BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023O23

Length=734
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353989.1|  PREDICTED: protein spinster-like isoform X1        144   4e-36   Solanum tuberosum [potatoes]
ref|XP_004237900.1|  PREDICTED: thiamine pathway transporter THI7...    144   5e-36   Solanum lycopersicum
ref|XP_009617414.1|  PREDICTED: protein spinster homolog 3-like         142   2e-35   Nicotiana tomentosiformis
ref|XP_009774756.1|  PREDICTED: protein spinster homolog 3-like         142   2e-35   Nicotiana sylvestris
gb|EPS74406.1|  hypothetical protein M569_00342                         139   2e-34   Genlisea aurea
ref|XP_011097585.1|  PREDICTED: uncharacterized protein LOC105176469    139   2e-34   Sesamum indicum [beniseed]
ref|XP_010680560.1|  PREDICTED: uncharacterized protein LOC104895687    137   4e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB59084.1|  hypothetical protein B456_009G238200                    136   2e-33   Gossypium raimondii
ref|XP_004299640.2|  PREDICTED: uncharacterized protein LOC101293095    135   3e-33   Fragaria vesca subsp. vesca
ref|XP_010676767.1|  PREDICTED: uncharacterized protein LOC104892506    135   3e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010269227.1|  PREDICTED: uncharacterized protein LOC104605...    135   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_007141167.1|  hypothetical protein PHAVU_008G172800g             135   4e-33   Phaseolus vulgaris [French bean]
ref|XP_009776810.1|  PREDICTED: protein spinster homolog 3-like         135   5e-33   Nicotiana sylvestris
ref|XP_010680559.1|  PREDICTED: uncharacterized protein LOC104895686    135   5e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK25314.1|  hypothetical protein AALP_AA8G096600                    135   5e-33   Arabis alpina [alpine rockcress]
ref|XP_006399512.1|  hypothetical protein EUTSA_v10013341mg             134   7e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002310569.2|  hypothetical protein POPTR_0007s05580g             133   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007222589.1|  hypothetical protein PRUPE_ppa004147mg             134   8e-33   Prunus persica
ref|XP_009125318.1|  PREDICTED: uncharacterized protein LOC103850332    134   8e-33   Brassica rapa
ref|XP_008391078.1|  PREDICTED: protein spinster-like                   134   8e-33   Malus domestica [apple tree]
ref|XP_007018800.1|  Major facilitator superfamily protein isoform 1    134   8e-33   
ref|XP_009373155.1|  PREDICTED: uncharacterized protein LOC103962202    134   9e-33   
ref|XP_008219735.1|  PREDICTED: protein spinster                        134   9e-33   
emb|CDX85770.1|  BnaA02g00430D                                          134   9e-33   
gb|KDO38381.1|  hypothetical protein CISIN_1g039580mg                   127   1e-32   Citrus sinensis [apfelsine]
emb|CDY40087.1|  BnaC02g00430D                                          134   1e-32   Brassica napus [oilseed rape]
emb|CDP01042.1|  unnamed protein product                                134   1e-32   Coffea canephora [robusta coffee]
ref|XP_010422880.1|  PREDICTED: uncharacterized protein LOC104708085    134   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003532830.2|  PREDICTED: uncharacterized protein LOC100787...    134   1e-32   Glycine max [soybeans]
gb|ACK44506.1|  AT5G10190-like protein                                  134   1e-32   Arabidopsis arenosa
ref|XP_006287606.1|  hypothetical protein CARUB_v10000817mg             134   1e-32   Capsella rubella
ref|XP_010453043.1|  PREDICTED: uncharacterized protein LOC104735027    134   1e-32   Camelina sativa [gold-of-pleasure]
gb|KHN29070.1|  Protein spinster like 2                                 133   1e-32   Glycine soja [wild soybean]
ref|XP_002871409.1|  hypothetical protein ARALYDRAFT_908976             134   1e-32   Arabidopsis lyrata subsp. lyrata
emb|CAB92060.1|  putative protein                                       134   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009589317.1|  PREDICTED: uncharacterized protein LOC104086707    135   1e-32   
ref|XP_006472622.1|  PREDICTED: protein spinster-like                   134   2e-32   Citrus sinensis [apfelsine]
ref|XP_010491675.1|  PREDICTED: uncharacterized protein LOC104769218    133   2e-32   Camelina sativa [gold-of-pleasure]
gb|KDO80928.1|  hypothetical protein CISIN_1g009914mg                   134   2e-32   Citrus sinensis [apfelsine]
ref|NP_196581.1|  major facilitator protein                             133   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21155.1|  hypothetical protein MIMGU_mgv1a004903mg                133   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_006380424.1|  hypothetical protein POPTR_0007s05580g             133   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006434008.1|  hypothetical protein CICLE_v10000861mg             133   2e-32   Citrus clementina [clementine]
ref|XP_008369122.1|  PREDICTED: uncharacterized protein LOC103432703    127   2e-32   
ref|XP_009349787.1|  PREDICTED: uncharacterized protein LOC103941324    133   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_010261277.1|  PREDICTED: uncharacterized protein LOC104600132    133   2e-32   Nelumbo nucifera [Indian lotus]
gb|KCW62137.1|  hypothetical protein EUGRSUZ_H04798                     133   2e-32   Eucalyptus grandis [rose gum]
gb|KCW62139.1|  hypothetical protein EUGRSUZ_H04799                     133   3e-32   Eucalyptus grandis [rose gum]
ref|XP_004161766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    133   3e-32   
ref|XP_004136402.1|  PREDICTED: uncharacterized protein LOC101220496    133   3e-32   Cucumis sativus [cucumbers]
ref|XP_003544788.1|  PREDICTED: protein spinster-like                   132   3e-32   Glycine max [soybeans]
ref|XP_008466033.1|  PREDICTED: uncharacterized protein LOC103503585    132   3e-32   Cucumis melo [Oriental melon]
ref|XP_006360304.1|  PREDICTED: protein spinster-like                   132   4e-32   Solanum tuberosum [potatoes]
ref|XP_010431548.1|  PREDICTED: uncharacterized protein LOC104715879    129   4e-32   Camelina sativa [gold-of-pleasure]
gb|KHG02734.1|  Protein spinster                                        132   4e-32   Gossypium arboreum [tree cotton]
gb|KDP41367.1|  hypothetical protein JCGZ_15774                         132   4e-32   Jatropha curcas
ref|XP_003615076.1|  Quinolone resistance protein norA                  132   4e-32   Medicago truncatula
ref|XP_004252631.1|  PREDICTED: protein spinster homolog 3-like         132   5e-32   Solanum lycopersicum
ref|XP_007159644.1|  hypothetical protein PHAVU_002G255100g             132   6e-32   Phaseolus vulgaris [French bean]
ref|XP_006380425.1|  transporter-related family protein                 132   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006366519.1|  PREDICTED: protein spinster-like                   132   6e-32   Solanum tuberosum [potatoes]
ref|XP_002513907.1|  carbohydrate transporter, putative                 132   7e-32   Ricinus communis
gb|KEH20844.1|  MFS transporter                                         131   7e-32   Medicago truncatula
ref|XP_003532829.1|  PREDICTED: protein spinster homolog 2-like         131   8e-32   Glycine max [soybeans]
ref|XP_010519664.1|  PREDICTED: protein spinster homolog 3              131   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_002262789.1|  PREDICTED: uncharacterized protein LOC100241664    131   9e-32   Vitis vinifera
emb|CBI40991.3|  unnamed protein product                                131   1e-31   Vitis vinifera
ref|XP_006428178.1|  hypothetical protein CICLE_v10027550mg             131   1e-31   Citrus clementina [clementine]
emb|CDY26852.1|  BnaA02g18770D                                          130   1e-31   Brassica napus [oilseed rape]
ref|XP_011022782.1|  PREDICTED: uncharacterized protein LOC105124456    134   2e-31   Populus euphratica
ref|XP_009128281.1|  PREDICTED: uncharacterized protein LOC103853113    130   2e-31   Brassica rapa
ref|XP_010087571.1|  Protein spinster                                   130   2e-31   Morus notabilis
ref|XP_006428176.1|  hypothetical protein CICLE_v10025435mg             130   2e-31   Citrus clementina [clementine]
gb|KJB40384.1|  hypothetical protein B456_007G061300                    130   2e-31   Gossypium raimondii
gb|KDO56602.1|  hypothetical protein CISIN_1g010733mg                   130   2e-31   Citrus sinensis [apfelsine]
gb|KHG02266.1|  Multidrug resistance 1                                  130   2e-31   Gossypium arboreum [tree cotton]
ref|XP_010025473.1|  PREDICTED: uncharacterized protein LOC104415800    133   2e-31   
ref|XP_006355355.1|  PREDICTED: protein spinster-like                   130   2e-31   Solanum tuberosum [potatoes]
ref|XP_010105908.1|  Protein spinster                                   130   3e-31   Morus notabilis
ref|XP_007047983.1|  Major facilitator superfamily protein              122   3e-31   
gb|KDP46850.1|  hypothetical protein JCGZ_24059                         130   3e-31   Jatropha curcas
emb|CDP20194.1|  unnamed protein product                                130   3e-31   Coffea canephora [robusta coffee]
ref|XP_008233756.1|  PREDICTED: protein spinster homolog 2-like         130   4e-31   Prunus mume [ume]
ref|XP_007208192.1|  hypothetical protein PRUPE_ppa020859mg             130   4e-31   Prunus persica
ref|XP_004289317.2|  PREDICTED: uncharacterized protein LOC101305892    130   4e-31   Fragaria vesca subsp. vesca
gb|EPS73054.1|  hypothetical protein M569_01700                         129   4e-31   Genlisea aurea
gb|KFK42199.1|  hypothetical protein AALP_AA2G224400                    129   4e-31   Arabis alpina [alpine rockcress]
ref|XP_010416784.1|  PREDICTED: uncharacterized protein LOC104702...    129   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010472021.1|  PREDICTED: uncharacterized protein LOC104751709    129   5e-31   Camelina sativa [gold-of-pleasure]
gb|KHG02267.1|  Protein spinster                                        129   6e-31   Gossypium arboreum [tree cotton]
ref|XP_010428932.1|  PREDICTED: uncharacterized protein LOC104713...    129   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010428931.1|  PREDICTED: uncharacterized protein LOC104713...    129   6e-31   
gb|KEH20847.1|  MFS transporter                                         129   8e-31   Medicago truncatula
emb|CDY14626.1|  BnaC02g24870D                                          128   1e-30   Brassica napus [oilseed rape]
ref|XP_004504065.1|  PREDICTED: hexuronate transporter-like             128   1e-30   Cicer arietinum [garbanzo]
gb|KJB40382.1|  hypothetical protein B456_007G061200                    128   1e-30   Gossypium raimondii
ref|XP_006585281.1|  PREDICTED: uncharacterized protein LOC100787...    128   1e-30   Glycine max [soybeans]
ref|XP_007047981.1|  Major facilitator superfamily protein              130   1e-30   
gb|KGN48756.1|  hypothetical protein Csa_6G500480                       128   1e-30   Cucumis sativus [cucumbers]
ref|XP_006301526.1|  hypothetical protein CARUB_v10021954mg             128   1e-30   Capsella rubella
ref|XP_009591227.1|  PREDICTED: uncharacterized protein LOC104088279    128   1e-30   Nicotiana tomentosiformis
ref|XP_004143560.1|  PREDICTED: protein spinster-like                   128   1e-30   Cucumis sativus [cucumbers]
gb|KEH20845.1|  MFS transporter                                         128   2e-30   Medicago truncatula
ref|NP_177937.1|  protein UNFERTILIZED EMBRYO SAC 2                     127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004239990.1|  PREDICTED: uncharacterized protein LOC101247024    127   2e-30   Solanum lycopersicum
ref|XP_009802680.1|  PREDICTED: uncharacterized protein LOC104248179    127   3e-30   Nicotiana sylvestris
ref|XP_004237593.1|  PREDICTED: uncharacterized protein LOC101252077    126   4e-30   
ref|XP_009339732.1|  PREDICTED: uncharacterized protein LOC103931925    126   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_009339958.1|  PREDICTED: uncharacterized protein LOC103932138    126   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_002887723.1|  hypothetical protein ARALYDRAFT_316721             125   9e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_008440603.1|  PREDICTED: LOW QUALITY PROTEIN: protein spin...    125   1e-29   Cucumis melo [Oriental melon]
ref|XP_006366531.1|  PREDICTED: protein spinster-like                   124   2e-29   Solanum tuberosum [potatoes]
ref|XP_009615250.1|  PREDICTED: protein spinster-like isoform X1        124   2e-29   Nicotiana tomentosiformis
emb|CDP20195.1|  unnamed protein product                                124   3e-29   Coffea canephora [robusta coffee]
ref|XP_006366518.1|  PREDICTED: protein spinster-like                   123   6e-29   Solanum tuberosum [potatoes]
ref|XP_009387123.1|  PREDICTED: protein spinster homolog 3-like         123   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240239.1|  PREDICTED: thiamine pathway transporter THI7...    123   8e-29   Solanum lycopersicum
ref|XP_009800196.1|  PREDICTED: uncharacterized protein LOC104246...    122   2e-28   Nicotiana sylvestris
ref|XP_006464223.1|  PREDICTED: protein spinster homolog 1-like         122   2e-28   Citrus sinensis [apfelsine]
ref|XP_002285800.1|  PREDICTED: protein spinster homolog 3              122   3e-28   Vitis vinifera
emb|CAN67717.1|  hypothetical protein VITISV_002356                     122   3e-28   Vitis vinifera
ref|XP_010025474.1|  PREDICTED: uncharacterized protein LOC104415801    121   3e-28   Eucalyptus grandis [rose gum]
gb|KCW62138.1|  hypothetical protein EUGRSUZ_H04799                     121   3e-28   Eucalyptus grandis [rose gum]
gb|KCW62140.1|  hypothetical protein EUGRSUZ_H04800                     120   4e-28   Eucalyptus grandis [rose gum]
ref|XP_010937471.1|  PREDICTED: uncharacterized protein LOC105056...    120   5e-28   Elaeis guineensis
ref|XP_010937473.1|  PREDICTED: uncharacterized protein LOC105056839    120   6e-28   Elaeis guineensis
ref|XP_008790839.1|  PREDICTED: uncharacterized protein LOC103707906    120   6e-28   
ref|XP_006826927.1|  hypothetical protein AMTR_s00010p00174280          120   7e-28   Amborella trichopoda
ref|XP_009390589.1|  PREDICTED: uncharacterized protein LOC103976949    119   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010238118.1|  PREDICTED: uncharacterized protein LOC100840670    114   2e-27   
gb|EMT12843.1|  Cis,cis-muconate transport protein                      119   2e-27   
ref|XP_008808071.1|  PREDICTED: uncharacterized protein LOC103720238    121   3e-27   
dbj|BAJ88628.1|  predicted protein                                      119   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010937472.1|  PREDICTED: uncharacterized protein LOC105056...    121   3e-27   
ref|XP_004956686.1|  PREDICTED: protein spinster homolog 2-like i...    117   3e-27   
ref|XP_011098488.1|  PREDICTED: uncharacterized protein LOC105177140    118   4e-27   Sesamum indicum [beniseed]
gb|EYU24000.1|  hypothetical protein MIMGU_mgv1a004501mg                118   5e-27   Erythranthe guttata [common monkey flower]
ref|NP_001132300.1|  hypothetical protein                               117   7e-27   Zea mays [maize]
ref|XP_009380853.1|  PREDICTED: uncharacterized protein LOC103969126    117   8e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008650920.1|  PREDICTED: hypothetical protein isoform X1         117   1e-26   
ref|XP_002462294.1|  hypothetical protein SORBIDRAFT_02g023360          117   1e-26   Sorghum bicolor [broomcorn]
ref|XP_004956685.1|  PREDICTED: protein spinster homolog 2-like i...    117   1e-26   Setaria italica
ref|XP_003578045.1|  PREDICTED: uncharacterized protein LOC100840971    116   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_010239351.1|  PREDICTED: uncharacterized protein LOC100830548    119   2e-26   
ref|XP_004959412.1|  PREDICTED: protein spinster-like                   115   4e-26   Setaria italica
tpg|DAA61214.1|  TPA: hypothetical protein ZEAMMB73_831938              115   9e-26   
gb|EMS50668.1|  hypothetical protein TRIUR3_13543                       116   1e-25   Triticum urartu
ref|XP_006660580.1|  PREDICTED: uncharacterized protein LOC102700176    113   2e-25   
ref|XP_002462296.1|  hypothetical protein SORBIDRAFT_02g023380          113   3e-25   Sorghum bicolor [broomcorn]
tpg|DAA61208.1|  TPA: hypothetical protein ZEAMMB73_278988              108   5e-25   
ref|XP_010321463.1|  PREDICTED: thiamine pathway transporter THI7...    111   5e-25   
ref|XP_008652638.1|  PREDICTED: uncharacterized protein LOC103632660    114   5e-25   
ref|XP_006366533.1|  PREDICTED: protein spinster-like                   112   6e-25   Solanum tuberosum [potatoes]
ref|XP_006366532.1|  PREDICTED: protein spinster-like                   112   6e-25   Solanum tuberosum [potatoes]
gb|KDO37750.1|  hypothetical protein CISIN_1g039825mg                   105   8e-25   Citrus sinensis [apfelsine]
ref|XP_004240241.1|  PREDICTED: thiamine pathway transporter THI7...    111   1e-24   Solanum lycopersicum
ref|XP_004956684.1|  PREDICTED: uncharacterized protein LOC101757...    110   2e-24   
ref|XP_006366534.1|  PREDICTED: protein spinster-like                   110   2e-24   Solanum tuberosum [potatoes]
tpg|DAA61213.1|  TPA: hypothetical protein ZEAMMB73_675601              111   2e-24   
ref|XP_004959413.1|  PREDICTED: protein spinster-like                   111   2e-24   
ref|XP_002462295.1|  hypothetical protein SORBIDRAFT_02g023370          110   2e-24   Sorghum bicolor [broomcorn]
ref|XP_002460144.1|  hypothetical protein SORBIDRAFT_02g023340          108   1e-23   Sorghum bicolor [broomcorn]
ref|XP_006659387.1|  PREDICTED: uncharacterized protein LOC102702208    107   4e-23   Oryza brachyantha
ref|XP_001772716.1|  predicted protein                                  107   4e-23   
ref|NP_001151945.1|  carbohydrate transporter/ sugar porter/ tran...    107   5e-23   Zea mays [maize]
ref|XP_008651564.1|  PREDICTED: carbohydrate transporter/ sugar p...    107   5e-23   Zea mays [maize]
ref|XP_010321609.1|  PREDICTED: uncharacterized protein LOC101255402    101   7e-23   
ref|XP_004973408.1|  PREDICTED: protein spinster-like                   106   9e-23   Setaria italica
gb|ACN34599.1|  unknown                                                 105   9e-23   Zea mays [maize]
ref|NP_001149291.1|  carbohydrate transporter/ sugar porter/ tran...    105   9e-23   
ref|XP_002444321.1|  hypothetical protein SORBIDRAFT_07g020120          105   1e-22   Sorghum bicolor [broomcorn]
ref|NP_001061782.1|  Os08g0409900                                       105   1e-22   
ref|XP_004239989.1|  PREDICTED: thiamine pathway transporter THI7...    105   1e-22   
ref|XP_010321607.1|  PREDICTED: uncharacterized protein LOC101254800    103   2e-22   
gb|EMS50666.1|  hypothetical protein TRIUR3_13541                       102   1e-21   Triticum urartu
gb|EAZ42703.1|  hypothetical protein OsJ_27271                          103   1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06969.1|  hypothetical protein OsI_29210                          103   1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_003578046.1|  PREDICTED: uncharacterized protein LOC100841274    102   1e-21   
gb|EMT12844.1|  hypothetical protein F775_24843                         100   2e-21   
ref|XP_002985424.1|  hypothetical protein SELMODRAFT_181671             101   4e-21   
ref|XP_002979759.1|  hypothetical protein SELMODRAFT_153414             101   4e-21   
ref|XP_010321606.1|  PREDICTED: uncharacterized protein LOC101254493    100   4e-21   
ref|XP_001774721.1|  predicted protein                                  101   5e-21   
ref|XP_004959411.1|  PREDICTED: uncharacterized protein LOC101775076    101   5e-21   Setaria italica
ref|XP_002462293.1|  hypothetical protein SORBIDRAFT_02g023350          101   5e-21   Sorghum bicolor [broomcorn]
ref|XP_003574467.2|  PREDICTED: uncharacterized protein LOC100836982    101   7e-21   
ref|XP_008652637.1|  PREDICTED: uncharacterized protein LOC103632659    100   9e-21   Zea mays [maize]
tpg|DAA44155.1|  TPA: hypothetical protein ZEAMMB73_515612              100   1e-20   
ref|XP_008652878.1|  PREDICTED: protein spinster-like                   100   1e-20   
gb|EEE68665.1|  hypothetical protein OsJ_27276                        98.6    3e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83565.1|  hypothetical protein OsI_29216                        98.6    4e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAC99641.1|  transporter-like protein                             98.6    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985152.1|  PREDICTED: uncharacterized protein LOC101754873  98.6    4e-20   Setaria italica
gb|EAZ08854.1|  hypothetical protein OsI_31116                        92.8    4e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAD26403.1|  transporter-like protein                             98.6    5e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08860.1|  hypothetical protein OsI_31122                        98.6    5e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAJ99144.1|  predicted protein                                    97.4    7e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465621.1|  hypothetical protein SORBIDRAFT_01g042390        97.4    1e-19   Sorghum bicolor [broomcorn]
gb|EAZ08856.1|  hypothetical protein OsI_31118                        92.8    3e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001063020.2|  Os09g0371200                                     92.4    7e-19   
gb|EAZ44506.1|  hypothetical protein OsJ_29123                        94.7    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467734.1|  hypothetical protein SORBIDRAFT_01g033180        94.0    2e-18   
gb|EEE69583.1|  hypothetical protein OsJ_29122                        93.2    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69582.1|  hypothetical protein OsJ_29121                        92.8    5e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD26401.1|  transporter-like protein                             92.8    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063021.1|  Os09g0371300                                     92.8    5e-18   
gb|EAZ08858.1|  hypothetical protein OsI_31120                        92.8    5e-18   Oryza sativa Indica Group [Indian rice]
dbj|BAD26399.1|  membrane transport protein-like                      92.4    6e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD26400.1|  transporter-like protein                             92.4    9e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08853.1|  hypothetical protein OsI_31115                        92.0    9e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001063019.1|  Os09g0371000                                     92.0    1e-17   
gb|EMT05566.1|  Quinolone resistance protein norA                     90.9    3e-17   
ref|XP_001762503.1|  predicted protein                                88.6    9e-17   
ref|XP_004148440.1|  PREDICTED: uncharacterized protein LOC101209309  85.1    2e-15   Cucumis sativus [cucumbers]
gb|AES94885.2|  MFS transporter                                       85.1    2e-15   Medicago truncatula
ref|XP_008457892.1|  PREDICTED: putative glycerol-3-phosphate tra...  84.7    2e-15   Cucumis melo [Oriental melon]
ref|XP_003611927.1|  hypothetical protein MTR_5g019490                84.7    3e-15   
ref|XP_002983895.1|  hypothetical protein SELMODRAFT_228993           83.6    5e-15   
ref|XP_002960772.1|  hypothetical protein SELMODRAFT_163585           83.6    5e-15   
gb|AFW89151.1|  hypothetical protein ZEAMMB73_529909                  83.6    7e-15   
ref|XP_002989078.1|  hypothetical protein SELMODRAFT_427648           83.2    8e-15   
ref|XP_010548364.1|  PREDICTED: uncharacterized protein LOC104819...  82.0    2e-14   
ref|XP_010548363.1|  PREDICTED: uncharacterized protein LOC104819...  82.0    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_008241629.1|  PREDICTED: monocarboxylate transporter 2         81.6    2e-14   Prunus mume [ume]
ref|XP_008786125.1|  PREDICTED: uncharacterized protein LOC103704...  81.6    2e-14   
ref|XP_010437305.1|  PREDICTED: uncharacterized protein LOC104721...  81.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010432136.1|  PREDICTED: uncharacterized protein LOC104716456  81.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008786124.1|  PREDICTED: uncharacterized protein LOC103704...  81.6    3e-14   Phoenix dactylifera
ref|XP_009379183.1|  PREDICTED: uncharacterized protein LOC103967633  81.3    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_010923447.1|  PREDICTED: uncharacterized protein LOC105046534  81.6    3e-14   Elaeis guineensis
ref|XP_009349750.1|  PREDICTED: uncharacterized protein LOC103941279  81.3    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_009374226.1|  PREDICTED: uncharacterized protein LOC103963176  81.6    3e-14   
ref|XP_002869023.1|  predicted protein                                81.3    3e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_010437304.1|  PREDICTED: uncharacterized protein LOC104721...  81.3    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010446742.1|  PREDICTED: uncharacterized protein LOC104729498  81.3    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006285423.1|  hypothetical protein CARUB_v10006840mg           81.3    3e-14   Capsella rubella
ref|XP_002273483.2|  PREDICTED: uncharacterized protein LOC100254...  81.3    4e-14   Vitis vinifera
ref|NP_195397.1|  major facilitator protein                           81.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338799.1|  PREDICTED: monocarboxylate transporter 2-like    81.3    4e-14   
ref|XP_002983793.1|  hypothetical protein SELMODRAFT_422991           80.9    4e-14   Selaginella moellendorffii
ref|XP_008338168.1|  PREDICTED: monocarboxylate transporter 2-like    81.3    4e-14   
ref|XP_004512009.1|  PREDICTED: uncharacterized protein LOC101490771  80.9    5e-14   Cicer arietinum [garbanzo]
ref|XP_011025716.1|  PREDICTED: uncharacterized protein LOC105126529  80.9    5e-14   Populus euphratica
ref|XP_002525099.1|  carbohydrate transporter, putative               80.5    6e-14   
ref|XP_010095292.1|  Protein spinster                                 80.9    6e-14   Morus notabilis
ref|XP_002310787.2|  hypothetical protein POPTR_0007s12360g           80.5    6e-14   
ref|XP_006573596.1|  PREDICTED: uncharacterized protein LOC100812...  80.5    7e-14   
ref|XP_004300601.1|  PREDICTED: uncharacterized protein LOC101296107  80.5    8e-14   Fragaria vesca subsp. vesca
gb|KJB43570.1|  hypothetical protein B456_007G206200                  79.7    1e-13   Gossypium raimondii
gb|KHG26667.1|  Protein spinster                                      79.7    1e-13   Gossypium arboreum [tree cotton]
gb|KFK30298.1|  hypothetical protein AALP_AA7G243500                  79.7    1e-13   Arabis alpina [alpine rockcress]
gb|EYU44661.1|  hypothetical protein MIMGU_mgv1a005107mg              79.3    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_006411961.1|  hypothetical protein EUTSA_v10025030mg           79.0    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_007156898.1|  hypothetical protein PHAVU_002G026600g           79.0    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009141825.1|  PREDICTED: uncharacterized protein LOC103865702  79.0    2e-13   Brassica rapa
ref|XP_007204349.1|  hypothetical protein PRUPE_ppa005683mg           79.0    2e-13   
ref|XP_009392991.1|  PREDICTED: uncharacterized protein LOC103978...  79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71312.1|  hypothetical protein M569_03447                       79.0    2e-13   Genlisea aurea
emb|CDX75599.1|  BnaA01g01030D                                        79.0    2e-13   
ref|XP_009392982.1|  PREDICTED: uncharacterized protein LOC103978...  79.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008448121.1|  PREDICTED: uncharacterized protein LOC103490411  79.0    2e-13   
emb|CDX69247.1|  BnaC01g02060D                                        79.0    2e-13   
ref|XP_008670920.1|  PREDICTED: uncharacterized protein LOC103648...  75.9    3e-13   
ref|XP_008670918.1|  PREDICTED: uncharacterized protein LOC103648...  75.9    3e-13   
ref|XP_008670917.1|  PREDICTED: uncharacterized protein LOC103648...  75.9    3e-13   
ref|XP_006856102.1|  hypothetical protein AMTR_s00059p00134890        78.2    3e-13   
ref|XP_005642678.1|  MFS general substrate transporter                78.2    4e-13   Coccomyxa subellipsoidea C-169
ref|XP_007047019.1|  Major facilitator superfamily protein isoform 1  78.2    4e-13   
ref|XP_008811922.1|  PREDICTED: uncharacterized protein LOC103722946  78.2    4e-13   Phoenix dactylifera
ref|XP_008670916.1|  PREDICTED: uncharacterized protein LOC103648...  75.9    4e-13   
ref|XP_005647506.1|  MFS general substrate transporter                78.2    5e-13   Coccomyxa subellipsoidea C-169
emb|CDP02803.1|  unnamed protein product                              77.8    6e-13   Coffea canephora [robusta coffee]
gb|KHN36148.1|  hypothetical protein glysoja_003271                   77.4    6e-13   Glycine soja [wild soybean]
ref|XP_001765603.1|  predicted protein                                77.4    6e-13   
ref|XP_006425735.1|  hypothetical protein CICLE_v10025430mg           77.4    7e-13   
gb|KDO79469.1|  hypothetical protein CISIN_1g010744mg                 77.4    7e-13   Citrus sinensis [apfelsine]
gb|KDO79468.1|  hypothetical protein CISIN_1g010744mg                 77.4    7e-13   Citrus sinensis [apfelsine]
ref|XP_011099576.1|  PREDICTED: protein spinster homolog 3            77.0    1e-12   Sesamum indicum [beniseed]
ref|XP_006363137.1|  PREDICTED: uncharacterized protein LOC102582265  76.6    1e-12   Solanum tuberosum [potatoes]
ref|XP_009618790.1|  PREDICTED: protein spinster-like                 76.3    2e-12   
ref|XP_010680910.1|  PREDICTED: uncharacterized protein LOC104895...  76.3    2e-12   
ref|XP_004232379.1|  PREDICTED: protein spinster                      76.3    2e-12   
ref|XP_010680909.1|  PREDICTED: uncharacterized protein LOC104895...  76.3    2e-12   
ref|XP_009774646.1|  PREDICTED: protein spinster-like                 76.3    2e-12   
ref|XP_010680908.1|  PREDICTED: uncharacterized protein LOC104895...  76.3    2e-12   
ref|XP_010070024.1|  PREDICTED: uncharacterized protein LOC104456848  75.9    2e-12   
ref|XP_006346929.1|  PREDICTED: protein spinster homolog 1-like       75.9    2e-12   
ref|XP_004233504.1|  PREDICTED: protein spinster-like                 75.9    2e-12   
ref|NP_001051655.1|  Os03g0809100                                     75.5    3e-12   
ref|XP_010936982.1|  PREDICTED: uncharacterized protein LOC105056467  75.1    4e-12   
ref|XP_010254940.1|  PREDICTED: uncharacterized protein LOC104595762  75.1    4e-12   
ref|XP_006650770.1|  PREDICTED: sugar phosphate exchanger 3-like      74.7    4e-12   
gb|KDP31805.1|  hypothetical protein JCGZ_12266                       74.3    6e-12   
ref|XP_010227969.1|  PREDICTED: sugar phosphate exchanger 3-like ...  74.3    6e-12   
ref|XP_010227967.1|  PREDICTED: sugar phosphate exchanger 3-like ...  74.3    6e-12   
dbj|BAJ98568.1|  predicted protein                                    74.3    8e-12   
gb|EMS66650.1|  hypothetical protein TRIUR3_16131                     73.9    8e-12   
gb|EMT23911.1|  Protein spinster                                      74.3    8e-12   
gb|EMT22164.1|  Protein spinster                                      73.9    9e-12   
gb|EAZ39089.1|  hypothetical protein OsJ_23521                        73.6    1e-11   
ref|XP_002461678.1|  hypothetical protein SORBIDRAFT_02g006340        73.2    2e-11   
gb|EAY92285.1|  hypothetical protein OsI_14007                        72.8    2e-11   
ref|XP_009618614.1|  PREDICTED: uncharacterized protein LOC104110772  72.8    2e-11   
ref|XP_009772101.1|  PREDICTED: uncharacterized protein LOC104222557  72.4    3e-11   
gb|KIZ04451.1|  hypothetical protein MNEG_3510                        72.8    3e-11   
gb|EMS55925.1|  Protein spinster                                      72.4    3e-11   
ref|XP_006657554.1|  PREDICTED: sugar phosphate exchanger 3-like      72.4    3e-11   
ref|XP_004979786.1|  PREDICTED: uncharacterized protein LOC101753478  72.0    4e-11   
gb|EEC81721.1|  hypothetical protein OsI_25341                        71.6    6e-11   
ref|XP_008651037.1|  PREDICTED: uncharacterized protein LOC100272...  71.2    7e-11   
ref|XP_010228233.1|  PREDICTED: uncharacterized protein LOC100841189  71.2    8e-11   
ref|XP_005647401.1|  MFS general substrate transporter                70.9    1e-10   
gb|EMS45397.1|  Protein spinster                                      70.5    2e-10   
ref|XP_010030884.1|  PREDICTED: uncharacterized protein LOC104420801  69.7    2e-10   
ref|XP_005644520.1|  MFS general substrate transporter                70.1    2e-10   
ref|XP_010029835.1|  PREDICTED: uncharacterized protein LOC104419771  69.7    2e-10   
ref|XP_010534073.1|  PREDICTED: uncharacterized protein LOC104809713  69.7    2e-10   
ref|NP_179449.5|  major facilitator protein                           69.7    3e-10   
ref|XP_002884144.1|  hypothetical protein ARALYDRAFT_319808           69.3    3e-10   
gb|AAD12208.1|  hypothetical protein                                  68.9    4e-10   
ref|XP_010467688.1|  PREDICTED: uncharacterized protein LOC104747703  68.6    5e-10   
ref|XP_006300221.1|  hypothetical protein CARUB_v10016457mg           68.6    5e-10   
ref|XP_005850539.1|  hypothetical protein CHLNCDRAFT_140406           68.6    6e-10   
gb|EMT22173.1|  Protein spinster                                      68.6    6e-10   
ref|XP_005849525.1|  hypothetical protein CHLNCDRAFT_8327             68.2    7e-10   
dbj|BAK08064.1|  predicted protein                                    67.8    9e-10   
ref|XP_011396418.1|  4-hydroxybenzoate transporter PcaK               67.8    1e-09   
ref|XP_002884143.1|  hypothetical protein ARALYDRAFT_900245           67.0    2e-09   
ref|XP_005647379.1|  MFS general substrate transporter                67.0    2e-09   
gb|KCW56805.1|  hypothetical protein EUGRSUZ_I02474                   67.0    2e-09   
gb|KFK40252.1|  hypothetical protein AALP_AA3G350000                  65.5    4e-09   
ref|XP_006409131.1|  hypothetical protein EUTSA_v10023180mg           65.9    5e-09   
ref|XP_010489564.1|  PREDICTED: uncharacterized protein LOC104767221  65.5    6e-09   
emb|CDY13021.1|  BnaC07g03200D                                        63.2    7e-09   
ref|XP_010414457.1|  PREDICTED: uncharacterized protein LOC104700615  63.9    2e-08   
emb|CDY13022.1|  BnaC07g03210D                                        63.5    2e-08   
ref|XP_005644015.1|  transporter like protein                         63.5    2e-08   
emb|CDY43897.1|  BnaA07g01740D                                        63.5    3e-08   
ref|XP_011397706.1|  Quinolone resistance protein NorA                63.5    3e-08   
gb|EAZ44503.1|  hypothetical protein OsJ_29120                        63.5    3e-08   
ref|XP_009114699.1|  PREDICTED: uncharacterized protein LOC103839972  62.8    5e-08   
ref|XP_005843321.1|  hypothetical protein CHLNCDRAFT_141208           62.8    5e-08   
ref|XP_006659388.1|  PREDICTED: protein spinster homolog 1-like       61.2    2e-07   
gb|KDD75337.1|  hypothetical protein H632_c735p0                      59.3    8e-07   
ref|XP_005842980.1|  hypothetical protein CHLNCDRAFT_141677           58.2    2e-06   
ref|XP_011401502.1|  hypothetical protein F751_5710                   57.4    3e-06   
gb|KHN42012.1|  hypothetical protein glysoja_003752                   54.3    3e-05   
gb|EMS66508.1|  hypothetical protein TRIUR3_25920                     53.1    5e-05   
ref|XP_005780056.1|  hypothetical protein EMIHUDRAFT_52552            53.1    8e-05   
ref|XP_005784270.1|  hypothetical protein EMIHUDRAFT_52594            52.4    1e-04   
ref|XP_003885552.1|  Major facilitator superfamily MFS_1, related     51.6    3e-04   
ref|XP_001691335.1|  predicted protein                                51.6    3e-04   
ref|XP_002370990.1|  transmembrane domain-containing protein          50.4    8e-04   
gb|EPR58739.1|  transporter, major facilitator family protein         50.4    8e-04   
ref|XP_008886420.1|  transporter, major facilitator family protein    50.4    8e-04   
gb|KFG58454.1|  transporter, major facilitator family protein         50.4    8e-04   



>ref|XP_006353989.1| PREDICTED: protein spinster-like isoform X1 [Solanum tuberosum]
 ref|XP_006353990.1| PREDICTED: protein spinster-like isoform X2 [Solanum tuberosum]
Length=518

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRS+VQSLCYPLAAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSMVQSLCYPLAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_004237900.1| PREDICTED: thiamine pathway transporter THI73-like [Solanum lycopersicum]
Length=518

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRS+VQSLCYPLAAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSMVQSLCYPLAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_009617414.1| PREDICTED: protein spinster homolog 3-like [Nicotiana tomentosiformis]
Length=520

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSMVQSLCYPLAAYLAARHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_009774756.1| PREDICTED: protein spinster homolog 3-like [Nicotiana sylvestris]
Length=518

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSMVQSLCYPLAAYLAARHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>gb|EPS74406.1| hypothetical protein M569_00342, partial [Genlisea aurea]
Length=450

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALHADPTRLGSLTLFRSIVQS CYPLAAYL+VRHNR HV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHADPTRLGSLTLFRSIVQSSCYPLAAYLAVRHNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_011097585.1| PREDICTED: uncharacterized protein LOC105176469 [Sesamum indicum]
Length=520

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALHADPTRLGSLTLFRSIVQS CYPLAAYL+VRHNR HV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHADPTRLGSLTLFRSIVQSSCYPLAAYLAVRHNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010680560.1| PREDICTED: uncharacterized protein LOC104895687 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQSLCYPLAAYL+VRHNRAH+
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSLCYPLAAYLAVRHNRAHI  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>gb|KJB59084.1| hypothetical protein B456_009G238200 [Gossypium raimondii]
 gb|KJB59085.1| hypothetical protein B456_009G238200 [Gossypium raimondii]
Length=518

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALHADPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHADPTGLGSLTLFRSIVQSACYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_004299640.2| PREDICTED: uncharacterized protein LOC101293095 [Fragaria vesca 
subsp. vesca]
Length=526

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRS+VQSLCYP+AAYL+VRHNRAHV
Sbjct  18   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSMVQSLCYPIAAYLAVRHNRAHV  77

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  78   IALGAFLWAAAT  89



>ref|XP_010676767.1| PREDICTED: uncharacterized protein LOC104892506 [Beta vulgaris 
subsp. vulgaris]
Length=513

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADES+LPGVYKEVGEALHADPT+LGSLTL RSIVQS CYPLA YLS RHNRAHV
Sbjct  18   AGIMEKADESILPGVYKEVGEALHADPTKLGSLTLLRSIVQSACYPLAVYLSARHNRAHV  77

Query  453  IAXGAFLWAAAT  488
            I+ GAFLWAAAT
Sbjct  78   ISLGAFLWAAAT  89



>ref|XP_010269227.1| PREDICTED: uncharacterized protein LOC104605963 isoform X1 [Nelumbo 
nucifera]
Length=515

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_007141167.1| hypothetical protein PHAVU_008G172800g [Phaseolus vulgaris]
 gb|ESW13161.1| hypothetical protein PHAVU_008G172800g [Phaseolus vulgaris]
Length=504

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_009776810.1| PREDICTED: protein spinster homolog 3-like [Nicotiana sylvestris]
Length=518

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADESLLPGVYKEVG+ALH DPT LGSLTLFRS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  14   AGIMEKADESLLPGVYKEVGDALHTDPTGLGSLTLFRSMVQSLCYPLAAYLAERHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_010680559.1| PREDICTED: uncharacterized protein LOC104895686 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALH DPT LGSLTLFRSIVQS CYPLAAYL++ HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAIHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KFK25314.1| hypothetical protein AALP_AA8G096600 [Arabis alpina]
Length=493

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHVDPTALGTLTLFRSIVQSCCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_006399512.1| hypothetical protein EUTSA_v10013341mg [Eutrema salsugineum]
 gb|ESQ40965.1| hypothetical protein EUTSA_v10013341mg [Eutrema salsugineum]
Length=497

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKE+GEALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEIGEALHVDPTALGTLTLFRSIVQSCCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_002310569.2| hypothetical protein POPTR_0007s05580g [Populus trichocarpa]
 gb|EEE91019.2| hypothetical protein POPTR_0007s05580g [Populus trichocarpa]
Length=385

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+V HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_007222589.1| hypothetical protein PRUPE_ppa004147mg [Prunus persica]
 gb|EMJ23788.1| hypothetical protein PRUPE_ppa004147mg [Prunus persica]
Length=527

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  18   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSACYPVAAYLAVRHNRAHV  77

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  78   IALGAFLWAAAT  89



>ref|XP_009125318.1| PREDICTED: uncharacterized protein LOC103850332 [Brassica rapa]
Length=494

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALH DPT LG+LTLFRSIVQ+ CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHVDPTALGTLTLFRSIVQTCCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_008391078.1| PREDICTED: protein spinster-like [Malus domestica]
 ref|XP_008391079.1| PREDICTED: protein spinster-like [Malus domestica]
Length=522

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSACYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAFGAFLWAAAT  85



>ref|XP_007018800.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY16025.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=522

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_009373155.1| PREDICTED: uncharacterized protein LOC103962202 [Pyrus x bretschneideri]
Length=522

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSACYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAFGAFLWAAAT  85



>ref|XP_008219735.1| PREDICTED: protein spinster [Prunus mume]
Length=509

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  16   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSACYPVAAYLAVRHNRAHV  75

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  76   IALGAFLWAAAT  87



>emb|CDX85770.1| BnaA02g00430D [Brassica napus]
Length=453

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALH DPT LG+LTLFRSIVQ+ CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHVDPTALGTLTLFRSIVQTCCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>gb|KDO38381.1| hypothetical protein CISIN_1g039580mg [Citrus sinensis]
Length=149

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG AL  DPT LGSLTLFRSIVQS CYPLAAYLSV HN AH+
Sbjct  14   AGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHI  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>emb|CDY40087.1| BnaC02g00430D [Brassica napus]
Length=493

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALH DPT LG+LTLFRSIVQ+ CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHVDPTALGTLTLFRSIVQTCCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>emb|CDP01042.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALH  PT LG+LTLFRS+VQSLCYPLA YL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHTGPTGLGTLTLFRSMVQSLCYPLATYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_010422880.1| PREDICTED: uncharacterized protein LOC104708085 [Camelina sativa]
Length=491

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_003532830.2| PREDICTED: uncharacterized protein LOC100787672 isoform X1 [Glycine 
max]
Length=486

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKE+G AL+ADPT LGSLT FRSIVQSLCYPLAAYL+ RHNRAHV
Sbjct  16   AGIMERADESLLPGVYKEIGAALNADPTALGSLTFFRSIVQSLCYPLAAYLATRHNRAHV  75

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  76   IALGAFLWAAAT  87



>gb|ACK44506.1| AT5G10190-like protein [Arabidopsis arenosa]
Length=489

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_006287606.1| hypothetical protein CARUB_v10000817mg [Capsella rubella]
 gb|EOA20504.1| hypothetical protein CARUB_v10000817mg [Capsella rubella]
Length=491

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_010453043.1| PREDICTED: uncharacterized protein LOC104735027 [Camelina sativa]
Length=491

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>gb|KHN29070.1| Protein spinster like 2 [Glycine soja]
Length=484

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKE+G AL+ADPT LGSLT FRSIVQSLCYPLAAYL+ RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEIGAALNADPTALGSLTFFRSIVQSLCYPLAAYLATRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_002871409.1| hypothetical protein ARALYDRAFT_908976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47668.1| hypothetical protein ARALYDRAFT_908976 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>emb|CAB92060.1| putative protein [Arabidopsis thaliana]
Length=521

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_009589317.1| PREDICTED: uncharacterized protein LOC104086707 [Nicotiana tomentosiformis]
Length=715

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADESLLPGVYKEVG+ALH DPT LGSLTLFRS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  14   AGIMEKADESLLPGVYKEVGDALHTDPTGLGSLTLFRSMVQSLCYPLAAYLAARHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_006472622.1| PREDICTED: protein spinster-like [Citrus sinensis]
Length=522

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYP+AAYL++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQASCYPIAAYLAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010491675.1| PREDICTED: uncharacterized protein LOC104769218 [Camelina sativa]
Length=492

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>gb|KDO80928.1| hypothetical protein CISIN_1g009914mg [Citrus sinensis]
Length=522

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYP+AAYL++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQASCYPIAAYLAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|NP_196581.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAK25872.1|AF360162_1 unknown protein [Arabidopsis thaliana]
 gb|AAM44941.1| unknown protein [Arabidopsis thaliana]
 gb|AED91506.1| major facilitator protein [Arabidopsis thaliana]
Length=488

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LG+LTLFRSIVQS CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGDALHVDPTALGTLTLFRSIVQSSCYPLAAYLSSRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>gb|EYU21155.1| hypothetical protein MIMGU_mgv1a004903mg [Erythranthe guttata]
Length=505

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGEALHA PT LGSLTLFRS+VQ+ CYPLAAYLS RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGEALHAGPTGLGSLTLFRSMVQAFCYPLAAYLSARHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IAYGAFLWSAAT  85



>ref|XP_006380424.1| hypothetical protein POPTR_0007s05580g [Populus trichocarpa]
 gb|ERP58221.1| hypothetical protein POPTR_0007s05580g [Populus trichocarpa]
Length=520

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+V HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_006434008.1| hypothetical protein CICLE_v10000861mg [Citrus clementina]
 gb|ESR47248.1| hypothetical protein CICLE_v10000861mg [Citrus clementina]
Length=522

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYP+AAYL++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQASCYPIAAYLAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_008369122.1| PREDICTED: uncharacterized protein LOC103432703 [Malus domestica]
Length=171

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG  LH DPT LGSLTLFRSIVQS CYPLAAYLS+RHNRA V
Sbjct  14   ASIMQRADESLLPGVYKEVGATLHTDPTGLGSLTLFRSIVQSSCYPLAAYLSMRHNRARV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_009349787.1| PREDICTED: uncharacterized protein LOC103941324 [Pyrus x bretschneideri]
Length=524

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSACYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_010261277.1| PREDICTED: uncharacterized protein LOC104600132 [Nelumbo nucifera]
Length=529

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG AL+ DPT LGSLTLFRSIVQS CYPLAAYL+VRHNRAHV
Sbjct  23   AGIMERADESLLPGVYKEVGAALNTDPTGLGSLTLFRSIVQSSCYPLAAYLAVRHNRAHV  82

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  83   IALGAFLWAAAT  94



>gb|KCW62137.1| hypothetical protein EUGRSUZ_H04798 [Eucalyptus grandis]
Length=522

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVYKEVG ALHADPT LGSLTLFRSIVQS CYPLAAYL+ RHNRAHV
Sbjct  14   ASIMERADESLLPGVYKEVGAALHADPTGLGSLTLFRSIVQSACYPLAAYLASRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KCW62139.1| hypothetical protein EUGRSUZ_H04799 [Eucalyptus grandis]
Length=522

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVYKEVG ALHADPT LGSLTLFRSIVQS CYPLAAYL+ RHNRAHV
Sbjct  14   ASIMERADESLLPGVYKEVGAALHADPTALGSLTLFRSIVQSACYPLAAYLASRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_004161766.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101220496 
[Cucumis sativus]
Length=521

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AG+MERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYPLAAYL+VRHNRAHV
Sbjct  14   AGVMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQAACYPLAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA+AT
Sbjct  74   IALGAFLWASAT  85



>ref|XP_004136402.1| PREDICTED: uncharacterized protein LOC101220496 [Cucumis sativus]
 gb|KGN60340.1| hypothetical protein Csa_3G895860 [Cucumis sativus]
Length=521

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AG+MERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYPLAAYL+VRHNRAHV
Sbjct  14   AGVMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQAACYPLAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA+AT
Sbjct  74   IALGAFLWASAT  85



>ref|XP_003544788.1| PREDICTED: protein spinster-like [Glycine max]
Length=503

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LG LTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGTALHTDPTGLGYLTLFRSIVQSSCYPVAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAVGAFLWAAAT  85



>ref|XP_008466033.1| PREDICTED: uncharacterized protein LOC103503585 [Cucumis melo]
Length=521

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AG+MERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYPLAAYL+VRHNRAHV
Sbjct  14   AGVMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQAACYPLAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA+AT
Sbjct  74   IALGAFLWASAT  85



>ref|XP_006360304.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=520

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADESLLPGVYKEVG+ALH DPT LGSLTLFRS+VQS CYP+AAYL+ RHNRAHV
Sbjct  14   AGIMEKADESLLPGVYKEVGDALHTDPTGLGSLTLFRSMVQSACYPIAAYLAARHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_010431548.1| PREDICTED: uncharacterized protein LOC104715879, partial [Camelina 
sativa]
Length=291

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAVCYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>gb|KHG02734.1| Protein spinster [Gossypium arboreum]
Length=518

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+V HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSACYPIAAYLAVSHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KDP41367.1| hypothetical protein JCGZ_15774 [Jatropha curcas]
Length=523

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GA LW+AAT
Sbjct  74   IALGALLWSAAT  85



>ref|XP_003615076.1| Quinolone resistance protein norA [Medicago truncatula]
 gb|AES98034.1| MFS transporter [Medicago truncatula]
Length=506

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYP+AAYL+ RHNRAHV
Sbjct  14   AGIMEKADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPIAAYLATRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_004252631.1| PREDICTED: protein spinster homolog 3-like [Solanum lycopersicum]
Length=520

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AG+ME+ADESLLPGVYKEVG+ALH DPT LGSLTLFRS+VQS CYP+AAYL+ RHNRAHV
Sbjct  14   AGVMEKADESLLPGVYKEVGDALHTDPTGLGSLTLFRSMVQSTCYPIAAYLAARHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAYGAFLWAAAT  85



>ref|XP_007159644.1| hypothetical protein PHAVU_002G255100g [Phaseolus vulgaris]
 gb|ESW31638.1| hypothetical protein PHAVU_002G255100g [Phaseolus vulgaris]
Length=507

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVGE L+ADPT LGSLTLFRS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  14   ASIMQRADESLLPGVYKEVGEDLNADPTALGSLTLFRSLVQSLCYPLAAYLATRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_006380425.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP58222.1| transporter-related family protein [Populus trichocarpa]
Length=513

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIM+RADESLLPGVYKEVG ALH DPT LGSLTLFRS+VQS CYPLAAYL+V HNRAHV
Sbjct  14   AGIMQRADESLLPGVYKEVGAALHTDPTGLGSLTLFRSVVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_006366519.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=484

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADE+LLPGVYKEVGE LH DPT LGSLTLFRS+VQ LCYPLAAYLS RHNRAHV
Sbjct  20   AGIMEKADETLLPGVYKEVGEDLHTDPTGLGSLTLFRSLVQCLCYPLAAYLSARHNRAHV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  80   IALGAFLWSAAT  91



>ref|XP_002513907.1| carbohydrate transporter, putative [Ricinus communis]
 gb|EEF48490.1| carbohydrate transporter, putative [Ricinus communis]
Length=526

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+V+HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAVKHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GA LWAAAT
Sbjct  74   IAFGALLWAAAT  85



>gb|KEH20844.1| MFS transporter [Medicago truncatula]
Length=484

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKE+G+ L+ADPT LGSLTLFRS+VQ+ CYPLAAYL+ RHNRAHV
Sbjct  15   AGIMERADESLLPGVYKEIGDELNADPTALGSLTLFRSLVQAFCYPLAAYLATRHNRAHV  74

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  75   IALGAFLWAAAT  86



>ref|XP_003532829.1| PREDICTED: protein spinster homolog 2-like [Glycine max]
 gb|KHN29069.1| Protein spinster [Glycine soja]
Length=512

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVGE L ADPT LGSLTLFRS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  14   ASIMQRADESLLPGVYKEVGEDLKADPTALGSLTLFRSLVQSLCYPLAAYLATRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010519664.1| PREDICTED: protein spinster homolog 3 [Tarenaya hassleriana]
Length=497

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+ RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHIDPTGLGSLTLFRSIVQSSCYPLAAYLASRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_002262789.1| PREDICTED: uncharacterized protein LOC100241664 [Vitis vinifera]
Length=526

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+  HNRAHV
Sbjct  19   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLATHHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IALGAFLWAAAT  90



>emb|CBI40991.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+  HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLATHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_006428178.1| hypothetical protein CICLE_v10027550mg [Citrus clementina]
 ref|XP_006464224.1| PREDICTED: protein spinster homolog 2-like [Citrus sinensis]
 gb|ESR41418.1| hypothetical protein CICLE_v10027550mg [Citrus clementina]
Length=522

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG AL  DPT LGSLTLFRSIVQS CYPLAAYLSV HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALRTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>emb|CDY26852.1| BnaA02g18770D [Brassica napus]
Length=437

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+S+RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLLRSMVQAVCYPLAAYMSMRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_011022782.1| PREDICTED: uncharacterized protein LOC105124456 [Populus euphratica]
Length=1041

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL+V HNRAHV
Sbjct  535  AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAVHHNRAHV  594

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  595  IALGAFLWAAAT  606


 Score =   132 bits (331),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIM+RADESLLPGVYKEVG ALH DPT LGSLTLFRS+VQS CYPLAAYL+V HNRAHV
Sbjct  14   AGIMQRADESLLPGVYKEVGAALHTDPTGLGSLTLFRSVVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_009128281.1| PREDICTED: uncharacterized protein LOC103853113 [Brassica rapa]
Length=474

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+S+RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLLRSMVQAVCYPLAAYMSMRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_010087571.1| Protein spinster [Morus notabilis]
 gb|EXB29426.1| Protein spinster [Morus notabilis]
Length=521

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQ+ CYPLAAYL+VRHNR HV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQASCYPLAAYLAVRHNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWAFAT  85



>ref|XP_006428176.1| hypothetical protein CICLE_v10025435mg [Citrus clementina]
 ref|XP_006464222.1| PREDICTED: protein spinster homolog 2-like [Citrus sinensis]
 gb|ESR41416.1| hypothetical protein CICLE_v10025435mg [Citrus clementina]
Length=502

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADES+LPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYLS  HNRAHV
Sbjct  14   AAIMERADESMLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSFCYPLAAYLSAHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KJB40384.1| hypothetical protein B456_007G061300 [Gossypium raimondii]
Length=521

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL+RSIVQS CYPLAAYL++ HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLYRSIVQSSCYPLAAYLAMHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KDO56602.1| hypothetical protein CISIN_1g010733mg [Citrus sinensis]
Length=502

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADES+LPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYLS  HNRAHV
Sbjct  14   AAIMERADESMLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSFCYPLAAYLSAHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KHG02266.1| Multidrug resistance 1 [Gossypium arboreum]
Length=516

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL+RSIVQS CYPLAAYL++ HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLYRSIVQSSCYPLAAYLAMHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010025473.1| PREDICTED: uncharacterized protein LOC104415800 [Eucalyptus grandis]
Length=1040

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVYKEVG ALHADPT LGSLTLFRSIVQS CYPLAAYL+ RHNRAHV
Sbjct  14   ASIMERADESLLPGVYKEVGAALHADPTALGSLTLFRSIVQSACYPLAAYLASRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85


 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVYKEVG ALHADPT LGSLTLFRSIVQS CYPLAAYL+ RHNRAHV
Sbjct  532  ASIMERADESLLPGVYKEVGAALHADPTGLGSLTLFRSIVQSACYPLAAYLASRHNRAHV  591

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  592  IALGAFLWAAAT  603



>ref|XP_006355355.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=517

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ALH DPT LGSLTLFRSIVQ LCYPLAAYLS R NR HV
Sbjct  17   AGIMERADESLLPGVYKEVGKALHTDPTGLGSLTLFRSIVQCLCYPLAAYLSGRQNRTHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  77   IALGAFLWSAAT  88



>ref|XP_010105908.1| Protein spinster [Morus notabilis]
 gb|EXC06727.1| Protein spinster [Morus notabilis]
Length=525

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPG YKEVG ALH +PT LGSLTL RS+VQSLCYP+AAYL+VRHNRAHV
Sbjct  14   AGIMERADESLLPGAYKEVGAALHTNPTGLGSLTLLRSMVQSLCYPIAAYLAVRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_007047983.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX92140.1| Major facilitator superfamily protein [Theobroma cacao]
Length=97

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADESLLPGVY EVG ALH DPT LGSLTLFRS+VQS CYPLAAYL+  HNRAHV
Sbjct  14   AAIMETADESLLPGVYNEVGAALHIDPTGLGSLTLFRSVVQSWCYPLAAYLARHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA+AT
Sbjct  74   IALGAFLWASAT  85



>gb|KDP46850.1| hypothetical protein JCGZ_24059 [Jatropha curcas]
Length=521

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIM+RADESLLPGVYKEVG  LH DPT LGSLTLFRSIVQS CYPLAAYL++RHNR HV
Sbjct  14   AGIMQRADESLLPGVYKEVGADLHMDPTGLGSLTLFRSIVQSFCYPLAAYLALRHNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>emb|CDP20194.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVY EVG ALH DPT LGSLTLFRSIVQS CYPLA YL+VRHNR HV
Sbjct  23   AGIMERADESLLPGVYNEVGAALHTDPTGLGSLTLFRSIVQSGCYPLATYLAVRHNRTHV  82

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  83   IALGAFLWAAAT  94



>ref|XP_008233756.1| PREDICTED: protein spinster homolog 2-like [Prunus mume]
Length=522

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG +LH DPT LGSLTLFRSIVQS CYPLAAYL++RHNRAHV
Sbjct  14   ASIMQRADESLLPGVYKEVGASLHTDPTGLGSLTLFRSIVQSACYPLAAYLAMRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_007208192.1| hypothetical protein PRUPE_ppa020859mg [Prunus persica]
 gb|EMJ09391.1| hypothetical protein PRUPE_ppa020859mg [Prunus persica]
Length=522

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG +LH DPT LGSLTLFRSIVQS CYPLAAYL++RHNRAHV
Sbjct  14   ASIMQRADESLLPGVYKEVGASLHTDPTGLGSLTLFRSIVQSACYPLAAYLAMRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_004289317.2| PREDICTED: uncharacterized protein LOC101305892 [Fragaria vesca 
subsp. vesca]
Length=523

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG +LH DPT LGSLTLFRSIVQS CYPLAAYL++RHNRAHV
Sbjct  16   ASIMQRADESLLPGVYKEVGASLHTDPTGLGSLTLFRSIVQSSCYPLAAYLAMRHNRAHV  75

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  76   IALGAFLWAAAT  87



>gb|EPS73054.1| hypothetical protein M569_01700, partial [Genlisea aurea]
Length=503

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLP VYKEVGE LHADPT LGSLTLFRSIVQ+LCYPLAAYL+ RHNRA +
Sbjct  14   AGIMERADESLLPAVYKEVGEELHADPTGLGSLTLFRSIVQALCYPLAAYLASRHNRALI  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IAYGAFLWSAAT  85



>gb|KFK42199.1| hypothetical protein AALP_AA2G224400 [Arabis alpina]
Length=489

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLA Y+S+RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLLRSMVQAICYPLATYMSLRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_010416784.1| PREDICTED: uncharacterized protein LOC104702599 isoform X1 [Camelina 
sativa]
 ref|XP_010416785.1| PREDICTED: uncharacterized protein LOC104702599 isoform X2 [Camelina 
sativa]
Length=490

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAVCYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_010472021.1| PREDICTED: uncharacterized protein LOC104751709 [Camelina sativa]
Length=490

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAVCYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>gb|KHG02267.1| Protein spinster [Gossypium arboreum]
Length=513

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL+RSIVQ+ CYPLAAYL++ HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLYRSIVQTCCYPLAAYLAMYHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010428932.1| PREDICTED: uncharacterized protein LOC104713493 isoform X2 [Camelina 
sativa]
Length=486

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAVCYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_010428931.1| PREDICTED: uncharacterized protein LOC104713493 isoform X1 [Camelina 
sativa]
Length=486

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAVCYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>gb|KEH20847.1| MFS transporter [Medicago truncatula]
Length=514

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG AL+ADPT LGSLTLFRS+VQS CYPLA YL+ R+NR+HV
Sbjct  15   AGIMERADESLLPGVYKEVGAALNADPTALGSLTLFRSLVQSFCYPLATYLATRYNRSHV  74

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  75   IALGAFLWAAAT  86



>emb|CDY14626.1| BnaC02g24870D [Brassica napus]
Length=436

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ++CYPLAAY+S+R+NRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLLRSMVQAVCYPLAAYMSMRYNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_004504065.1| PREDICTED: hexuronate transporter-like [Cicer arietinum]
Length=512

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIM+RADESLLPGVYKEVG  L+A+PT LGSLTL+RS+VQSLCYPLAAYL+ RHNRAHV
Sbjct  16   AGIMQRADESLLPGVYKEVGAELNANPTALGSLTLYRSLVQSLCYPLAAYLATRHNRAHV  75

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  76   IALGAFLWAAAT  87



>gb|KJB40382.1| hypothetical protein B456_007G061200 [Gossypium raimondii]
Length=513

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL+RS+VQ+ CYPLAAYL++ HNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLYRSVVQTSCYPLAAYLAMYHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_006585281.1| PREDICTED: uncharacterized protein LOC100787672 isoform X2 [Glycine 
max]
 ref|XP_006585282.1| PREDICTED: uncharacterized protein LOC100787672 isoform X3 [Glycine 
max]
Length=468

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERADESLLPGVYKE+G AL+ADPT LGSLT FRSIVQSLCYPLAAYL+ RHNRAHVIA 
Sbjct  1    MERADESLLPGVYKEIGAALNADPTALGSLTFFRSIVQSLCYPLAAYLATRHNRAHVIAL  60

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  61   GAFLWAAAT  69



>ref|XP_007047981.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX92138.1| Major facilitator superfamily protein [Theobroma cacao]
Length=697

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTLFRSIVQS CYPLAAYL++ +NRAHV
Sbjct  192  AGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPLAAYLAMHYNRAHV  251

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  252  IALGAFLWAAAT  263



>gb|KGN48756.1| hypothetical protein Csa_6G500480 [Cucumis sativus]
Length=516

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMER DESLLPGVYKEVG ALH DPT LGSLTLFRS+VQS CYPLAAYL+V HNRAHV
Sbjct  14   AAIMERTDESLLPGVYKEVGAALHIDPTGLGSLTLFRSVVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAVGAFLWAAAT  85



>ref|XP_006301526.1| hypothetical protein CARUB_v10021954mg [Capsella rubella]
 gb|EOA34424.1| hypothetical protein CARUB_v10021954mg [Capsella rubella]
Length=488

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ+ CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAACYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_009591227.1| PREDICTED: uncharacterized protein LOC104088279 [Nicotiana tomentosiformis]
Length=492

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG+ LH DPT LGSLT+FRS+VQ LCYPLAAYL+ RHNRAHV
Sbjct  26   AGIMERADESLLPGVYKEVGKDLHTDPTGLGSLTVFRSLVQCLCYPLAAYLAARHNRAHV  85

Query  453  IAXGAFLWAAAT  488
            IA GA LW+AAT
Sbjct  86   IALGALLWSAAT  97



>ref|XP_004143560.1| PREDICTED: protein spinster-like [Cucumis sativus]
 ref|XP_004160158.1| PREDICTED: protein spinster-like [Cucumis sativus]
Length=520

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMER DESLLPGVYKEVG ALH DPT LGSLTLFRS+VQS CYPLAAYL+V HNRAHV
Sbjct  14   AAIMERTDESLLPGVYKEVGAALHIDPTGLGSLTLFRSVVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAVGAFLWAAAT  85



>gb|KEH20845.1| MFS transporter [Medicago truncatula]
Length=514

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG  L+ADPT LGSLTLFRS+VQS CYPLAAYL+ RHNRAHV
Sbjct  14   ASIMQRADESLLPGVYKEVGAELNADPTALGSLTLFRSLVQSFCYPLAAYLATRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|NP_177937.1| protein UNFERTILIZED EMBRYO SAC 2 [Arabidopsis thaliana]
 gb|AAG52102.1|AC012680_13 putative transporter; 34935-36578 [Arabidopsis thaliana]
 gb|AAO42813.1| At1g78130 [Arabidopsis thaliana]
 dbj|BAE99345.1| transporter like protein [Arabidopsis thaliana]
 gb|AEE36070.1| putative transporter [Arabidopsis thaliana]
Length=490

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALH DPT LGSLTL RS+VQ+ CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAACYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_004239990.1| PREDICTED: uncharacterized protein LOC101247024 [Solanum lycopersicum]
Length=483

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 1/72 (1%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADE+LLPGVYKEVGE LH DPT LGSLTLFRS+VQ LCYPLAAYLS RHNRAHV
Sbjct  20   AGIMEKADETLLPGVYKEVGEDLHTDPTGLGSLTLFRSLVQCLCYPLAAYLS-RHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  79   IALGAFLWSAAT  90



>ref|XP_009802680.1| PREDICTED: uncharacterized protein LOC104248179 [Nicotiana sylvestris]
Length=485

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADESLLPG YKEVG+ LH DPT LGSLT+FRS+VQ LCYPLAAYL+ RHNRAHV
Sbjct  20   AGIMEKADESLLPGAYKEVGKELHTDPTGLGSLTVFRSLVQCLCYPLAAYLAARHNRAHV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  80   IALGAFLWSAAT  91



>ref|XP_004237593.1| PREDICTED: uncharacterized protein LOC101252077 [Solanum lycopersicum]
Length=504

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
             GIMERADESLLPGVYKEVG+ALH DPT LGSLTL RSIVQ LCYPLAAYLS R NR HV
Sbjct  17   GGIMERADESLLPGVYKEVGKALHTDPTGLGSLTLIRSIVQCLCYPLAAYLSGRQNRTHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  77   IALGAFLWSAAT  88



>ref|XP_009339732.1| PREDICTED: uncharacterized protein LOC103931925 [Pyrus x bretschneideri]
Length=525

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG  LH DPT LGSLTLFRSIVQS CYPLAAYL++RHNRA V
Sbjct  14   ASIMQRADESLLPGVYKEVGATLHTDPTGLGSLTLFRSIVQSSCYPLAAYLAMRHNRARV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_009339958.1| PREDICTED: uncharacterized protein LOC103932138 [Pyrus x bretschneideri]
 ref|XP_009339959.1| PREDICTED: uncharacterized protein LOC103932139 [Pyrus x bretschneideri]
Length=525

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IM+RADESLLPGVYKEVG  LH DPT LGSLTLFRSIVQS CYPLAAYL++RHNRA V
Sbjct  14   ASIMQRADESLLPGVYKEVGATLHTDPTGLGSLTLFRSIVQSSCYPLAAYLAMRHNRARV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_002887723.1| hypothetical protein ARALYDRAFT_316721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63982.1| hypothetical protein ARALYDRAFT_316721 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG AL  DPT LGSLTL RS+VQ+ CYPLAAY+++RHNRAHV
Sbjct  14   AGIMERADESLLPGVYKEVGLALQTDPTGLGSLTLLRSMVQAACYPLAAYMAIRHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  74   IALGAFLWSAAT  85



>ref|XP_008440603.1| PREDICTED: LOW QUALITY PROTEIN: protein spinster [Cucumis melo]
Length=520

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMER D SLLPGVYKEVG ALH DPT LGSLTLFRS+VQS CYPLAAYL+V HNRAHV
Sbjct  14   AAIMERTDXSLLPGVYKEVGAALHIDPTGLGSLTLFRSVVQSSCYPLAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IAVGAFLWAAAT  85



>ref|XP_006366531.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=482

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADE+LLP VY E+G+ LH DPT LGSLTLFRS+VQ LCYPLAAYLS RHNRAHV
Sbjct  17   AGIMEKADETLLPYVYTEIGKDLHTDPTGLGSLTLFRSLVQCLCYPLAAYLSTRHNRAHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  77   IAFGAFLWSAAT  88



>ref|XP_009615250.1| PREDICTED: protein spinster-like isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME+ADESLLPGVYKEVG+ LH DPT LGSLTLFRS++Q LCYPLAAYL+ R+NRAHV
Sbjct  20   ASIMEKADESLLPGVYKEVGKDLHTDPTGLGSLTLFRSLIQCLCYPLAAYLAARYNRAHV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  80   IAIGAFLWSAAT  91



>emb|CDP20195.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERADESLLPGVY EVG ALH DPT LGSLTLFRSIVQ+ CYPLA YL+VRHNR HVIA 
Sbjct  1    MERADESLLPGVYNEVGAALHTDPTGLGSLTLFRSIVQTACYPLATYLAVRHNRTHVIAL  60

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  61   GAFLWAAAT  69



>ref|XP_006366518.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=488

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADE+LLP VY E+G+ LH DPT LGSLTLFRS+VQ LCYPLAAYLS  HNRAHV
Sbjct  22   AGIMEKADETLLPNVYTEIGKDLHTDPTGLGSLTLFRSLVQCLCYPLAAYLSAHHNRAHV  81

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  82   IALGAFLWSAAT  93



>ref|XP_009387123.1| PREDICTED: protein spinster homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=521

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY EVG ALHA PT LGSLTLFRSIVQS CYPLAAYL+ RHNR HV
Sbjct  17   AAIMERADEALLPAVYHEVGAALHASPTGLGSLTLFRSIVQSACYPLAAYLATRHNRTHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  77   IALGAFLWAAAT  88



>ref|XP_004240239.1| PREDICTED: thiamine pathway transporter THI73-like [Solanum lycopersicum]
Length=484

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADE+LLP VY E+G+ LH DPT LGSLTLFRS+VQ LCYPLAAYLS R NRAHV
Sbjct  22   AGIMEKADETLLPNVYTEIGKDLHTDPTGLGSLTLFRSLVQCLCYPLAAYLSTRRNRAHV  81

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  82   IAFGAFLWSAAT  93



>ref|XP_009800196.1| PREDICTED: uncharacterized protein LOC104246138 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME+ADESLLPGVY EVG+ LH DPT LGSLTLFRS+VQ LCYPLAAY + R+NRAHV
Sbjct  20   ASIMEKADESLLPGVYNEVGKDLHTDPTGLGSLTLFRSLVQCLCYPLAAYFAARYNRAHV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+AAT
Sbjct  80   IAIGAFLWSAAT  91



>ref|XP_006464223.1| PREDICTED: protein spinster homolog 1-like [Citrus sinensis]
Length=523

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERAD SLLPGVYKEVG ALH DP  L SLTLFRSIVQS CYPLAAYL V HNRAHV
Sbjct  14   AGIMERADVSLLPGVYKEVGAALHTDPIGLDSLTLFRSIVQSSCYPLAAYLFVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWATAT  85



>ref|XP_002285800.1| PREDICTED: protein spinster homolog 3 [Vitis vinifera]
 emb|CBI19148.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLL GVYKEVG ALH DPT LGSLTLFRS+VQ+  YPLA YL+ RHNR HV
Sbjct  14   AGIMERADESLLSGVYKEVGAALHTDPTGLGSLTLFRSMVQASSYPLAVYLAARHNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>emb|CAN67717.1| hypothetical protein VITISV_002356 [Vitis vinifera]
Length=536

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLL GVYKEVG ALH DPT LGSLTLFRS+VQ+  YPLA YL+ RHNR HV
Sbjct  14   AGIMERADESLLSGVYKEVGAALHTDPTGLGSLTLFRSMVQASSYPLAVYLAARHNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010025474.1| PREDICTED: uncharacterized protein LOC104415801 [Eucalyptus grandis]
Length=522

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVYKEVG ALHA PT LGSLT  R++VQS CYPLAAYL+ RHNRAH+
Sbjct  14   ASIMERADESLLPGVYKEVGAALHAGPTALGSLTTCRAVVQSACYPLAAYLASRHNRAHI  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KCW62138.1| hypothetical protein EUGRSUZ_H04799 [Eucalyptus grandis]
Length=522

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVYKEVG ALHA PT LGSLT  R++VQS CYPLAAYL+ RHNRAH+
Sbjct  14   ASIMERADESLLPGVYKEVGAALHAGPTALGSLTTCRAVVQSACYPLAAYLASRHNRAHI  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>gb|KCW62140.1| hypothetical protein EUGRSUZ_H04800 [Eucalyptus grandis]
Length=500

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVY++VG ALH DPT LGSLTL RS VQS CYP+AAYL+ RH+RA V
Sbjct  14   AGIMERADESLLPGVYRKVGAALHTDPTGLGSLTLIRSAVQSCCYPVAAYLATRHDRARV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010937471.1| PREDICTED: uncharacterized protein LOC105056838 isoform X1 [Elaeis 
guineensis]
Length=520

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALHA PT LGSLTL RSIVQ+ CYPLA Y++VR+NR HV
Sbjct  14   AGIMERADEALLPAVYKEVGAALHATPTGLGSLTLLRSIVQAACYPLATYMAVRYNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85



>ref|XP_010937473.1| PREDICTED: uncharacterized protein LOC105056839 [Elaeis guineensis]
Length=522

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALHA PT LGSLTL RSI+Q+ CYPLA Y++VR+NR HV
Sbjct  17   AGIMERADEALLPAVYKEVGAALHATPTGLGSLTLLRSIIQAACYPLATYMAVRYNRTHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  77   IALGAFLWAAAT  88



>ref|XP_008790839.1| PREDICTED: uncharacterized protein LOC103707906 [Phoenix dactylifera]
Length=523

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALH  PT LG LTLFRS+VQ+ CYPLAAYL+VR+NRAHV
Sbjct  17   AGIMERADEALLPAVYKEVGAALHTTPTGLGFLTLFRSLVQASCYPLAAYLAVRYNRAHV  76

Query  453  IAXGAFLWAAAT  488
            IA G+FLWAAAT
Sbjct  77   IALGSFLWAAAT  88



>ref|XP_006826927.1| hypothetical protein AMTR_s00010p00174280 [Amborella trichopoda]
 gb|ERM94164.1| hypothetical protein AMTR_s00010p00174280 [Amborella trichopoda]
Length=518

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLPGVY+EVG ALH  PT LGSLTLFRSIVQ+ CYP+AAYL+V HNRAHV
Sbjct  14   ASIMERADEALLPGVYREVGLALHTSPTGLGSLTLFRSIVQASCYPIAAYLAVHHNRAHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  74   IALGAFLWAIAT  85



>ref|XP_009390589.1| PREDICTED: uncharacterized protein LOC103976949 [Musa acuminata 
subsp. malaccensis]
Length=512

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG AL A PT LGSLTLFRSIVQ+ CYPLAAY+S+R++R HV
Sbjct  19   AGIMERADEALLPAVYKEVGAALDATPTALGSLTLFRSIVQTCCYPLAAYMSMRYDRTHV  78

Query  453  IAXGAFLWAAAT  488
            +A GAFLW+AAT
Sbjct  79   VALGAFLWSAAT  90



>ref|XP_010238118.1| PREDICTED: uncharacterized protein LOC100840670 [Brachypodium 
distachyon]
Length=172

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL+RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  67   AAIMERADEALLPAVYREVGAALHATPMGLGALTLYRSFVQAACYPLAAYAAVRYNRAHV  126

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  127  IAVGAFLWAAAT  138



>gb|EMT12843.1| Cis,cis-muconate transport protein [Aegilops tauschii]
Length=421

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPLAAYAASRHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>ref|XP_008808071.1| PREDICTED: uncharacterized protein LOC103720238 [Phoenix dactylifera]
Length=1038

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALHA PT LGSLTL RSIVQ+ CYPLA Y++VR+NR HV
Sbjct  532  AGIMERADEALLPAVYKEVGAALHASPTGLGSLTLLRSIVQAACYPLATYMAVRYNRTHV  591

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  592  IALGAFLWAAAT  603


 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALHA PT LGSLTL RS+VQ+ CYPLA Y++VR++R H+
Sbjct  17   AGIMERADEALLPAVYKEVGAALHATPTGLGSLTLLRSVVQAACYPLAIYMAVRYDRTHI  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  77   IALGAFLWAAAT  88



>dbj|BAJ88628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPLAAYAASRHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>ref|XP_010937472.1| PREDICTED: uncharacterized protein LOC105056838 isoform X2 [Elaeis 
guineensis]
Length=1036

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALHA PT LGSLTL RSIVQ+ CYPLA Y++VR+NR HV
Sbjct  14   AGIMERADEALLPAVYKEVGAALHATPTGLGSLTLLRSIVQAACYPLATYMAVRYNRTHV  73

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  74   IALGAFLWAAAT  85


 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADE+LLP VYKEVG ALHA PT LGSLTL RSIVQ+ CYPL+ Y++VR+NR HV
Sbjct  530  AGIMERADEALLPAVYKEVGAALHATPTGLGSLTLLRSIVQAACYPLSTYMAVRYNRTHV  589

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  590  IALGAFLWAAAT  601



>ref|XP_004956686.1| PREDICTED: protein spinster homolog 2-like isoform X2 [Setaria 
italica]
Length=366

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYP+AAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPVAAYAASRHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IALGAFLWAAAT  90



>ref|XP_011098488.1| PREDICTED: uncharacterized protein LOC105177140 [Sesamum indicum]
Length=513

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVGE L   PT LGSLTLFRS+VQ++CYPLAAYL+  HNRA V
Sbjct  14   AGIMERADESLLPGVYKEVGETLQTGPTGLGSLTLFRSMVQAICYPLAAYLASFHNRAVV  73

Query  453  IAXGAFLWAAAT  488
            I+ GAFLWA AT
Sbjct  74   ISYGAFLWAGAT  85



>gb|EYU24000.1| hypothetical protein MIMGU_mgv1a004501mg [Erythranthe guttata]
Length=524

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERADESLLPGVYKEVG ALHA PTRLGSLTLFRSIVQS CYPLAAYLSVRHNR HV
Sbjct  14   AGIMERADESLLPGVYKEVGAALHASPTRLGSLTLFRSIVQSSCYPLAAYLSVRHNRTHV  73

Query  453  I  455
            I
Sbjct  74   I  74



>ref|NP_001132300.1| hypothetical protein [Zea mays]
 gb|ACF81094.1| unknown [Zea mays]
 tpg|DAA61212.1| TPA: hypothetical protein ZEAMMB73_106604 [Zea mays]
Length=506

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYP+AAY + RHNRAHV
Sbjct  17   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPVAAYAASRHNRAHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  77   IALGAFLWAAAT  88



>ref|XP_009380853.1| PREDICTED: uncharacterized protein LOC103969126 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A I+ERADE+LLP VYKEVG ALH  P  LGSLTLFRSIVQS CYPLAAY++ RHNR HV
Sbjct  17   AAILERADEALLPAVYKEVGAALHVSPAGLGSLTLFRSIVQSSCYPLAAYMAARHNRTHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLWA AT
Sbjct  77   IALGAFLWATAT  88



>ref|XP_008650920.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=534

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYP+AAY + RHNRAHV
Sbjct  17   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPVAAYAASRHNRAHV  76

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  77   IALGAFLWAAAT  88



>ref|XP_002462294.1| hypothetical protein SORBIDRAFT_02g023360 [Sorghum bicolor]
 gb|EER98815.1| hypothetical protein SORBIDRAFT_02g023360 [Sorghum bicolor]
Length=520

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYP+AAY + RHNRAHV
Sbjct  20   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPVAAYAASRHNRAHV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  80   IALGAFLWAAAT  91



>ref|XP_004956685.1| PREDICTED: protein spinster homolog 2-like isoform X1 [Setaria 
italica]
Length=518

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL+RSIVQ+ CYP+AAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHATPTGLGALTLYRSIVQAACYPVAAYAASRHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IALGAFLWAAAT  90



>ref|XP_003578045.1| PREDICTED: uncharacterized protein LOC100840971 [Brachypodium 
distachyon]
Length=505

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALH  PT LG+LTL+RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHTTPTGLGALTLYRSIVQAGCYPLAAYAASRHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>ref|XP_010239351.1| PREDICTED: uncharacterized protein LOC100830548 [Brachypodium 
distachyon]
Length=1190

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHADPT LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  177  ASIMERADEALLPAVYREVGAALHADPTWLGALTLCRSIVQAACYPLAAYAAARHNRAHV  236

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  237  IAVGAFLWAAAT  248


 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHADPT LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  711  ASIMERADEALLPAVYREVGAALHADPTWLGALTLCRSIVQAACYPLAAYAAARHNRAHV  770

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  771  IAVGAFLWAAAT  782



>ref|XP_004959412.1| PREDICTED: protein spinster-like [Setaria italica]
Length=514

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RSIVQ++CYPLAAY + RHNRAHV
Sbjct  18   ASIMERADEALLPAVYREVGAALHATPAGLGALTLCRSIVQAVCYPLAAYAAARHNRAHV  77

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  78   IAVGAFLWAAAT  89



>tpg|DAA61214.1| TPA: hypothetical protein ZEAMMB73_831938 [Zea mays]
Length=535

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  30   ASIMERADEALLPAVYREVGAALHASPAGLGALTLCRSIVQAACYPLAAYAAARHNRAHV  89

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  90   IAVGAFLWAAAT  101



>gb|EMS50668.1| hypothetical protein TRIUR3_13543 [Triticum urartu]
Length=765

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+E+G A+HADPT LGSLTL RSIVQ+ CYPLAAY + RHNRA V
Sbjct  23   ASIMERADEALLPAVYREIGAAMHADPTWLGSLTLCRSIVQAACYPLAAYAAARHNRARV  82

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  83   IAVGAFLWAAAT  94



>ref|XP_006660580.1| PREDICTED: uncharacterized protein LOC102700176 [Oryza brachyantha]
Length=496

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALH  PT LG+LTL RS+VQ+ CYPLAAY + RHNRAHV
Sbjct  38   ASIMERADEALLPAVYREVGAALHDTPTGLGALTLCRSVVQATCYPLAAYAAPRHNRAHV  97

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  98   IAVGAFLWAAAT  109



>ref|XP_002462296.1| hypothetical protein SORBIDRAFT_02g023380 [Sorghum bicolor]
 gb|EER98817.1| hypothetical protein SORBIDRAFT_02g023380 [Sorghum bicolor]
Length=523

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+L+L RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHASPAGLGALSLCRSIVQAACYPLAAYAAARHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>tpg|DAA61208.1| TPA: hypothetical protein ZEAMMB73_278988 [Zea mays]
Length=195

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG AL A P  LG+LTL+RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  15   AAIMERADEALLPAVYREVGAALGATPVALGALTLYRSAVQAACYPLAAYAAVRYNRAHV  74

Query  453  IAXGAFLWAAAT  488
            +A GA LWAAAT
Sbjct  75   VAVGAVLWAAAT  86



>ref|XP_010321463.1| PREDICTED: thiamine pathway transporter THI73-like isoform X2 
[Solanum lycopersicum]
Length=391

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLPGVYKEVG+ L+ DP  LGSL+L+RS+VQ LCYP+AA+L+ RHNRA+V
Sbjct  23   AAIMEMADETLLPGVYKEVGKDLNIDPAGLGSLSLYRSLVQCLCYPIAAFLAARHNRANV  82

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  83   IALGAFLWSGAT  94



>ref|XP_008652638.1| PREDICTED: uncharacterized protein LOC103632660 [Zea mays]
Length=1036

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  19   ASIMERADEALLPAVYREVGAALHASPAGLGALTLCRSIVQAACYPLAAYAAARHNRAHV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90


 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLP VY+EVG ALHA P  LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  545  ASIMECADEALLPAVYREVGAALHATPAGLGALTLCRSIVQAACYPLAAYAAARHNRAHV  604

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  605  IAVGAFLWAAAT  616



>ref|XP_006366533.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=479

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADESLLPGVYKEVG+ L  DP  LGSL+L+RS+VQ LCYPLAA+L+ RHNRA+V
Sbjct  15   AAIMEMADESLLPGVYKEVGKDLGIDPAGLGSLSLYRSLVQCLCYPLAAFLAARHNRANV  74

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+A T
Sbjct  75   IALGAFLWSATT  86



>ref|XP_006366532.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=479

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADESLLPGVYKEVG+ L  DP  LGSL+L+RS+VQ LCYPLAA+L+ RHNRA+V
Sbjct  15   AAIMEMADESLLPGVYKEVGKDLGIDPAGLGSLSLYRSLVQCLCYPLAAFLAARHNRANV  74

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  75   IALGAFLWSGAT  86



>gb|KDO37750.1| hypothetical protein CISIN_1g039825mg [Citrus sinensis]
Length=117

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIMERAD SLLPGVYKEVG ALH DP  L SLTLFRSIVQS CYPLAAYL V HNRAHV
Sbjct  14   AGIMERADVSLLPGVYKEVGAALHTDPIGLDSLTLFRSIVQSSCYPLAAYLFVHHNRAHV  73

Query  453  IA  458
            IA
Sbjct  74   IA  75



>ref|XP_004240241.1| PREDICTED: thiamine pathway transporter THI73-like isoform X1 
[Solanum lycopersicum]
Length=487

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLPGVYKEVG+ L+ DP  LGSL+L+RS+VQ LCYP+AA+L+ RHNRA+V
Sbjct  23   AAIMEMADETLLPGVYKEVGKDLNIDPAGLGSLSLYRSLVQCLCYPIAAFLAARHNRANV  82

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  83   IALGAFLWSGAT  94



>ref|XP_004956684.1| PREDICTED: uncharacterized protein LOC101757627 isoform X1 [Setaria 
italica]
Length=469

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL+RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  17   AAIMERADEALLPAVYREVGAALHATPMGLGALTLYRSAVQAACYPLAAYAAVRYNRAHV  76

Query  453  IAXGAFLWAAAT  488
            +A GA LWAAAT
Sbjct  77   VAVGAVLWAAAT  88



>ref|XP_006366534.1| PREDICTED: protein spinster-like [Solanum tuberosum]
Length=487

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLPGVYKEVG+ L  DP  LGSL+L+RS+VQ LCYPLAA+L+ RHNRA+V
Sbjct  23   AAIMEMADETLLPGVYKEVGKDLGIDPAGLGSLSLYRSLVQCLCYPLAAFLAARHNRANV  82

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  83   IALGAFLWSGAT  94



>tpg|DAA61213.1| TPA: hypothetical protein ZEAMMB73_675601 [Zea mays]
Length=509

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLP VY+EVG ALHA P  LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  18   ASIMECADEALLPAVYREVGAALHATPAGLGALTLCRSIVQAACYPLAAYAAARHNRAHV  77

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  78   IAVGAFLWAAAT  89



>ref|XP_004959413.1| PREDICTED: protein spinster-like [Setaria italica]
Length=519

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS+VQ+ CYPLAAY + RHNRA V
Sbjct  19   ASIMERADEALLPAVYREVGAALHATPAGLGALTLCRSVVQAACYPLAAYAAARHNRARV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>ref|XP_002462295.1| hypothetical protein SORBIDRAFT_02g023370 [Sorghum bicolor]
 gb|EER98816.1| hypothetical protein SORBIDRAFT_02g023370 [Sorghum bicolor]
Length=511

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLP VY+EVG ALHA P  LG+LTL RSIVQ+ CYPLAAY + RHNRAHV
Sbjct  18   ASIMECADEALLPAVYREVGAALHATPAGLGALTLCRSIVQAACYPLAAYAAARHNRAHV  77

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  78   IAVGAFLWAAAT  89



>ref|XP_002460144.1| hypothetical protein SORBIDRAFT_02g023340 [Sorghum bicolor]
 gb|EER96665.1| hypothetical protein SORBIDRAFT_02g023340 [Sorghum bicolor]
Length=520

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG+AL A P  LG LTL+RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  16   AAIMERADEALLPAVYREVGDALGATPVALGGLTLYRSAVQAACYPLAAYAAVRYNRAHV  75

Query  453  IAXGAFLWAAAT  488
            +A GA LWAAAT
Sbjct  76   VAVGALLWAAAT  87



>ref|XP_006659387.1| PREDICTED: uncharacterized protein LOC102702208 [Oryza brachyantha]
Length=512

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVGEALHA P  LG+LTL RS VQ+ CYPLAAY +VR++R  V
Sbjct  15   ASIMERADEALLPAVYREVGEALHATPAGLGALTLCRSSVQAACYPLAAYAAVRYDRTRV  74

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  75   VALGAFLWAAAT  86



>ref|XP_001772716.1| predicted protein [Physcomitrella patens]
 gb|EDQ62430.1| predicted protein [Physcomitrella patens]
Length=516

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+L+PGVY+E+G ALHA P +LGSLTL RS+VQ++C PLAAY +V HNRA+V
Sbjct  21   ASIMERADEALVPGVYREIGLALHASPAKLGSLTLVRSLVQAICAPLAAYAAVNHNRANV  80

Query  453  IAXGAFLWAAAT  488
            IA GA +WA AT
Sbjct  81   IAFGAIMWAVAT  92



>ref|NP_001151945.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 gb|ACG45106.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 tpg|DAA61209.1| TPA: carbohydrate transporter/ sugar porter/ transporter [Zea 
mays]
Length=519

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG AL A P  LG+LTL+RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  15   AAIMERADEALLPAVYREVGAALGATPVALGALTLYRSAVQAACYPLAAYAAVRYNRAHV  74

Query  453  IAXGAFLWAAAT  488
            +A GA LWAAAT
Sbjct  75   VAVGAVLWAAAT  86



>ref|XP_008651564.1| PREDICTED: carbohydrate transporter/ sugar porter/ transporter 
isoform X1 [Zea mays]
 gb|ACN29067.1| unknown [Zea mays]
 tpg|DAA61210.1| TPA: hypothetical protein ZEAMMB73_278988 [Zea mays]
Length=518

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG AL A P  LG+LTL+RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  15   AAIMERADEALLPAVYREVGAALGATPVALGALTLYRSAVQAACYPLAAYAAVRYNRAHV  74

Query  453  IAXGAFLWAAAT  488
            +A GA LWAAAT
Sbjct  75   VAVGAVLWAAAT  86



>ref|XP_010321609.1| PREDICTED: uncharacterized protein LOC101255402 [Solanum lycopersicum]
Length=143

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLPGVY+EVG  L  DP  LGSL+ +RS+VQ LCYPLAA+L+ RHN A+ 
Sbjct  22   ASIMEMADETLLPGVYEEVGMDLRIDPAGLGSLSFYRSLVQCLCYPLAAFLASRHNHANG  81

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  82   IALGAFLWSGAT  93



>ref|XP_004973408.1| PREDICTED: protein spinster-like [Setaria italica]
Length=490

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VYKEVG AL A PT LGSLTL R++VQ+ CYPLAAY S RH+RA V
Sbjct  21   ASVLEKADEVLLPAVYKEVGAALGASPTALGSLTLCRALVQTACYPLAAYASARHDRARV  80

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  81   VAVGAFLWAAAT  92



>gb|ACN34599.1| unknown [Zea mays]
 tpg|DAA49103.1| TPA: carbohydrate transporter/ sugar porter/ transporter [Zea 
mays]
Length=486

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VYKEVG AL A PT LGSLTL R++VQ+ CYPLAAY S RH+RA V
Sbjct  20   ASVLEKADEVLLPAVYKEVGTALGASPTALGSLTLCRALVQAACYPLAAYASARHDRARV  79

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  80   VAVGAFLWAAAT  91



>ref|NP_001149291.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 gb|ACG34874.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
Length=486

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VYKEVG AL A PT LGSLTL R++VQ+ CYPLAAY S RH+RA V
Sbjct  20   ASVLEKADEVLLPAVYKEVGTALGASPTALGSLTLCRALVQAACYPLAAYASARHDRARV  79

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  80   VAVGAFLWAAAT  91



>ref|XP_002444321.1| hypothetical protein SORBIDRAFT_07g020120 [Sorghum bicolor]
 gb|EES13816.1| hypothetical protein SORBIDRAFT_07g020120 [Sorghum bicolor]
Length=494

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VYKEVG AL A PT LGSLTL R++VQ+ CYPLAAY S RH+RA V
Sbjct  22   ASVLEKADEVLLPAVYKEVGAALGASPTALGSLTLCRALVQAACYPLAAYASARHDRARV  81

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  82   VAVGAFLWAAAT  93



>ref|NP_001061782.1| Os08g0409900 [Oryza sativa Japonica Group]
 dbj|BAC99637.1| transporter-like protein [Oryza sativa Japonica Group]
 dbj|BAF23696.1| Os08g0409900 [Oryza sativa Japonica Group]
Length=508

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVGEAL A P  LG+LTL RS VQ+ CYPLAAY +VR++RA V
Sbjct  15   AAIMERADEALLPAVYREVGEALRATPAALGALTLCRSSVQAACYPLAAYAAVRYDRARV  74

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  75   VALGAFLWAAAT  86



>ref|XP_004239989.1| PREDICTED: thiamine pathway transporter THI73-like [Solanum lycopersicum]
Length=482

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLP VYKEVG+ L+ DP  LGSL+L+RS+VQ LCYP+AA+L+  HNRA+V
Sbjct  16   ASIMEMADETLLPRVYKEVGKDLNIDPAGLGSLSLYRSLVQCLCYPIAAFLAASHNRANV  75

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  76   IALGAFLWSGAT  87



>ref|XP_010321607.1| PREDICTED: uncharacterized protein LOC101254800 [Solanum lycopersicum]
Length=386

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME ADE+LLPGVYKEVG+ L  DP  LGSL+L+RS+VQ LCYPLAA+L+ RHN A+ 
Sbjct  18   AAIMEMADETLLPGVYKEVGKDLRIDPAGLGSLSLYRSLVQCLCYPLAAFLAARHNCAND  77

Query  453  IAXGAFLWAAA  485
            IA GAFLW+ A
Sbjct  78   IALGAFLWSGA  88



>gb|EMS50666.1| hypothetical protein TRIUR3_13541 [Triticum urartu]
Length=430

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL A PT LGS+ L RS+VQ+ CYPLAAYL+ RH+R  VIA 
Sbjct  28   MERADSALLPAVYREIGAALQASPTALGSIALSRSVVQAACYPLAAYLAARHDRLTVIAL  87

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  88   GAFLWAAAT  96



>gb|EAZ42703.1| hypothetical protein OsJ_27271 [Oryza sativa Japonica Group]
Length=508

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+L P VY++VGEAL A P  LG+LTL RS VQ+ CYPLAAY +VR++RA V
Sbjct  15   AAIMERADEALFPAVYRKVGEALRAKPAALGALTLCRSSVQAACYPLAAYAAVRYDRARV  74

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  75   VALGAFLWAAAT  86



>gb|EAZ06969.1| hypothetical protein OsI_29210 [Oryza sativa Indica Group]
Length=508

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMER DE+LLP VY+EVGEAL A P  LG+LTL RS VQ+ CYPLAAY +VR++RA V
Sbjct  15   AAIMERVDEALLPAVYREVGEALRATPAALGALTLCRSSVQAACYPLAAYTAVRYDRARV  74

Query  453  IAXGAFLWAAAT  488
            +  GAFLWAAAT
Sbjct  75   VTLGAFLWAAAT  86



>ref|XP_003578046.1| PREDICTED: uncharacterized protein LOC100841274 [Brachypodium 
distachyon]
Length=487

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL A PT LGS+ L RS+VQ+ CYPLAAYL+ RH+R  VIA 
Sbjct  29   MERADAALLPSVYREIGAALQASPTALGSIALSRSVVQAACYPLAAYLAARHDRLSVIAL  88

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  89   GAFLWAAAT  97



>gb|EMT12844.1| hypothetical protein F775_24843 [Aegilops tauschii]
Length=280

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL   PT LGS+ L RS+VQ+ CYPLAAYL+ RH+R  VIA 
Sbjct  28   MERADAALLPAVYREIGAALQTSPTALGSIALSRSVVQAACYPLAAYLAARHDRLTVIAL  87

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  88   GAFLWAAAT  96



>ref|XP_002985424.1| hypothetical protein SELMODRAFT_181671 [Selaginella moellendorffii]
 gb|EFJ13554.1| hypothetical protein SELMODRAFT_181671 [Selaginella moellendorffii]
Length=504

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A +ME+ADE+LLPGVYKE+GE+LH     LGSLTL RSI Q+LC+P AAY S+ ++R+ V
Sbjct  20   ASVMEQADEALLPGVYKEIGESLHTGLAALGSLTLLRSITQALCFPFAAYFSLHYDRSKV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  80   IAIGAFLWSIAT  91



>ref|XP_002979759.1| hypothetical protein SELMODRAFT_153414 [Selaginella moellendorffii]
 gb|EFJ19161.1| hypothetical protein SELMODRAFT_153414 [Selaginella moellendorffii]
Length=504

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A +ME+ADE+LLPGVYKE+GE+LH     LGSLTL RSI Q+LC+P AAY S+ ++R+ V
Sbjct  20   ASVMEQADEALLPGVYKEIGESLHTGLAALGSLTLLRSITQALCFPFAAYFSLHYDRSKV  79

Query  453  IAXGAFLWAAAT  488
            IA GAFLW+ AT
Sbjct  80   IAIGAFLWSIAT  91



>ref|XP_010321606.1| PREDICTED: uncharacterized protein LOC101254493 [Solanum lycopersicum]
Length=462

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            AGIME+ADE+LLP VY E+G+ LH DPT LGSLTLFRS+VQ LCYPLAAYLS R NR H+
Sbjct  17   AGIMEKADEALLPNVYTEIGKDLHTDPTGLGSLTLFRSLVQCLCYPLAAYLSTRRNRGHI  76



>ref|XP_001774721.1| predicted protein [Physcomitrella patens]
 gb|EDQ60536.1| predicted protein [Physcomitrella patens]
Length=520

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADESLLPGVY+E+G  LHA P +LGSLTL RS++Q++  PLAAY S+ HNR +V
Sbjct  21   AAIMERADESLLPGVYREIGLELHASPAKLGSLTLVRSLMQAIFAPLAAYASLNHNRKNV  80

Query  453  IAXGAFLWAAAT  488
            IA GA LWA AT
Sbjct  81   IALGAVLWAVAT  92



>ref|XP_004959411.1| PREDICTED: uncharacterized protein LOC101775076 [Setaria italica]
Length=488

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL A PT LGS+ L RS+VQ+ CYPLAAYL+ RH+R  VIA 
Sbjct  26   MERADAALLPAVYREIGAALQASPTALGSIALSRSVVQTACYPLAAYLAARHDRLTVIAL  85

Query  462  GAFLWAAAT  488
            GAF+WAAAT
Sbjct  86   GAFVWAAAT  94



>ref|XP_002462293.1| hypothetical protein SORBIDRAFT_02g023350 [Sorghum bicolor]
 gb|EER98814.1| hypothetical protein SORBIDRAFT_02g023350 [Sorghum bicolor]
Length=490

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL A PT LGS+ L RS+VQ+ CYPLAAYL+ RH+R  VIA 
Sbjct  26   MERADAALLPAVYREIGAALQASPTALGSIALSRSVVQTACYPLAAYLAARHDRLTVIAL  85

Query  462  GAFLWAAAT  488
            GAF+WAAAT
Sbjct  86   GAFVWAAAT  94



>ref|XP_003574467.2| PREDICTED: uncharacterized protein LOC100836982 [Brachypodium 
distachyon]
Length=591

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VY+EVG AL A PT LGSLTL R++VQ+L +PLAAY S RH+RA V
Sbjct  124  ASVLEKADEVLLPAVYREVGAALGASPTALGSLTLCRALVQALSFPLAAYASARHDRARV  183

Query  453  IAXGAFLWAAAT  488
            +A GAFLWAAAT
Sbjct  184  VAVGAFLWAAAT  195



>ref|XP_008652637.1| PREDICTED: uncharacterized protein LOC103632659 [Zea mays]
 tpg|DAA61211.1| TPA: hypothetical protein ZEAMMB73_337613 [Zea mays]
Length=492

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL A PT LGS+ L RS+VQ+ CYPLAAYL+ RH+R  VIA 
Sbjct  26   MERADAALLPAVYREIGTALQASPTALGSIALSRSVVQTACYPLAAYLAARHDRVTVIAL  85

Query  462  GAFLWAAAT  488
            GAF+WA AT
Sbjct  86   GAFVWAVAT  94



>tpg|DAA44155.1| TPA: hypothetical protein ZEAMMB73_515612 [Zea mays]
Length=484

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++ERADE+LLP VYKEVGE+L   PT LGSLTL R++VQ+LCYPLA   + R++RA V
Sbjct  23   AALLERADEALLPAVYKEVGESLGVSPTALGSLTLCRALVQTLCYPLATCAAARYDRARV  82

Query  453  IAXGAFLWAAAT  488
            +A GAFLWA AT
Sbjct  83   VAVGAFLWAVAT  94



>ref|XP_008652878.1| PREDICTED: protein spinster-like, partial [Zea mays]
Length=481

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++ERADE+LLP VYKEVGE+L   PT LGSLTL R++VQ+LCYPLA   + R++RA V
Sbjct  20   AALLERADEALLPAVYKEVGESLGVSPTALGSLTLCRALVQTLCYPLATCAAARYDRARV  79

Query  453  IAXGAFLWAAAT  488
            +A GAFLWA AT
Sbjct  80   VAVGAFLWAVAT  91



>gb|EEE68665.1| hypothetical protein OsJ_27276 [Oryza sativa Japonica Group]
Length=444

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VY+EVG  L   PT LGSLTL R+IVQ+  YPLAAY S RH+RA V
Sbjct  19   ASVLEKADEVLLPAVYREVGAELGVSPTALGSLTLCRAIVQAASYPLAAYASARHDRARV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>gb|EEC83565.1| hypothetical protein OsI_29216 [Oryza sativa Indica Group]
Length=496

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VY+EVG  L   PT LGSLTL R+IVQ+  YPLAAY S RH+RA V
Sbjct  19   ASVLEKADEVLLPAVYREVGAELGVSPTALGSLTLCRAIVQAASYPLAAYASARHDRARV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>dbj|BAC99641.1| transporter-like protein [Oryza sativa Japonica Group]
Length=481

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++E+ADE LLP VY+EVG  L   PT LGSLTL R+IVQ+  YPLAAY S RH+RA V
Sbjct  19   ASVLEKADEVLLPAVYREVGAELGVSPTALGSLTLCRAIVQAASYPLAAYASARHDRARV  78

Query  453  IAXGAFLWAAAT  488
            IA GAFLWAAAT
Sbjct  79   IAVGAFLWAAAT  90



>ref|XP_004985152.1| PREDICTED: uncharacterized protein LOC101754873 [Setaria italica]
Length=484

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  285  ERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAXG  464
            ERADE+LLP VY+EVG AL A PT LGSLTL R++VQ+LCYPLA   + RH+RA V+A G
Sbjct  22   ERADEALLPAVYREVGAALGASPTALGSLTLCRAVVQALCYPLATCAAARHDRARVVAAG  81

Query  465  AFLWAAAT  488
            AFLWA AT
Sbjct  82   AFLWAVAT  89



>gb|EAZ08854.1| hypothetical protein OsI_31116 [Oryza sativa Indica Group]
Length=107

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+L L RS VQ+ CYPLAAY +VRHNRAHV
Sbjct  24   ASIMERADEALLPAVYREVGAALHATPAGLGALMLCRSAVQAACYPLAAYSAVRHNRAHV  83

Query  453  IAX  461
            IA 
Sbjct  84   IAA  86



>dbj|BAD26403.1| transporter-like protein [Oryza sativa Japonica Group]
Length=497

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G  L A P+ LGS+ L RS+VQ+ CYPLAAYL+ RH+R  V+A 
Sbjct  33   MERADAALLPAVYREIGAGLRASPSALGSIALSRSVVQAACYPLAAYLAARHDRLTVVAL  92

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  93   GAFLWAAAT  101



>gb|EAZ08860.1| hypothetical protein OsI_31122 [Oryza sativa Indica Group]
Length=515

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LLP VY+E+G AL A P+ LGS+ L RS+VQ+ CYPLAAYL+ RH+R  V+A 
Sbjct  33   MERADAALLPAVYREIGAALLASPSALGSIALSRSVVQAACYPLAAYLAARHDRLTVVAL  92

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  93   GAFLWAAAT  101



>dbj|BAJ99144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  IMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIA  458
            ++E+ADE LLP VY+EVG AL   PT LGSLTL R++VQ+L +PLAAY S RH+RA V+A
Sbjct  23   MLEKADEVLLPAVYREVGLALAVSPTALGSLTLCRALVQALSFPLAAYASARHDRAKVVA  82

Query  459  XGAFLWAAAT  488
             GAFLWAAAT
Sbjct  83   VGAFLWAAAT  92



>ref|XP_002465621.1| hypothetical protein SORBIDRAFT_01g042390 [Sorghum bicolor]
 gb|EER92619.1| hypothetical protein SORBIDRAFT_01g042390 [Sorghum bicolor]
Length=481

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +3

Query  285  ERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAXG  464
            ERADE+LLP VYKEVGEAL   PT LGSLTL R++VQ++CYPLA   + R++RA V+A G
Sbjct  25   ERADEALLPAVYKEVGEALRVTPTALGSLTLCRALVQAVCYPLATCAAARYDRARVVAAG  84

Query  465  AFLWAAAT  488
            AFLWA AT
Sbjct  85   AFLWAVAT  92



>gb|EAZ08856.1| hypothetical protein OsI_31118 [Oryza sativa Indica Group]
Length=204

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY + RHNRAHV
Sbjct  29   ASIMERADEALLPAVYREVGAALHATPAGLGALTLCRSAVQAACYPLAAYAAARHNRAHV  88

Query  453  IAX  461
            IA 
Sbjct  89   IAA  91



>ref|NP_001063020.2| Os09g0371200 [Oryza sativa Japonica Group]
 dbj|BAF24934.2| Os09g0371200 [Oryza sativa Japonica Group]
Length=227

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY + RHNRAHV
Sbjct  52   ASIMERADEALLPAVYQEVGAALHATPAGLGALTLCRSAVQAACYPLAAYAAARHNRAHV  111

Query  453  IAX  461
            IA 
Sbjct  112  IAA  114



>gb|EAZ44506.1| hypothetical protein OsJ_29123 [Oryza sativa Japonica Group]
Length=458

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  282  MERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAX  461
            MERAD +LL  VY+E+G  L A P+ LGS+ L RS+VQ+ CYPLAAYL+ RH+R  V+A 
Sbjct  1    MERADAALLRAVYREIGAGLRASPSALGSIALSRSVVQAACYPLAAYLAARHDRLTVVAL  60

Query  462  GAFLWAAAT  488
            GAFLWAAAT
Sbjct  61   GAFLWAAAT  69



>ref|XP_002467734.1| hypothetical protein SORBIDRAFT_01g033180 [Sorghum bicolor]
 gb|EER94732.1| hypothetical protein SORBIDRAFT_01g033180 [Sorghum bicolor]
Length=490

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A ++ERADE LLP VYKEVGEAL   PT LGSL+L R++VQ++CYPLA   + R +RA V
Sbjct  19   AALLERADEQLLPAVYKEVGEALRVSPTALGSLSLCRALVQAVCYPLATCAAARCDRARV  78

Query  453  IAXGAFLWAAAT  488
            +A GA LWA AT
Sbjct  79   VAAGAVLWAVAT  90



>gb|EEE69583.1| hypothetical protein OsJ_29122 [Oryza sativa Japonica Group]
Length=494

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL RS VQ+ CYP+AAY + RHNRAHV
Sbjct  26   ASIMERADEALLPAVYREVGAALHATPTGLGALTLCRSAVQAACYPVAAYAASRHNRAHV  85

Query  453  IAX  461
            +A 
Sbjct  86   VAA  88



>gb|EEE69582.1| hypothetical protein OsJ_29121 [Oryza sativa Japonica Group]
Length=525

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY + RHNRAHV
Sbjct  29   ASIMERADEALLPAVYQEVGAALHATPAGLGALTLCRSAVQAACYPLAAYAAARHNRAHV  88

Query  453  IAX  461
            IA 
Sbjct  89   IAA  91



>dbj|BAD26401.1| transporter-like protein [Oryza sativa Japonica Group]
Length=520

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL RS VQ+ CYP+AAY + RHNRAHV
Sbjct  26   ASIMERADEALLPAVYREVGAALHATPTGLGALTLCRSAVQAACYPVAAYAASRHNRAHV  85

Query  453  IAX  461
            +A 
Sbjct  86   VAA  88



>ref|NP_001063021.1| Os09g0371300 [Oryza sativa Japonica Group]
 dbj|BAF24935.1| Os09g0371300 [Oryza sativa Japonica Group]
Length=507

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL RS VQ+ CYP+AAY + RHNRAHV
Sbjct  26   ASIMERADEALLPAVYREVGAALHATPTGLGALTLCRSAVQAACYPVAAYAASRHNRAHV  85

Query  453  IAX  461
            +A 
Sbjct  86   VAA  88



>gb|EAZ08858.1| hypothetical protein OsI_31120 [Oryza sativa Indica Group]
Length=547

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA PT LG+LTL RS VQ+ CYP+AAY + RHNRAHV
Sbjct  26   ASIMERADEALLPAVYREVGAALHATPTGLGALTLCRSAVQAACYPVAAYAASRHNRAHV  85

Query  453  IAX  461
            +A 
Sbjct  86   VAA  88



>dbj|BAD26399.1| membrane transport protein-like [Oryza sativa Japonica Group]
Length=516

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY + RHNRAHV
Sbjct  24   ASIMERADEALLPAVYREVGAALHATPAGLGALTLCRSAVQAACYPLAAYSAARHNRAHV  83

Query  453  IAX  461
            IA 
Sbjct  84   IAA  86



>dbj|BAD26400.1| transporter-like protein [Oryza sativa Japonica Group]
Length=576

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY + RHNRAHV
Sbjct  29   ASIMERADEALLPAVYQEVGAALHATPAGLGALTLCRSAVQAACYPLAAYAAARHNRAHV  88

Query  453  IAX  461
            IA 
Sbjct  89   IAA  91



>gb|EAZ08853.1| hypothetical protein OsI_31115 [Oryza sativa Indica Group]
Length=519

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  19   AAIMERADEALLPAVYREVGAALHATPMGLGALTLCRSFVQAACYPLAAYAAVRYNRAHV  78

Query  453  IAX  461
            +A 
Sbjct  79   VAA  81



>ref|NP_001063019.1| Os09g0371000 [Oryza sativa Japonica Group]
 dbj|BAD26398.1| transporter-like protein [Oryza sativa Japonica Group]
 dbj|BAF24933.1| Os09g0371000 [Oryza sativa Japonica Group]
 gb|EAZ44502.1| hypothetical protein OsJ_29119 [Oryza sativa Japonica Group]
 dbj|BAG98797.1| unnamed protein product [Oryza sativa Japonica Group]
Length=520

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VY+EVG ALHA P  LG+LTL RS VQ+ CYPLAAY +VR+NRAHV
Sbjct  19   AAIMERADEALLPAVYREVGAALHATPMGLGALTLCRSFVQAACYPLAAYAAVRYNRAHV  78

Query  453  IAX  461
            +A 
Sbjct  79   VAA  81



>gb|EMT05566.1| Quinolone resistance protein norA [Aegilops tauschii]
Length=527

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +3

Query  279  IMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIA  458
            ++E+ADE LLP VY+EVG AL   PT LGSLTL R++VQ+L +PLAA  S R +RA V+A
Sbjct  24   MLEKADEVLLPAVYREVGAALAVSPTALGSLTLCRALVQALSFPLAASASARPDRAKVVA  83

Query  459  XGAFLWAAAT  488
             GAFLWAAAT
Sbjct  84   VGAFLWAAAT  93



>ref|XP_001762503.1| predicted protein [Physcomitrella patens]
 gb|EDQ72626.1| predicted protein [Physcomitrella patens]
Length=465

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A I+ERADESLLP VYKEV EA  A P+ LGSLT  R+IVQ++C PLA  L++R+ R  V
Sbjct  15   AAILERADESLLPAVYKEVSEAFKASPSELGSLTFIRTIVQAVCSPLAGILAMRYYRPSV  74

Query  453  IAXGAFLWAAAT  488
            I  G   WA +T
Sbjct  75   IGLGTLFWAVST  86



>ref|XP_004148440.1| PREDICTED: uncharacterized protein LOC101209309 [Cucumis sativus]
 ref|XP_004164467.1| PREDICTED: uncharacterized protein LOC101231698 [Cucumis sativus]
 gb|KGN62081.1| hypothetical protein Csa_2G296060 [Cucumis sativus]
Length=467

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV E  +A P+ LG LT  R+ VQ LC PLA  L + ++R  V
Sbjct  19   AAIMERADENLLPSVYKEVSETFNASPSDLGYLTFIRNFVQGLCSPLAGILVLSYDRPKV  78

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  79   LAMGTFCWALST  90



>gb|AES94885.2| MFS transporter [Medicago truncatula]
Length=495

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA HA P+ LG LT  R+ VQ L  PLA  L + ++R  +
Sbjct  47   AAIMERADENLLPAVYKEVSEAFHAGPSDLGYLTFIRNFVQGLSSPLAGILVINYDRPTI  106

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  107  LAMGTFCWALST  118



>ref|XP_008457892.1| PREDICTED: putative glycerol-3-phosphate transporter 2 [Cucumis 
melo]
Length=467

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV E  +A P+ LG LT  R+ VQ LC PLA  L + ++R  V
Sbjct  19   AAIMERADENLLPSVYKEVSETFNASPSDLGYLTFIRNFVQGLCSPLAGILVLSYDRPKV  78

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  79   LAMGTFCWALST  90



>ref|XP_003611927.1| hypothetical protein MTR_5g019490 [Medicago truncatula]
Length=538

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA HA P+ LG LT  R+ VQ L  PLA  L + ++R  +
Sbjct  90   AAIMERADENLLPAVYKEVSEAFHAGPSDLGYLTFIRNFVQGLSSPLAGILVINYDRPTI  149

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  150  LAMGTFCWALST  161



>ref|XP_002983895.1| hypothetical protein SELMODRAFT_228993 [Selaginella moellendorffii]
 gb|EFJ14907.1| hypothetical protein SELMODRAFT_228993 [Selaginella moellendorffii]
Length=463

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME+ADESLLP VYKEV +  HA P+ LG+LT  R++VQ++  P A  LS+R+NR  V
Sbjct  20   AAIMEKADESLLPAVYKEVAQTFHATPSELGALTFIRALVQAIFSPAAGILSMRYNRPAV  79

Query  453  IAXGAFLWAAAT  488
            I  G   WA +T
Sbjct  80   IGLGTIFWAFST  91



>ref|XP_002960772.1| hypothetical protein SELMODRAFT_163585 [Selaginella moellendorffii]
 gb|EFJ38311.1| hypothetical protein SELMODRAFT_163585 [Selaginella moellendorffii]
Length=475

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IME+ADESLLP VYKEV +  HA P+ LG+LT  R++VQ++  P A  LS+R+NR  V
Sbjct  20   AAIMEKADESLLPAVYKEVAQTFHATPSELGALTFIRALVQAIFSPAAGILSMRYNRPAV  79

Query  453  IAXGAFLWAAAT  488
            I  G   WA +T
Sbjct  80   IGLGTIFWAFST  91



>gb|AFW89151.1| hypothetical protein ZEAMMB73_529909 [Zea mays]
Length=505

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  309  PGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHVIAXGAFLWAAAT  488
            P VY+EVGEAL A PT LGSLTL R++VQ++CYPLA   + R++RA V+A GAFLWA AT
Sbjct  35   PAVYREVGEALAASPTALGSLTLCRALVQAVCYPLATCAAARYDRARVVAAGAFLWAVAT  94



>ref|XP_002989078.1| hypothetical protein SELMODRAFT_427648 [Selaginella moellendorffii]
 gb|EFJ09872.1| hypothetical protein SELMODRAFT_427648 [Selaginella moellendorffii]
Length=453

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A +MERADE+L+P VY E+       P+ LG LT  R++VQ+L  PLAAYL++ +NRAH+
Sbjct  12   AAMMERADEALVPAVYSEIAAGFGIGPSALGWLTFVRALVQALASPLAAYLAMTYNRAHI  71

Query  453  IAXGAFLWAAAT  488
            +  GA +W AAT
Sbjct  72   VGLGALVWGAAT  83



>ref|XP_010548364.1| PREDICTED: uncharacterized protein LOC104819807 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010548365.1| PREDICTED: uncharacterized protein LOC104819807 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555440.1| PREDICTED: uncharacterized protein LOC104824938 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010555441.1| PREDICTED: uncharacterized protein LOC104824938 isoform X2 [Tarenaya 
hassleriana]
Length=445

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A +MERADE+LLP VYKEV EA +A P+ LG LT  R++VQ L  PLA  L + ++R  V
Sbjct  2    AAVMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNLVQGLASPLAGILVISYDRPTV  61

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  62   LAIGTFCWALST  73



>ref|XP_010548363.1| PREDICTED: uncharacterized protein LOC104819807 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010555439.1| PREDICTED: uncharacterized protein LOC104824938 isoform X1 [Tarenaya 
hassleriana]
Length=462

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A +MERADE+LLP VYKEV EA +A P+ LG LT  R++VQ L  PLA  L + ++R  V
Sbjct  19   AAVMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNLVQGLASPLAGILVISYDRPTV  78

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  79   LAIGTFCWALST  90



>ref|XP_008241629.1| PREDICTED: monocarboxylate transporter 2 [Prunus mume]
Length=493

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ +  PLA  L + ++R  V
Sbjct  45   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFVQGMASPLAGVLVINYDRPTV  104

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  105  LAMGTFCWALST  116



>ref|XP_008786125.1| PREDICTED: uncharacterized protein LOC103704553 isoform X2 [Phoenix 
dactylifera]
Length=464

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A PT LG LT  R+ VQ+L  PLA  L++ ++R  V
Sbjct  16   ASIMERADENLLPAVYKEVSEAFNAGPTELGYLTFIRNFVQALSSPLAGVLALHYDRPAV  75

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  76   LAMGTAFWALST  87



>ref|XP_010437305.1| PREDICTED: uncharacterized protein LOC104721094 isoform X2 [Camelina 
sativa]
Length=460

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  21   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNFVQGLASPLAGVLVITYDRPIV  80

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  81   LAIGTFCWALST  92



>ref|XP_010432136.1| PREDICTED: uncharacterized protein LOC104716456 [Camelina sativa]
Length=490

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  51   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFVQGLASPLAGVLVITYDRPIV  110

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  111  LAIGTFCWALST  122



>ref|XP_008786124.1| PREDICTED: uncharacterized protein LOC103704553 isoform X1 [Phoenix 
dactylifera]
Length=485

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A PT LG LT  R+ VQ+L  PLA  L++ ++R  V
Sbjct  37   ASIMERADENLLPAVYKEVSEAFNAGPTELGYLTFIRNFVQALSSPLAGVLALHYDRPAV  96

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  97   LAMGTAFWALST  108



>ref|XP_009379183.1| PREDICTED: uncharacterized protein LOC103967633 [Pyrus x bretschneideri]
Length=462

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ +Q +  PLA  L + ++R  V
Sbjct  19   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFIQGMASPLAGVLVINYDRPAV  78

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  79   LAMGTFCWALST  90



>ref|XP_010923447.1| PREDICTED: uncharacterized protein LOC105046534 [Elaeis guineensis]
Length=485

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A PT LG LT  R+ VQ+L  PLA  L++ ++R  V
Sbjct  37   ASIMERADENLLPAVYKEVSEAFNAGPTDLGYLTFIRNFVQALSSPLAGVLALYYDRPAV  96

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  97   LAMGTVFWALST  108



>ref|XP_009349750.1| PREDICTED: uncharacterized protein LOC103941279 [Pyrus x bretschneideri]
Length=462

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ +Q +  PLA  L + ++R  V
Sbjct  19   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFIQGMASPLAGVLVINYDRPAV  78

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  79   LAMGTFCWALST  90



>ref|XP_009374226.1| PREDICTED: uncharacterized protein LOC103963176 [Pyrus x bretschneideri]
Length=498

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ +Q L  PLA  L + ++R  V
Sbjct  50   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFIQGLASPLAGVLVINYDRPLV  109

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  110  LAMGTFCWALST  121



>ref|XP_002869023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  51   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNFVQGLASPLAGVLVITYDRPIV  110

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  111  LAIGTFCWALST  122



>ref|XP_010437304.1| PREDICTED: uncharacterized protein LOC104721094 isoform X1 [Camelina 
sativa]
Length=490

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  51   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNFVQGLASPLAGVLVITYDRPIV  110

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  111  LAIGTFCWALST  122



>ref|XP_010446742.1| PREDICTED: uncharacterized protein LOC104729498 [Camelina sativa]
Length=490

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  51   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNFVQGLASPLAGVLVITYDRPIV  110

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  111  LAIGTFCWALST  122



>ref|XP_006285423.1| hypothetical protein CARUB_v10006840mg [Capsella rubella]
 gb|EOA18321.1| hypothetical protein CARUB_v10006840mg [Capsella rubella]
Length=490

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  51   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNFVQGLASPLAGVLVITYDRPIV  110

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  111  LAIGTFCWALST  122



>ref|XP_002273483.2| PREDICTED: uncharacterized protein LOC100254794 isoform X1 [Vitis 
vinifera]
 emb|CBI17567.3| unnamed protein product [Vitis vinifera]
Length=517

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA  A P+ LG LT  R+ VQ L  PLA  L + H+R  V
Sbjct  69   ASIMERADENLLPAVYKEVSEAFSAGPSELGYLTFIRNFVQGLASPLAGVLVISHDRPTV  128

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  129  LAMGTVCWAIST  140



>ref|NP_195397.1| major facilitator protein [Arabidopsis thaliana]
 emb|CAB16804.1| putative protein [Arabidopsis thaliana]
 emb|CAB80345.1| putative protein [Arabidopsis thaliana]
 gb|AAL36255.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67457.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86701.1| major facilitator protein [Arabidopsis thaliana]
Length=489

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  51   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFVRNFVQGLASPLAGVLVITYDRPIV  110

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  111  LAIGTFCWALST  122



>ref|XP_008338799.1| PREDICTED: monocarboxylate transporter 2-like [Malus domestica]
Length=462

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ +Q +  PLA  L + ++R  V
Sbjct  19   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFIQGMASPLAGVLVINYDRPAV  78

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  79   LAMGTFCWALST  90



>ref|XP_002983793.1| hypothetical protein SELMODRAFT_422991 [Selaginella moellendorffii]
 gb|EFJ15289.1| hypothetical protein SELMODRAFT_422991 [Selaginella moellendorffii]
Length=453

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A +MERADE+L+P VY E+       P+ LG LT  R++VQ+L  PLAAYL++ +NRAH+
Sbjct  12   AAMMERADEALVPAVYSEIAACFGIGPSALGWLTFVRALVQALASPLAAYLAMTYNRAHI  71

Query  453  IAXGAFLWAAAT  488
            +  GA +W  AT
Sbjct  72   VGLGALVWGVAT  83



>ref|XP_008338168.1| PREDICTED: monocarboxylate transporter 2-like [Malus domestica]
Length=493

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA  A P+ LG LT  R+ +Q L  PLA  L + ++R  V
Sbjct  50   AAIMERADENLLPSVYKEVSEAFXAGPSDLGYLTFIRNFIQGLASPLAGVLVINYDRPSV  109

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  110  LAMGTFCWALST  121



>ref|XP_004512009.1| PREDICTED: uncharacterized protein LOC101490771 [Cicer arietinum]
Length=495

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  +
Sbjct  47   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFVQGLSSPLAGILVINYDRPTI  106

Query  453  IAXGAFLWAAAT  488
            ++ G F WA +T
Sbjct  107  LSTGIFCWALST  118



>ref|XP_011025716.1| PREDICTED: uncharacterized protein LOC105126529 [Populus euphratica]
Length=496

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + H R  V
Sbjct  48   AAIMERADENLLPAVYKEVSEAFNAGPSDLGYLTFIRNFVQGLSSPLAGILVINHARPTV  107

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  108  LAMGTLCWALST  119



>ref|XP_002525099.1| carbohydrate transporter, putative [Ricinus communis]
 gb|EEF37226.1| carbohydrate transporter, putative [Ricinus communis]
Length=485

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV E  +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  37   AAIMERADENLLPAVYKEVSETFNAGPSDLGYLTFIRNFVQGLSSPLAGVLVINYDRPTV  96

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  97   LAMGTFCWALST  108



>ref|XP_010095292.1| Protein spinster [Morus notabilis]
 gb|EXB59138.1| Protein spinster [Morus notabilis]
Length=501

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA  A P+ LG LT  R+ VQ +  PLA  L + ++R  V
Sbjct  46   AAIMERADENLLPSVYKEVSEAFSAGPSDLGYLTFIRNFVQGISSPLAGVLVINYDRPTV  105

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  106  LAMGTFCWALST  117



>ref|XP_002310787.2| hypothetical protein POPTR_0007s12360g [Populus trichocarpa]
 gb|EEE91237.2| hypothetical protein POPTR_0007s12360g [Populus trichocarpa]
Length=487

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + H R  V
Sbjct  48   AAIMERADENLLPAVYKEVSEAFNAGPSDLGYLTFIRNFVQGLSSPLAGILVINHARPTV  107

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  108  LAMGTLCWALST  119



>ref|XP_006573596.1| PREDICTED: uncharacterized protein LOC100812646 isoform X1 [Glycine 
max]
 ref|XP_006573597.1| PREDICTED: uncharacterized protein LOC100812646 isoform X2 [Glycine 
max]
 ref|XP_006573598.1| PREDICTED: uncharacterized protein LOC100812646 isoform X3 [Glycine 
max]
 ref|XP_006573599.1| PREDICTED: uncharacterized protein LOC100812646 isoform X4 [Glycine 
max]
 ref|XP_006573600.1| PREDICTED: uncharacterized protein LOC100812646 isoform X5 [Glycine 
max]
 ref|XP_006573601.1| PREDICTED: uncharacterized protein LOC100812646 isoform X6 [Glycine 
max]
Length=496

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV E  +A P+ LG LT  R+ VQ L  PLA  L + ++R  +
Sbjct  48   AAIMERADENLLPSVYKEVSETFNAGPSDLGYLTFVRNFVQGLSSPLAGILVINYDRPTI  107

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  108  LAMGTFCWALST  119



>ref|XP_004300601.1| PREDICTED: uncharacterized protein LOC101296107 [Fragaria vesca 
subsp. vesca]
Length=498

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ +  PLA  L + ++R  V
Sbjct  45   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFVQGMASPLAGVLVLLYDRPTV  104

Query  453  IAXGAFLWAAAT  488
            +A G F WA +T
Sbjct  105  LAMGTFCWAIST  116



>gb|KJB43570.1| hypothetical protein B456_007G206200 [Gossypium raimondii]
Length=493

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  45   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFVQGLASPLAGVLVINYDRPTV  104

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  105  LAIGTMCWALST  116



>gb|KHG26667.1| Protein spinster [Gossypium arboreum]
Length=493

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  273  AGIMERADESLLPGVYKEVGEALHADPTRLGSLTLFRSIVQSLCYPLAAYLSVRHNRAHV  452
            A IMERADE+LLP VYKEV EA +A P+ LG LT  R+ VQ L  PLA  L + ++R  V
Sbjct  45   AAIMERADENLLPSVYKEVSEAFNAGPSDLGYLTFIRNFVQGLASPLAGVLVINYDRPTV  104

Query  453  IAXGAFLWAAAT  488
            +A G   WA +T
Sbjct  105  LAIGTMCWALST  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485