFRTVSNSLER----KESDQNLHSVSSQSSLEA  1078

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HEMTP+EV+VRNNTKE IK+SL+ITCRDVAGE+CVEG K+TVLW GVL+GI +EVPPL+E
Sbjct  1079  HEMTPLEVIVRNNTKEMIKMSLNITCRDVAGESCVEGAKSTVLWNGVLSGITLEVPPLEE  1138

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
               H FS+YFL+PGEYTL AAA IDDA +ILRARAR SS DE IFC GPP+H+ VNGT
Sbjct  1139  TAHSFSLYFLIPGEYTLSAAAIIDDATDILRARARTSSPDEPIFCCGPPYHLCVNGT  1195



>ref|XP_011039615.1| PREDICTED: trafficking protein particle complex subunit 9 [Populus 
euphratica]
Length=1182

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 140/177 (79%), Gaps = 9/177 (5%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELN KDA+Q+AL++S MDVLLPDPLTFGF L +N             ++N    K SV+A
Sbjct  1014  ELNTKDAMQSALKTSAMDVLLPDPLTFGFRLVRN---------NLSKESNDSRPKGSVLA  1064

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             H+MTPMEVLVRNNTK+ I++SLSITCRDVAGENCVE  K TVLW+GVLNGI +E PPL+E
Sbjct  1065  HDMTPMEVLVRNNTKDMIRMSLSITCRDVAGENCVEDTKATVLWSGVLNGITIEAPPLKE  1124

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
              +H FS+YFLVPGEYTL+A A ++DAN+ILRARA+ +S DE IFCRGPPF +RV GT
Sbjct  1125  SQHSFSLYFLVPGEYTLVATAVVEDANDILRARAKTNSPDEPIFCRGPPFRVRVIGT  1181



>ref|XP_009381560.1| PREDICTED: trafficking protein particle complex subunit 9 [Musa 
acuminata subsp. malaccensis]
Length=1213

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 147/188 (78%), Gaps = 11/188 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG--SPEIDVPKEFDMQNNS-------  518
             ELNIKDA QAALQ+S+MD+LLPDPLTFGF L +NG  S  I  P+E  + +N        
Sbjct  1025  ELNIKDATQAALQASIMDILLPDPLTFGFRLGENGTASENIVSPEESSISDNPPGQPGSR  1084

Query  517   --LACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLN  344
                  K SV+AHEMT MEV++RNNTKE IK+SL+++CRDVAGENC+EG+K TVLWAG L+
Sbjct  1085  NVARAKGSVLAHEMTRMEVIIRNNTKERIKMSLNVSCRDVAGENCIEGNKATVLWAGTLS  1144

Query  343   GIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPP  164
              I++E PPLQ+I H F++YFLVPG+YTLLAAA I+DA ++LRARA++ SSDE IFCRG P
Sbjct  1145  DISLEAPPLQDITHSFALYFLVPGDYTLLAAAVINDATDVLRARAKSDSSDEPIFCRGSP  1204

Query  163   FHIRVNGT  140
             FH+ V GT
Sbjct  1205  FHVHVVGT  1212



>ref|XP_002871450.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47709.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1186

 Score =   231 bits (590),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG     + ++ + +  S   K SV++
Sbjct  1013  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNG-----LERDSETKAESPFSKGSVLS  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1068  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+ V G
Sbjct  1128  ARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVCVAG  1183



>ref|XP_006286929.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19827.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=792

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 139/179 (78%), Gaps = 11/179 (6%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVPKEFDMQNNSLACKSS  500
            EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N      E   P  F         K S
Sbjct  619  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNSLEMDSETKAPSPFP--------KGS  670

Query  499  VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
            V++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI++EV P
Sbjct  671  VLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISIEVAP  730

Query  319  LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
            LQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  731  LQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVVG  789



>ref|XP_008784808.1| PREDICTED: trafficking protein particle complex subunit 9 [Phoenix 
dactylifera]
Length=1209

 Score =   231 bits (589),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 142/188 (76%), Gaps = 11/188 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-------PEIDV----PKEFDMQN  524
             ELNIKDA Q ALQ+SVMD+LLPDPLTFGF LAKNG+       PE  +    P    +  
Sbjct  1021  ELNIKDATQPALQASVMDILLPDPLTFGFRLAKNGATARINGFPEESIISGDPPSQCVNG  1080

Query  523   NSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLN  344
             + + CK S+ AHEMT MEVLVRNNTKE I++SL + CRDVAGENC EG+  TVLWAGVLN
Sbjct  1081  SVVKCKGSISAHEMTHMEVLVRNNTKEMIQMSLCVACRDVAGENCTEGNNATVLWAGVLN  1140

Query  343   GIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPP  164
              I +EVPPL+E++H FS+YFLVPGEYTL AA+ I+DA ++LRARAR  S DE IFCRG P
Sbjct  1141  DIRLEVPPLEEVEHAFSLYFLVPGEYTLQAASVINDATDVLRARARTDSPDEPIFCRGSP  1200

Query  163   FHIRVNGT  140
             FH+ V GT
Sbjct  1201  FHVHVVGT  1208



>ref|XP_006286927.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19825.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=982

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 139/179 (78%), Gaps = 11/179 (6%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVPKEFDMQNNSLACKSS  500
            EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N      E   P  F         K S
Sbjct  809  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNSLEMDSETKAPSPFP--------KGS  860

Query  499  VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
            V++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI++EV P
Sbjct  861  VLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISIEVAP  920

Query  319  LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
            LQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  921  LQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVVG  979



>ref|NP_196665.1| protein TRS120 [Arabidopsis thaliana]
 sp|Q9FY61.1|TR120_ARATH RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=AtTRS120; Short=TRAPP II-specific 
subunit 120 homolog; AltName: Full=Protein VASCULAR NETWORK 
DEFECTIVE 4 [Arabidopsis thaliana]
 emb|CAC03452.1| putative protein [Arabidopsis thaliana]
 gb|AED91628.1| protein TRS120 [Arabidopsis thaliana]
Length=1186

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG     + K+ + +  S   K SV++
Sbjct  1013  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNG-----LEKDPETKAESPFSKGSVLS  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1068  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS++FLVPGEYT++AAA I+DAN +LRARA  +S +E IFCRGPPFH+ V G
Sbjct  1128  ARHCFSLFFLVPGEYTMVAAAVIEDANNVLRARAGTASPNEPIFCRGPPFHVCVAG  1183



>ref|XP_006286928.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19826.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=1186

 Score =   229 bits (583),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 139/179 (78%), Gaps = 11/179 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVPKEFDMQNNSLACKSS  500
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N      E   P  F         K S
Sbjct  1013  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNSLEMDSETKAPSPFP--------KGS  1064

Query  499   VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPP  320
             V++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI++EV P
Sbjct  1065  VLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISIEVAP  1124

Query  319   LQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
             LQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1125  LQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVVG  1183



>ref|XP_004145518.1| PREDICTED: uncharacterized protein LOC101217047 [Cucumis sativus]
 ref|XP_004157090.1| PREDICTED: uncharacterized LOC101217047 [Cucumis sativus]
 gb|KGN55459.1| hypothetical protein Csa_4G652710 [Cucumis sativus]
Length=1196

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 145/178 (81%), Gaps = 6/178 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQN-NSLACKSSVI  494
             ELNIKDAI AALQSS+MDVLLPDPLTFGF    N      + ++   QN ++++ +SS+ 
Sbjct  1023  ELNIKDAILAALQSSMMDVLLPDPLTFGFRTVTNS-----LDRKESYQNLHTVSSQSSLE  1077

Query  493   AHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQ  314
             AHEMTP+EV+VRNNTKE IK+SL+ITCRDVAGE+CVEG K+TVLW GVL+GI +EVPPL+
Sbjct  1078  AHEMTPLEVIVRNNTKEMIKMSLNITCRDVAGESCVEGAKSTVLWNGVLSGITLEVPPLE  1137

Query  313   EIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             E  H FS+YFL+PGEYTL AAA IDDA +ILRARAR SS DE IFC GPP+H+ VNGT
Sbjct  1138  ETAHSFSLYFLIPGEYTLSAAAIIDDATDILRARARTSSPDEPIFCCGPPYHLCVNGT  1195



>ref|XP_010453144.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Camelina sativa]
Length=1186

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S E D     + +  S     SV++
Sbjct  1013  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRN-SLETDS----ETKAQSPFPTGSVLS  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1068  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1128  ARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVVG  1183



>ref|XP_010491799.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1196

 Score =   228 bits (581),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S E D     + +  S   K SV++
Sbjct  1023  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRN-SLETDS----ETKAQSPFPKGSVLS  1077

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1078  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQE  1137

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGP FH+RV G
Sbjct  1138  ARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPSFHVRVVG  1193



>ref|XP_010491797.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
Length=1186

 Score =   228 bits (580),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S E D     + +  S   K SV++
Sbjct  1013  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRN-SLETDS----ETKAQSPFPKGSVLS  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE
Sbjct  1068  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGP FH+RV G
Sbjct  1128  ARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPSFHVRVVG  1183



>ref|XP_010419658.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
 ref|XP_010419659.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1186

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ ALQ++VMDVLLPDPLTFGF L ++ S E D     + +  S   K SV++
Sbjct  1013  ELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRD-SLETDS----ETKAQSPFPKGSVLS  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWAG L GI+MEV PLQE
Sbjct  1068  HEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGAVATVLWAGALCGISMEVAPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
              +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFCRGPPFH+RV G
Sbjct  1128  ARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFCRGPPFHVRVVG  1183



>ref|XP_006848818.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
 gb|ERN10399.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
Length=1207

 Score =   226 bits (575),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 144/189 (76%), Gaps = 14/189 (7%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN--GSPEIDVPKEF----------DMQ  527
             ELNIKDA+QAALQ+++MD+LLPDPLTFGF L++N   +  +D  +            D +
Sbjct  1020  ELNIKDAVQAALQTTIMDILLPDPLTFGFRLSRNKFSTGPLDAQQNARSHGRHHSGEDGR  1079

Query  526   NNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVL  347
                L C  S++AHEMTPMEVLVRNNTKE +K+SLSITC+DVAG+NC +GDK TVLWAGVL
Sbjct  1080  TKVLNC--SILAHEMTPMEVLVRNNTKELVKMSLSITCKDVAGDNCFDGDKATVLWAGVL  1137

Query  346   NGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGP  167
             +GI ++VPPLQEI H F MYFLVPGEYTL+ +A IDDA++ LR RAR  SS+E IFC GP
Sbjct  1138  SGIRVDVPPLQEITHSFVMYFLVPGEYTLMGSAVIDDASDFLRDRARTDSSNEPIFCSGP  1197

Query  166   PFHIRVNGT  140
             PF + V GT
Sbjct  1198  PFRLHVLGT  1206



>ref|XP_010453143.1| PREDICTED: uncharacterized protein LOC104735118 [Camelina sativa]
Length=158

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = -1

Query  622  MDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKE  443
            MDVLLPDPLTFGF L +N S E D     + +  S     SV++HE+TPMEVLVRNNT E
Sbjct  1    MDVLLPDPLTFGFRLVRN-SLETDS----ETKAQSPFPTGSVLSHEVTPMEVLVRNNTSE  55

Query  442  TIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYT  263
             IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE +H FS+YFLVPGEYT
Sbjct  56   AIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQEARHCFSLYFLVPGEYT  115

Query  262  LLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
            ++AAA I+DAN +LRARAR +SS+E IFCRGPPFH+RV G
Sbjct  116  MVAAAVIEDANNVLRARARTASSNEPIFCRGPPFHVRVVG  155



>ref|XP_002446750.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
 gb|EES11078.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
Length=1163

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 4/178 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP-EIDVPKEFDMQNNSLACKSSVI  494
             ELNIKDAIQAALQ+S+MD+LLPDPLTF F LAKNG+    D  K+F    + L CK  + 
Sbjct  988   ELNIKDAIQAALQASIMDILLPDPLTFSFKLAKNGTVINDDSSKDF---GSVLRCKDPIS  1044

Query  493   AHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQ  314
             AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWAGVL+ I +EVPPLQ
Sbjct  1045  AHEMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFDENSATVLWAGVLSDIHLEVPPLQ  1104

Query  313   EIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             E+ H FSMYFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHIRV GT
Sbjct  1105  EVIHPFSMYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIRVVGT  1162



>tpg|DAA37075.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1163

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 4/178 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP-EIDVPKEFDMQNNSLACKSSVI  494
             ELNIKDAIQ ALQ+S+MD+LLPDPL F F L  NG+   +D PK+     N L CK  + 
Sbjct  988   ELNIKDAIQTALQASIMDILLPDPLMFSFKLVTNGTVVNVDSPKD---SGNVLRCKDPIS  1044

Query  493   AHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQ  314
             AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWAGVL+ I +EVPPLQ
Sbjct  1045  AHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIHLEVPPLQ  1104

Query  313   EIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             E+ H FSMYFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHIRV GT
Sbjct  1105  EVVHPFSMYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIRVVGT  1162



>ref|XP_008669201.1| PREDICTED: trafficking protein particle complex subunit 9 [Zea 
mays]
 tpg|DAA37076.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1178

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 4/178 (2%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP-EIDVPKEFDMQNNSLACKSSVI  494
             ELNIKDAIQ ALQ+S+MD+LLPDPL F F L  NG+   +D PK+     N L CK  + 
Sbjct  1003  ELNIKDAIQTALQASIMDILLPDPLMFSFKLVTNGTVVNVDSPKD---SGNVLRCKDPIS  1059

Query  493   AHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQ  314
             AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWAGVL+ I +EVPPLQ
Sbjct  1060  AHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIHLEVPPLQ  1119

Query  313   EIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             E+ H FSMYFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHIRV GT
Sbjct  1120  EVVHPFSMYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIRVVGT  1177



>gb|EMS61444.1| hypothetical protein TRIUR3_09999 [Triticum urartu]
Length=1134

 Score =   213 bits (543),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 6/183 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQ------NNSLAC  509
             ELNIKDAIQAALQ+S++D+LLPDPLTF F LAK+  P  D     D         N L C
Sbjct  951   ELNIKDAIQAALQASILDILLPDPLTFSFRLAKDAKPVNDSNHSTDENVGPSAGENVLRC  1010

Query  508   KSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAME  329
             K  + AH+MT MEV +RNNTKE I+++LSI+C+DVAGENC E +  TVLWAGVLN I +E
Sbjct  1011  KDPISAHKMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFEENSATVLWAGVLNDIQLE  1070

Query  328   VPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRV  149
             VPPLQE+ H FS+YFLVPG+Y+L +++ I DA ++LRARA+A S DE I CRG PFHI V
Sbjct  1071  VPPLQEVVHPFSVYFLVPGDYSLQSSSVIIDATDVLRARAKAESPDEPILCRGSPFHIHV  1130

Query  148   NGT  140
              GT
Sbjct  1131  VGT  1133



>dbj|BAJ94931.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1019

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 138/184 (75%), Gaps = 8/184 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQN-------NSLA  512
             ELNIKDAIQAALQ+S++D+LLPDPLTF F LAK+  P  D      ++N       N L 
Sbjct  836   ELNIKDAIQAALQASILDILLPDPLTFSFRLAKDAKPAND-SSHSTVENVGPFTGENVLR  894

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + AH+MT MEV +RNNTKE I+++LSI+C+DVAGENC E +  TVLWAGVLN I +
Sbjct  895   CKDPISAHKMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFEENSATVLWAGVLNDIQL  954

Query  331   EVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIR  152
             EVPPLQE+ H FS+YFLVPG+Y+L +++ I DA ++LRARA+A S DE I CRG PFHI 
Sbjct  955   EVPPLQEVMHPFSVYFLVPGDYSLQSSSVIIDATDVLRARAKAESPDEPILCRGSPFHIH  1014

Query  151   VNGT  140
             V GT
Sbjct  1015  VVGT  1018



>gb|EPS63566.1| hypothetical protein M569_11217, partial [Genlisea aurea]
Length=1100

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 13/177 (7%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL+IKDAIQ+ALQ+SVMDVLLPDPLTFGF L+K G              +S +  + V+A
Sbjct  934   ELDIKDAIQSALQASVMDVLLPDPLTFGFRLSKTG-------------GDSASAAAVVVA  980

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             +EMT ME LVRNNT ET+++SLSI C+DVAGE C++G + TVLW GVL G++ME+PPL+E
Sbjct  981   NEMTTMEALVRNNTMETLEISLSIACKDVAGEKCMDGGRATVLWEGVLTGVSMEIPPLRE  1040

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             + H FS++FL+PG+YT+LAAA I DANE+LRARAR +SSDE I CRGPPF +RV+GT
Sbjct  1041  VGHVFSLFFLIPGDYTVLAAAVIKDANEVLRARARTTSSDEPIVCRGPPFRLRVDGT  1097



>gb|EMT13211.1| hypothetical protein F775_03305 [Aegilops tauschii]
Length=1214

 Score =   212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 6/183 (3%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF------DMQNNSLAC  509
             ELNIKDAIQAALQ+S++D+LLPDPLTF F LAK+  P  D               N L C
Sbjct  1031  ELNIKDAIQAALQASILDILLPDPLTFSFRLAKDAKPANDSSHSTVENVGPSAGENVLRC  1090

Query  508   KSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAME  329
             K  + AH+MT MEV +RNNTKE I+++LSI+C+DVAGENC E +  TVLWAGVLN I +E
Sbjct  1091  KDPISAHKMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFEENSATVLWAGVLNDIQLE  1150

Query  328   VPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRV  149
             VPPLQE+ H FS+YFLVPG+Y+L +++ I DA ++LRARA+A SSDE I CRG PFHI V
Sbjct  1151  VPPLQEVIHPFSVYFLVPGDYSLQSSSVIIDATDVLRARAKAESSDEPILCRGSPFHIHV  1210

Query  148   NGT  140
              GT
Sbjct  1211  VGT  1213



>ref|XP_010227185.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9 [Brachypodium distachyon]
Length=1210

 Score =   209 bits (532),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 138/190 (73%), Gaps = 13/190 (7%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVP---KEFDMQNNS------  518
             ELNIKDAIQAALQ+S+MD+LLPDPLTF F LAK+G+    V     +F    N       
Sbjct  1020  ELNIKDAIQAALQASIMDILLPDPLTFSFRLAKDGTMAKTVSASANDFSHSTNENACPST  1079

Query  517   ----LACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGV  350
                 L CK  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWAGV
Sbjct  1080  GESVLRCKDPISAHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWAGV  1139

Query  349   LNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRG  170
             L+ I +EVPPLQE+ H FS+YFLVPG+Y+L A++ I DA ++LRARA+A S DE I CRG
Sbjct  1140  LSDIQVEVPPLQELVHPFSVYFLVPGDYSLQASSVIIDATDVLRARAKAESPDEPILCRG  1199

Query  169   PPFHIRVNGT  140
              PFHI V GT
Sbjct  1200  SPFHIHVVGT  1209



>ref|XP_004976133.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Setaria italica]
Length=1185

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 134/177 (76%), Gaps = 11/177 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQ+S+MD+LLPDPLTF F LAKNG+             N  + K  + A
Sbjct  1019  ELNIKDAIQAALQASIMDILLPDPLTFSFKLAKNGA-----------VTNVDSSKDPISA  1067

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWAGVL+ I +EV PLQE
Sbjct  1068  HEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIHLEVLPLQE  1127

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             + H FS+YFLVPG+Y+L A++ I DA ++LRARA+A S DE I CRG PFHIRV GT
Sbjct  1128  VVHPFSVYFLVPGDYSLQASSVIIDATDVLRARAKAESPDEPILCRGSPFHIRVVGT  1184



>ref|XP_004976134.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Setaria italica]
Length=1182

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 134/177 (76%), Gaps = 11/177 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             ELNIKDAIQAALQ+S+MD+LLPDPLTF F LAKNG+             N  + K  + A
Sbjct  1016  ELNIKDAIQAALQASIMDILLPDPLTFSFKLAKNGA-----------VTNVDSSKDPISA  1064

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             HEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWAGVL+ I +EV PLQE
Sbjct  1065  HEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIHLEVLPLQE  1124

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNGT  140
             + H FS+YFLVPG+Y+L A++ I DA ++LRARA+A S DE I CRG PFHIRV GT
Sbjct  1125  VVHPFSVYFLVPGDYSLQASSVIIDATDVLRARAKAESPDEPILCRGSPFHIRVVGT  1181



>gb|AES79528.2| transporter TRS120 [Medicago truncatula]
Length=369

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = -1

Query  616  VLLPDPLTFGFSLAKN--GSPEIDVPKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKE  443
            + L +PLTFGF L ++   S  +D  KE D+   S A KSSV+AHEMT M V+VRNNTK+
Sbjct  209  IALENPLTFGFKLVRDESDSDNLDPVKESDLPE-SPASKSSVLAHEMTSMVVVVRNNTKD  267

Query  442  TIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYT  263
            TIK++L+ITCRDVAGENCV+G K+TVLW GVL+ I +E+PPL +IKH F ++FLVPGEYT
Sbjct  268  TIKINLNITCRDVAGENCVDGTKSTVLWTGVLSEITVEIPPLHQIKHSFCLHFLVPGEYT  327

Query  262  LLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  143
            LLAAA IDDAN+ILRARARA+SS E IFCRGPP+H+RV G
Sbjct  328  LLAAAVIDDANDILRARARATSSAEPIFCRGPPYHLRVLG  367



>ref|NP_001053234.1| Os04g0502200 [Oryza sativa Japonica Group]
 sp|Q0JBY9.1|TR120_ORYSJ RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=TRAPP II-specific subunit 120 homolog 
[Oryza sativa Japonica Group]
 dbj|BAF15148.1| Os04g0502200 [Oryza sativa Japonica Group]
Length=1187

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 139/184 (76%), Gaps = 7/184 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE-FDMQNNS-----LA  512
             ELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE  D  + S     L 
Sbjct  1003  ELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKEPGDGSSRSADESVLR  1062

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +  TVLWAGVL+ I +
Sbjct  1063  CKDPIFANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIYL  1122

Query  331   EVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIR  152
             EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHI 
Sbjct  1123  EVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIH  1182

Query  151   VNGT  140
             V GT
Sbjct  1183  VVGT  1186



>gb|EEC77580.1| hypothetical protein OsI_16530 [Oryza sativa Indica Group]
Length=1167

 Score =   206 bits (524),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 139/184 (76%), Gaps = 7/184 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE-FDMQNNS-----LA  512
             ELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE  D  + S     L 
Sbjct  983   ELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKEPGDGSSRSADESVLR  1042

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +  TVLWAGVL+ I +
Sbjct  1043  CKDPIFANEMTHMEVQIRNNTKETIQMNLSISCKDVAGENCFDENSATVLWAGVLSDIYL  1102

Query  331   EVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIR  152
             EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHI 
Sbjct  1103  EVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIH  1162

Query  151   VNGT  140
             V GT
Sbjct  1163  VVGT  1166



>emb|CAH67557.1| H0311C03.11 [Oryza sativa Indica Group]
Length=1187

 Score =   206 bits (523),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 139/184 (76%), Gaps = 7/184 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE-FDMQNNS-----LA  512
             ELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE  D  + S     L 
Sbjct  1003  ELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKEPGDGSSRSADESVLR  1062

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +  TVLWAGVL+ I +
Sbjct  1063  CKDPIFANEMTHMEVQIRNNTKETIQMNLSISCKDVAGENCFDENSATVLWAGVLSDIYL  1122

Query  331   EVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIR  152
             EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHI 
Sbjct  1123  EVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIH  1182

Query  151   VNGT  140
             V GT
Sbjct  1183  VVGT  1186



>ref|XP_006653574.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Oryza brachyantha]
Length=1113

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 135/184 (73%), Gaps = 7/184 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE-------IDVPKEFDMQNNSLA  512
             ELNIKDAIQAALQ+S+MD+LLPDPLTF F  AK+G+                   ++ L 
Sbjct  929   ELNIKDAIQAALQASIMDILLPDPLTFSFRHAKDGTSAKTDSSEEPSDDSSHSANDSVLR  988

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +  TVLWAGVL+ I +
Sbjct  989   CKDPISANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIYL  1048

Query  331   EVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIR  152
             EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHI 
Sbjct  1049  EVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHIH  1108

Query  151   VNGT  140
             V GT
Sbjct  1109  VVGT  1112



>gb|EEE61278.1| hypothetical protein OsJ_15360 [Oryza sativa Japonica Group]
Length=1247

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 136/179 (76%), Gaps = 7/179 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE-FDMQNNS-----LA  512
             ELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE  D  + S     L 
Sbjct  984   ELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKEPGDGSSRSADESVLR  1043

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +  TVLWAGVL+ I +
Sbjct  1044  CKDPIFANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIYL  1103

Query  331   EVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHI  155
             EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S DE I CRG PFHI
Sbjct  1104  EVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPILCRGSPFHI  1162



>ref|XP_009362330.1| PREDICTED: uncharacterized protein LOC103952471 [Pyrus x bretschneideri]
 ref|XP_009362331.1| PREDICTED: uncharacterized protein LOC103952471 [Pyrus x bretschneideri]
Length=153

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = -1

Query  586  FSLAKNGS-PEIDVPK-EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITC  413
            + L++NG  PE      E +   +  A K S +AHE+  MEV+VRNNTKE IK+SLSITC
Sbjct  3    YHLSRNGRVPETSGSHTEPNFHGHPFASKGSALAHEIIAMEVMVRNNTKEMIKMSLSITC  62

Query  412  RDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDA  233
            RDVAGENCVE  K TVL +GVL+GI  EVPPL+EIKH  S+YFLV GEYTL+AA+ IDDA
Sbjct  63   RDVAGENCVECTKATVLCSGVLSGITAEVPPLREIKHSLSLYFLVLGEYTLVAASVIDDA  122

Query  232  NEILrararassSDESIFCRGPPFHIRVNGT  140
            N+ILRARAR  SSDE I CRGPP+H+RV GT
Sbjct  123  NDILRARARTKSSDEPILCRGPPYHVRVVGT  153



>ref|XP_007011773.1| Trafficking protein particle complex subunit 9 isoform 2 [Theobroma 
cacao]
 gb|EOY29392.1| Trafficking protein particle complex subunit 9 isoform 2 [Theobroma 
cacao]
Length=1057

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVPKEFDMQNNSLACKSS  500
            ELNIKDAIQAALQSSVMDVLLPDPLTFGF LA+NGS    ++D+PKE +      A K+ 
Sbjct  857  ELNIKDAIQAALQSSVMDVLLPDPLTFGFRLARNGSENASKLDLPKELNTSIQPSASKNF  916

Query  499  VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAG  353
            VIAH+MTPMEVLVRNNTKETIK++LS+TCRDVAGENCVEG K TVLWAG
Sbjct  917  VIAHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGENCVEGTKATVLWAG  965



>ref|XP_001774293.1| predicted protein [Physcomitrella patens]
 gb|EDQ60929.1| predicted protein [Physcomitrella patens]
Length=1118

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 18/176 (10%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL IKDA++ ALQ+SV+ +LLPDPLTFGF LAK       +    D  N     K  +  
Sbjct  955   ELPIKDALREALQASVLKILLPDPLTFGFRLAKTSISAPSLRSARDSDN-----KGGIGV  1009

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVE--GDKTTVLWAGVLNGIAMEVPPL  317
              E+TP+E+LVRNNT E++K++LS+TCRDV G +C+   G K TVLWAG L+G+ +EV  L
Sbjct  1010  RELTPIEMLVRNNTNESVKMTLSVTCRDVTGTSCMSAAGAKATVLWAGTLDGVDVEVGAL  1069

Query  316   QEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRV  149
              E  H F++ FLVPG+YTLL +A ID              + E++   GPPF + V
Sbjct  1070  GEAVHRFALCFLVPGQYTLLGSAVIDS-----------QPTHEALSYTGPPFAVHV  1114



>gb|EYU32375.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1153

 Score =   145 bits (367),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 5/113 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP----EIDVPKEFDMQNNSLACKS  503
             EL+IKDAIQAALQ+SV+DVLLPDPLTFGF LAK+ S     + + PK+ DM N S   + 
Sbjct  1041  ELDIKDAIQAALQASVLDVLLPDPLTFGFRLAKSTSDLSIMKQNSPKKTDMVN-SCGTEG  1099

Query  502   SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLN  344
             S++AH+MT MEVLVRNNTK  I+++LS+TC+DVAGENC+EGDK TVLW G  N
Sbjct  1100  SIVAHDMTAMEVLVRNNTKGAIRINLSVTCKDVAGENCIEGDKATVLWEGANN  1152



>emb|CAE01639.1| OSJNBa0029H02.30 [Oryza sativa Japonica Group]
Length=1193

 Score =   145 bits (367),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE-FDMQNNS-----LA  512
             ELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE  D  + S     L 
Sbjct  983   ELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKEPGDGSSRSADESVLR  1042

Query  511   CKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAM  332
             CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +  TVLWAGVL+ I +
Sbjct  1043  CKDPIFANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDENSATVLWAGVLSDIYL  1102

Query  331   EVPPLQE  311
             EV PLQE
Sbjct  1103  EVQPLQE  1109



>ref|XP_001777714.1| predicted protein [Physcomitrella patens]
 gb|EDQ57494.1| predicted protein [Physcomitrella patens]
Length=1123

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 107/178 (60%), Gaps = 18/178 (10%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLAC--KSSV  497
             EL IKDA++ ALQ+SV+ +LLPD LTFGF LAK     I  P      +  L+   K   
Sbjct  956   ELPIKDALREALQASVLKILLPDSLTFGFRLAKT---SISAPSLRSADDGGLSTDNKGGF  1012

Query  496   IAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCV--EGDKTTVLWAGVLNGIAMEVP  323
                E+ P+E+LVRNNT E +K++LS+TCRDV G +C+   G K TVLWAG L+ + +EV 
Sbjct  1013  GVRELAPIEMLVRNNTNEAVKMTLSVTCRDVTGTSCLGAAGTKATVLWAGTLDRVNVEVG  1072

Query  322   PLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRV  149
              L E+ H FS+ FLVPG+YTLL +A I+                E++   GPPF + V
Sbjct  1073  ALGEVVHRFSLCFLVPGQYTLLGSAVINS-----------QPGHEALSYTGPPFAVDV  1119



>ref|XP_009762936.1| PREDICTED: uncharacterized protein LOC104214912 [Nicotiana sylvestris]
Length=209

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 6/106 (6%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPKEFDMQNNSLACKSS  500
            EL+IK+AIQAALQSS+MD+LL DPLTFGF   KN      E+++ +E D+Q    A K S
Sbjct  107  ELHIKEAIQAALQSSMMDILLSDPLTFGFRCGKNTLRDFAELNLDEESDIQG---ARKCS  163

Query  499  VIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  362
            + AH+M P+EVLV NN KE IK+SLSITCRD+ G+NCVEGDK TVL
Sbjct  164  LRAHDMAPIEVLVCNNAKEIIKVSLSITCRDIVGDNCVEGDKATVL  209



>ref|XP_002962206.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
 gb|EFJ37466.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
Length=1091

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 101/174 (58%), Gaps = 36/174 (21%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL++KDAI+ AL+ SV ++LLPDPLTF F LA                         V A
Sbjct  953   ELHLKDAIRDALRDSVREILLPDPLTFAFRLAAG---------------------EDVRA  991

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             +++ P+E+LV+NNT E + +SLS+ CRD++G +CV   +  +L+AG L+G+ +E+  L E
Sbjct  992   NQLVPIEMLVKNNTAEDVAVSLSVACRDISGASCVV--EQQILYAGALDGVEVELSSLGE  1049

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRV  149
               H FS++FLVPGEYTLL AA +                D+SI   GPPF + V
Sbjct  1050  AVHRFSLFFLVPGEYTLLGAAVVS-------------LRDDSICYCGPPFAVHV  1090



>ref|XP_002965121.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
 gb|EFJ33959.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
Length=1091

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 36/174 (21%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL++KDAI+ AL+ SV ++LLPDPLTF F LA                         V A
Sbjct  953   ELHLKDAIRDALRDSVREILLPDPLTFAFRLAAG---------------------EDVRA  991

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQE  311
             +++ P+E+LV+NNT E + +SLS+ CRD++G +CV   +  +L+AG L+G+ +E+  L +
Sbjct  992   NQLVPIEMLVKNNTAEDVAVSLSVACRDISGTSCVV--EQQILYAGALDGVEVELSSLGD  1049

Query  310   IKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRV  149
               H FS++FLVPGEYTLL AA +                D+SI   GPPF + V
Sbjct  1050  AVHRFSLFFLVPGEYTLLGAAVV-------------PLRDDSICYCGPPFAVHV  1090



>gb|AFW58779.1| hypothetical protein ZEAMMB73_746167 [Zea mays]
Length=280

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (62%), Gaps = 4/117 (3%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKEFDMQNNSLACKSSVI  494
            ELNIKDAI AA+Q+S++D+LLPDPLTF F LAKNG+   +D  K+ D   + L CK  + 
Sbjct  164  ELNIKDAILAAIQASIIDILLPDPLTFSFKLAKNGTVNNVDSSKDSD---DVLRCKDPIS  220

Query  493  AHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVP  323
            AHEM  MEV V NNTKE I+++L+I+C+   G         +V    VL       P
Sbjct  221  AHEMIHMEVQVCNNTKEIIRMNLNISCKGKRGRKTNRKQMKSVTRGFVLPRFGSRKP  277



>ref|XP_002980237.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
 gb|EFJ18497.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
Length=1093

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 94/176 (53%), Gaps = 29/176 (16%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
             EL + DAI+AA+Q S+  +L  +PLTF F LA               QNN    + SV A
Sbjct  946   ELQVADAIRAAVQESMSQILASNPLTFNFRLASE-------------QNNG---QRSVEA  989

Query  490   HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQ-  314
              E+TP+E++V NNTK+ I + LS+TC DV   +C+     +V+W+G ++GI   +   Q 
Sbjct  990   CELTPVEMIVTNNTKDEISMELSVTCLDVTSSSCL----NSVMWSGSMSGIEASISASQG  1045

Query  313   EIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFHIRVN  146
             +  H F + FLVPGEY+L+  A ++   +            +S     PPF I V+
Sbjct  1046  QHIHSFELCFLVPGEYSLVGVAQVNSVGK--------KQQHKSQCYSSPPFTIHVS  1093



>ref|XP_008664222.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9-like [Zea mays]
Length=1113

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = -1

Query  670   ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKEFDMQNNSLACKSSVI  494
             ELNIKDAI AA+Q+S++D+LLPDPLTF F LAKNG+   +D  K+ D   + L CK  + 
Sbjct  985   ELNIKDAILAAIQASIIDILLPDPLTFSFKLAKNGTVNNVDSSKDSD---DVLRCKDPIS  1041

Query  493   AHEMTPMEVLVRNNTKETIKLSLSITCRDVAGEN  392
             AHEM  MEV V NNTKE I+++L+I+C+   G  
Sbjct  1042  AHEMIHMEVQVCNNTKEIIRMNLNISCKGKRGRK  1075



>ref|XP_002963095.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
 gb|EFJ36558.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
Length=1000

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 20/108 (19%)
 Frame = -1

Query  670  ELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIA  491
            EL + DAI+AA+Q S+  +L  +PLTF F LA               QNN    + SV A
Sbjct  904  ELQVADAIRAAVQESMSQILASNPLTFNFRLASE-------------QNNG---QRSVKA  947

Query  490  HEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVL  347
             ++TP+E++V NNTK+ I + LS+TC DV   +C+     +V+W+G L
Sbjct  948  CDLTPVEMIVTNNTKDEISMELSVTCLDVTSSSCL----NSVMWSGKL  991



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780