BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023N21

Length=784
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097110.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...    506   4e-174   Sesamum indicum [beniseed]
gb|KJB48415.1|  hypothetical protein B456_008G068200                    501   3e-173   Gossypium raimondii
gb|EYU29487.1|  hypothetical protein MIMGU_mgv1a0028802mg               501   4e-173   Erythranthe guttata [common monkey flower]
emb|CDP02029.1|  unnamed protein product                                504   5e-173   Coffea canephora [robusta coffee]
gb|KEH27557.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    499   1e-172   Medicago truncatula
ref|XP_003518027.1|  PREDICTED: succinate dehydrogenase [ubiquino...    503   1e-172   Glycine max [soybeans]
ref|XP_008453738.1|  PREDICTED: succinate dehydrogenase [ubiquino...    503   1e-172   Cucumis melo [Oriental melon]
gb|KCW56781.1|  hypothetical protein EUGRSUZ_I024522                    501   2e-172   Eucalyptus grandis [rose gum]
ref|XP_004166314.1|  PREDICTED: succinate dehydrogenase [ubiquino...    493   2e-172   
gb|KJB48417.1|  hypothetical protein B456_008G068200                    502   2e-172   Gossypium raimondii
ref|XP_002530482.1|  succinate dehydrogenase, putative                  502   2e-172   
gb|KJB48416.1|  hypothetical protein B456_008G068200                    502   3e-172   Gossypium raimondii
gb|KDP30152.1|  hypothetical protein JCGZ_18113                         502   5e-172   Jatropha curcas
ref|XP_010029813.1|  PREDICTED: succinate dehydrogenase [ubiquino...    501   6e-172   Eucalyptus grandis [rose gum]
ref|XP_009794665.1|  PREDICTED: succinate dehydrogenase [ubiquino...    501   9e-172   Nicotiana sylvestris
ref|XP_003611986.1|  Succinate dehydrogenase                            501   9e-172   Medicago truncatula
ref|XP_009794664.1|  PREDICTED: succinate dehydrogenase [ubiquino...    501   1e-171   Nicotiana sylvestris
gb|KDO79531.1|  hypothetical protein CISIN_1g046556mg                   499   6e-171   Citrus sinensis [apfelsine]
gb|KJB17788.1|  hypothetical protein B456_003G015500                    499   6e-171   Gossypium raimondii
ref|XP_006425687.1|  hypothetical protein CICLE_v10025149mg             499   6e-171   Citrus clementina [clementine]
ref|XP_011025771.1|  PREDICTED: succinate dehydrogenase [ubiquino...    498   8e-171   Populus euphratica
ref|XP_011099603.1|  PREDICTED: succinate dehydrogenase [ubiquino...    498   8e-171   Sesamum indicum [beniseed]
ref|XP_010942023.1|  PREDICTED: succinate dehydrogenase [ubiquino...    498   1e-170   Elaeis guineensis
ref|XP_007046957.1|  Succinate dehydrogenase 1-1 isoform 1              498   1e-170   Theobroma cacao [chocolate]
ref|XP_010254866.1|  PREDICTED: succinate dehydrogenase [ubiquino...    497   2e-170   Nelumbo nucifera [Indian lotus]
ref|XP_010679713.1|  PREDICTED: succinate dehydrogenase [ubiquino...    497   3e-170   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011003741.1|  PREDICTED: succinate dehydrogenase [ubiquino...    497   3e-170   Populus euphratica
ref|XP_009624858.1|  PREDICTED: succinate dehydrogenase [ubiquino...    496   4e-170   Nicotiana tomentosiformis
gb|EPS73346.1|  hypothetical protein M569_01410                         484   5e-170   Genlisea aurea
ref|XP_010547500.1|  PREDICTED: succinate dehydrogenase [ubiquino...    494   2e-169   Tarenaya hassleriana [spider flower]
gb|KGN53253.1|  hypothetical protein Csa_4G038700                       494   3e-169   Cucumis sativus [cucumbers]
ref|XP_009350004.1|  PREDICTED: succinate dehydrogenase [ubiquino...    494   3e-169   Pyrus x bretschneideri [bai li]
ref|XP_007156038.1|  hypothetical protein PHAVU_003G253200g             494   4e-169   Phaseolus vulgaris [French bean]
ref|XP_010263681.1|  PREDICTED: succinate dehydrogenase [ubiquino...    491   4e-169   
ref|XP_004149154.1|  PREDICTED: succinate dehydrogenase [ubiquino...    494   7e-169   
ref|XP_004512040.1|  PREDICTED: succinate dehydrogenase [ubiquino...    493   8e-169   Cicer arietinum [garbanzo]
ref|XP_010485332.1|  PREDICTED: succinate dehydrogenase [ubiquino...    489   2e-168   
ref|XP_007156937.1|  hypothetical protein PHAVU_002G029800g             492   2e-168   Phaseolus vulgaris [French bean]
ref|XP_006340609.1|  PREDICTED: succinate dehydrogenase [ubiquino...    492   3e-168   Solanum tuberosum [potatoes]
ref|XP_002269407.1|  PREDICTED: succinate dehydrogenase [ubiquino...    493   3e-168   Vitis vinifera
ref|XP_009408578.1|  PREDICTED: succinate dehydrogenase [ubiquino...    492   3e-168   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008338495.1|  PREDICTED: succinate dehydrogenase [ubiquino...    491   4e-168   Malus domestica [apple tree]
gb|ACG43057.1|  succinate dehydrogenase flavoprotein subunit,mito...    491   6e-168   Zea mays [maize]
ref|XP_002310225.1|  Succinate dehydrogenase flavoprotein subunit       491   7e-168   
ref|XP_009371587.1|  PREDICTED: succinate dehydrogenase [ubiquino...    491   9e-168   Pyrus x bretschneideri [bai li]
ref|NP_001146722.1|  uncharacterized protein LOC100280324               490   1e-167   Zea mays [maize]
ref|XP_010263680.1|  PREDICTED: succinate dehydrogenase [ubiquino...    491   1e-167   Nelumbo nucifera [Indian lotus]
ref|XP_010444736.1|  PREDICTED: succinate dehydrogenase [ubiquino...    487   1e-167   Camelina sativa [gold-of-pleasure]
ref|XP_008338100.1|  PREDICTED: succinate dehydrogenase [ubiquino...    490   2e-167   Malus domestica [apple tree]
ref|XP_004509252.1|  PREDICTED: succinate dehydrogenase [ubiquino...    490   2e-167   Cicer arietinum [garbanzo]
ref|NP_001146352.1|  uncharacterized protein LOC100279930               489   3e-167   Zea mays [maize]
ref|XP_010550391.1|  PREDICTED: succinate dehydrogenase [ubiquino...    489   3e-167   Tarenaya hassleriana [spider flower]
ref|XP_006383209.1|  hypothetical protein POPTR_0005s12530g             489   5e-167   
ref|XP_008787307.1|  PREDICTED: succinate dehydrogenase [ubiquino...    489   5e-167   Phoenix dactylifera
ref|XP_004287904.1|  PREDICTED: succinate dehydrogenase [ubiquino...    488   7e-167   Fragaria vesca subsp. vesca
ref|XP_009406751.1|  PREDICTED: succinate dehydrogenase [ubiquino...    488   1e-166   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942844.1|  PREDICTED: succinate dehydrogenase [ubiquino...    487   1e-166   Elaeis guineensis
ref|XP_010444735.1|  PREDICTED: succinate dehydrogenase [ubiquino...    488   1e-166   Camelina sativa [gold-of-pleasure]
tpg|DAA42707.1|  TPA: hypothetical protein ZEAMMB73_508415              490   1e-166   
ref|XP_008241667.1|  PREDICTED: succinate dehydrogenase [ubiquino...    488   1e-166   Prunus mume [ume]
gb|KFK28359.1|  succinate dehydrogenase                                 488   1e-166   Arabis alpina [alpine rockcress]
ref|NP_201477.1|  succinate dehydrogenase [ubiquinone] flavoprote...    487   2e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464904.1|  PREDICTED: succinate dehydrogenase [ubiquino...    487   3e-166   Camelina sativa [gold-of-pleasure]
ref|XP_006280112.1|  hypothetical protein CARUB_v10026004mg             489   3e-166   
ref|NP_001058845.1|  Os07g0134800                                       486   3e-166   
ref|XP_010942839.1|  PREDICTED: succinate dehydrogenase [ubiquino...    487   3e-166   Elaeis guineensis
gb|ADZ75464.1|  succinate dehydrogenase                                 486   4e-166   Litchi chinensis [litchi]
ref|XP_003558573.1|  PREDICTED: succinate dehydrogenase [ubiquino...    486   5e-166   Brachypodium distachyon [annual false brome]
ref|XP_004972473.1|  PREDICTED: succinate dehydrogenase [ubiquino...    486   6e-166   Setaria italica
gb|EEE66523.1|  hypothetical protein OsJ_23002                          487   7e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202009.1|  hypothetical protein PRUPE_ppa002787mg             486   7e-166   
ref|XP_006658260.1|  PREDICTED: succinate dehydrogenase [ubiquino...    486   7e-166   Oryza brachyantha
ref|XP_003537582.1|  PREDICTED: succinate dehydrogenase [ubiquino...    486   7e-166   Glycine max [soybeans]
ref|XP_004232400.1|  PREDICTED: succinate dehydrogenase [ubiquino...    485   1e-165   Solanum lycopersicum
gb|KHG24770.1|  SDH1-1: Succinate dehydrogenase [ubiquinone] flav...    485   1e-165   Gossypium arboreum [tree cotton]
ref|XP_002866741.1|  succinate dehydrogenase 1-1                        485   1e-165   
ref|XP_003517234.1|  PREDICTED: succinate dehydrogenase [ubiquino...    484   3e-165   Glycine max [soybeans]
ref|XP_002463806.1|  hypothetical protein SORBIDRAFT_01g006490          484   3e-165   Sorghum bicolor [broomcorn]
dbj|BAK08049.1|  predicted protein                                      483   5e-165   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008783478.1|  PREDICTED: succinate dehydrogenase [ubiquino...    483   7e-165   Phoenix dactylifera
ref|XP_003557614.1|  PREDICTED: succinate dehydrogenase [ubiquino...    483   1e-164   Brachypodium distachyon [annual false brome]
ref|XP_004981575.1|  PREDICTED: succinate dehydrogenase [ubiquino...    481   2e-164   
ref|XP_004981574.1|  PREDICTED: succinate dehydrogenase [ubiquino...    482   2e-164   Setaria italica
ref|XP_006393871.1|  hypothetical protein EUTSA_v10003821mg             480   1e-163   Eutrema salsugineum [saltwater cress]
gb|EMS68611.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    479   1e-163   Triticum urartu
gb|KHF98130.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    478   5e-163   Gossypium arboreum [tree cotton]
gb|KHN41982.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    477   1e-162   Glycine soja [wild soybean]
ref|XP_008344291.1|  PREDICTED: succinate dehydrogenase [ubiquino...    476   4e-162   
emb|CDY57124.1|  BnaA09g52600D                                          476   5e-162   Brassica napus [oilseed rape]
emb|CDX81369.1|  BnaC09g07800D                                          475   8e-162   
emb|CDY30754.1|  BnaC07g16540D                                          475   9e-162   Brassica napus [oilseed rape]
ref|XP_009103488.1|  PREDICTED: succinate dehydrogenase [ubiquino...    475   1e-161   
ref|XP_009103489.1|  PREDICTED: succinate dehydrogenase [ubiquino...    475   1e-161   Brassica rapa
emb|CDY49839.1|  BnaC02g43980D                                          474   2e-161   Brassica napus [oilseed rape]
dbj|BAK02783.1|  predicted protein                                      474   2e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK40220.1|  hypothetical protein AALP_AA3G346200                    474   4e-161   Arabis alpina [alpine rockcress]
ref|XP_010467662.1|  PREDICTED: succinate dehydrogenase [ubiquino...    473   1e-160   Camelina sativa [gold-of-pleasure]
gb|KHN36125.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    471   2e-160   Glycine soja [wild soybean]
ref|XP_010489548.1|  PREDICTED: succinate dehydrogenase [ubiquino...    471   3e-160   Camelina sativa [gold-of-pleasure]
emb|CAN74538.1|  hypothetical protein VITISV_023718                     469   6e-160   Vitis vinifera
ref|XP_009112332.1|  PREDICTED: succinate dehydrogenase [ubiquino...    471   6e-160   Brassica rapa
ref|XP_009112333.1|  PREDICTED: succinate dehydrogenase [ubiquino...    470   6e-160   Brassica rapa
ref|NP_179435.1|  succinate dehydrogenase [ubiquinone] flavoprote...    469   2e-159   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29234.1|  BnaA06g25230D                                          469   4e-159   Brassica napus [oilseed rape]
ref|XP_009150830.1|  PREDICTED: succinate dehydrogenase [ubiquino...    468   4e-159   Brassica rapa
ref|XP_006856022.1|  hypothetical protein AMTR_s00059p00054360          468   4e-159   
ref|XP_010414323.1|  PREDICTED: succinate dehydrogenase [ubiquino...    468   5e-159   Camelina sativa [gold-of-pleasure]
ref|XP_002886171.1|  succinate dehydrogenase 1-2                        467   1e-158   
ref|XP_006409150.1|  hypothetical protein EUTSA_v10022591mg             467   1e-158   
emb|CDY36482.1|  BnaC03g48410D                                          465   9e-158   Brassica napus [oilseed rape]
ref|XP_010113491.1|  Succinate dehydrogenase [ubiquinone] flavopr...    463   3e-157   
gb|AIZ74343.1|  succinate dehydrogenase                                 458   5e-155   Pinus massoniana [Chinese red pine]
gb|KHG24771.1|  SDH1-1: Succinate dehydrogenase [ubiquinone] flav...    454   1e-153   Gossypium arboreum [tree cotton]
gb|EMT18500.1|  Succinate dehydrogenase (ubiquinone) flavoprotein...    451   1e-152   
ref|XP_001780340.1|  predicted protein                                  450   6e-152   
ref|XP_001762172.1|  predicted protein                                  445   3e-150   
ref|XP_002970038.1|  hypothetical protein SELMODRAFT_440964             441   3e-148   Selaginella moellendorffii
ref|XP_002985229.1|  hypothetical protein SELMODRAFT_446158             440   5e-148   Selaginella moellendorffii
gb|KEH27558.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    433   1e-145   Medicago truncatula
tpg|DAA59498.1|  TPA: hypothetical protein ZEAMMB73_792658              421   3e-141   
gb|EMT27843.1|  Succinate dehydrogenase (ubiquinone) flavoprotein...    414   3e-136   
gb|EMS46614.1|  Succinate dehydrogenase [ubiquinone] flavoprotein...    400   5e-133   Triticum urartu
ref|XP_004509253.1|  PREDICTED: succinate dehydrogenase [ubiquino...    391   2e-129   
ref|XP_005846959.1|  hypothetical protein CHLNCDRAFT_56196              380   2e-125   Chlorella variabilis
ref|XP_001689842.1|  succinate dehydrogenase subunit A                  379   6e-124   Chlamydomonas reinhardtii
ref|XP_011396968.1|  Succinate dehydrogenase [ubiquinone] flavopr...    370   7e-121   Auxenochlorella protothecoides
ref|XP_002949632.1|  succinate dehydrogenase subunit A, mitochond...    359   2e-116   Volvox carteri f. nagariensis
ref|WP_043100651.1|  fumarate reductase                                 357   7e-116   Oleiagrimonas soli
ref|XP_005707862.1|  succinate dehydrogenase (ubiquinone) flavopr...    357   8e-116   Galdieria sulphuraria
ref|XP_005707863.1|  succinate dehydrogenase (ubiquinone) flavopr...    358   1e-115   Galdieria sulphuraria
ref|XP_005644633.1|  succinate dehydrogenase                            354   9e-115   Coccomyxa subellipsoidea C-169
ref|XP_003082803.1|  succinate dehydrogenase flavoprotein alpha s...    354   4e-114   Ostreococcus tauri
ref|WP_028770211.1|  fumarate reductase                                 350   3e-113   Silanimonas lenta
ref|XP_001422453.1|  predicted protein                                  349   1e-112   Ostreococcus lucimarinus CCE9901
ref|XP_005711554.1|  succinate dehydrogenase (Complex II) flavopr...    349   1e-112   Chondrus crispus [carageen]
ref|WP_027071780.1|  fumarate reductase                                 348   2e-112   Luteimonas sp. J29
ref|WP_007508942.1|  MULTISPECIES: succinate dehydrogenase              346   1e-111   Rhodanobacter
ref|WP_006889695.1|  succinate dehydrogenase                            345   1e-111   Methylobacter tundripaludum
ref|WP_004153153.1|  succinate dehydrogenase flavoprotein subunit       345   1e-111   Stenotrophomonas maltophilia
ref|WP_008268193.1|  succinate dehydrogenase                            345   2e-111   Stenotrophomonas sp. SKA14
ref|WP_012510712.1|  succinate dehydrogenase                            345   2e-111   Stenotrophomonas maltophilia
ref|WP_015448068.1|  succinate dehydrogenase                            345   2e-111   Rhodanobacter denitrificans
ref|XP_005539527.1|  succinate dehydrogenase flavoprotein subunit...    348   2e-111   Cyanidioschyzon merolae strain 10D
emb|CCP11050.1|  succinate dehydrogenase flavoprotein subunit           345   2e-111   Stenotrophomonas maltophilia SKK35
dbj|GAN44243.1|  fumarate reductase                                     345   3e-111   
ref|WP_027491859.1|  fumarate reductase                                 345   3e-111   Rhodanobacter sp. OR444
ref|WP_024890019.1|  fumarate reductase                                 344   4e-111   Luteimonas huabeiensis
ref|WP_032128866.1|  fumarate reductase                                 344   5e-111   Stenotrophomonas
ref|WP_008434627.1|  succinate dehydrogenase                            344   6e-111   Rhodanobacter thiooxydans
ref|WP_031432226.1|  fumarate reductase                                 343   1e-110   Methylomarinum vadi
ref|WP_034220123.1|  fumarate reductase                                 343   1e-110   Arenimonas donghaensis
ref|WP_042614012.1|  fumarate reductase                                 343   2e-110   Stenotrophomonas
ref|WP_024958618.1|  fumarate reductase                                 343   2e-110   Stenotrophomonas
ref|WP_024868052.1|  fumarate reductase                                 342   2e-110   Pseudoxanthomonas suwonensis
ref|WP_028919050.1|  fumarate reductase                                 342   2e-110   Pseudoxanthomonas suwonensis
ref|WP_018718364.1|  succinate dehydrogenase                            342   4e-110   Arhodomonas aquaeolei
gb|ESA13975.1|  hypothetical protein GLOINDRAFT_346712                  339   7e-110   
ref|WP_017461216.1|  succinate dehydrogenase                            341   7e-110   Dyella ginsengisoli
ref|WP_018183055.1|  succinate dehydrogenase                            340   1e-109   Kaistia granuli
ref|WP_010484342.1|  succinate dehydrogenase                            340   1e-109   Stenotrophomonas maltophilia
gb|KDO21309.1|  succinate dehydrogenase flavoprotein subunit            341   2e-109   Saprolegnia parasitica CBS 223.65
ref|WP_019338331.1|  succinate dehydrogenase                            340   2e-109   Stenotrophomonas maltophilia
ref|WP_019466021.1|  succinate dehydrogenase                            340   3e-109   Dyella japonica
ref|WP_033830834.1|  fumarate reductase                                 340   3e-109   Stenotrophomonas
gb|EXX63396.1|  succinate dehydrogenase flavoprotein subunit SDH1       340   4e-109   Rhizophagus irregularis DAOM 197198w
ref|WP_014646765.1|  succinate dehydrogenase                            339   4e-109   Stenotrophomonas maltophilia
ref|WP_029074935.1|  fumarate reductase                                 339   4e-109   Kaistia adipata
ref|WP_039454199.1|  fumarate reductase                                 335   4e-109   
ref|XP_008617967.1|  succinate dehydrogenase [ubiquinone] flavopr...    340   6e-109   Saprolegnia diclina VS20
ref|WP_028917287.1|  fumarate reductase                                 338   7e-109   Pseudoxanthomonas sp. J35
ref|XP_005841533.1|  hypothetical protein GUITHDRAFT_159138             338   8e-109   Guillardia theta CCMP2712
ref|WP_005409078.1|  succinate dehydrogenase                            338   9e-109   Stenotrophomonas
ref|WP_017840176.1|  succinate dehydrogenase                            338   1e-108   Methylomicrobium buryatense
ref|XP_003063914.1|  predicted protein                                  339   1e-108   Micromonas pusilla CCMP1545
ref|WP_033833072.1|  fumarate reductase                                 338   1e-108   Stenotrophomonas maltophilia
ref|WP_024297036.1|  fumarate reductase                                 338   1e-108   Methylosarcina lacus
ref|WP_022969875.1|  succinate dehydrogenase                            338   1e-108   Arenimonas oryziterrae
ref|WP_014036803.1|  succinate dehydrogenase                            338   1e-108   Stenotrophomonas
ref|WP_005416133.1|  succinate dehydrogenase flavoprotein subunit       338   1e-108   Stenotrophomonas maltophilia
ref|WP_008213919.1|  succinate dehydrogenase                            338   1e-108   Rhodanobacter
ref|WP_025878814.1|  MULTISPECIES: fumarate reductase                   338   2e-108   Xanthomonadaceae
ref|WP_019397705.1|  MULTISPECIES: succinate dehydrogenase              337   2e-108   Pseudoxanthomonas
ref|WP_014149121.1|  succinate dehydrogenase                            337   2e-108   Methylomicrobium alcaliphilum
ref|WP_005371927.1|  MULTISPECIES: succinate dehydrogenase              337   3e-108   Methylomicrobium agile
ref|WP_018044518.1|  succinate dehydrogenase                            337   3e-108   Methylobacterium sp. 88A
ref|WP_038616778.1|  fumarate reductase                                 337   3e-108   
ref|WP_019183254.1|  succinate dehydrogenase                            337   3e-108   Stenotrophomonas
ref|WP_028838112.1|  fumarate reductase                                 337   3e-108   Thermomonas fusca
ref|WP_011629078.1|  succinate dehydrogenase                            337   4e-108   Alkalilimnicola ehrlichii
ref|WP_043800939.1|  fumarate reductase                                 337   4e-108   Arenimonas malthae
ref|WP_019994878.1|  succinate dehydrogenase                            337   4e-108   Aureimonas ureilytica
ref|WP_027172788.1|  fumarate reductase                                 337   5e-108   Methylobacterium sp. 10
ref|WP_007082035.1|  succinate dehydrogenase                            336   5e-108   Rhodanobacter fulvus
ref|WP_027150677.1|  fumarate reductase                                 336   6e-108   Methylobacter tundripaludum
ref|XP_008870100.1|  succinate dehydrogenase [ubiquinone] flavopr...    337   6e-108   Aphanomyces invadans
ref|WP_017355966.1|  succinate dehydrogenase                            336   6e-108   Stenotrophomonas maltophilia
ref|WP_027839624.1|  fumarate reductase                                 336   7e-108   
ref|WP_027079842.1|  fumarate reductase                                 336   9e-108   Luteimonas mephitis
ref|WP_031435994.1|  fumarate reductase                                 335   1e-107   Methylobacter tundripaludum
ref|WP_023493887.1|  succinate dehydrogenase flavoprotein subunit       335   1e-107   Methyloglobulus morosus
ref|WP_024712195.1|  fumarate reductase                                 335   1e-107   Xanthomonas oryzae
ref|WP_019300225.1|  succinate dehydrogenase                            335   1e-107   Xanthomonas oryzae
ref|WP_019904706.1|  succinate dehydrogenase                            335   1e-107   Methylobacterium sp. 77
ref|WP_013534975.1|  succinate dehydrogenase                            335   2e-107   Pseudoxanthomonas suwonensis
ref|WP_037021074.1|  fumarate reductase                                 335   2e-107   
ref|WP_018974716.1|  succinate dehydrogenase                            335   2e-107   Rudaea cellulosilytica
ref|WP_026634481.1|  fumarate reductase                                 335   2e-107   Dyella
ref|WP_014503502.1|  succinate dehydrogenase                            335   2e-107   Xanthomonas oryzae
ref|WP_029219954.1|  fumarate reductase                                 335   2e-107   Xanthomonas cassavae
ref|WP_008945582.1|  succinate dehydrogenase                            335   2e-107   Oceanibaculum indicum
ref|WP_009493498.1|  succinate dehydrogenase                            335   3e-107   Microvirga lotononidis
ref|WP_010373310.1|  succinate dehydrogenase                            334   3e-107   Xanthomonas
ref|WP_039434923.1|  fumarate reductase                                 334   3e-107   Xanthomonas vasicola
ref|WP_021133416.1|  succinate dehydrogenase flavoprotein subunit       334   3e-107   Phaeospirillum fulvum
ref|WP_026986788.1|  fumarate reductase                                 334   4e-107   Fodinicurvata fenggangensis
ref|WP_029030003.1|  fumarate reductase                                 335   4e-107   Salinarimonas rosea
ref|WP_027316818.1|  fumarate reductase                                 334   4e-107   Microvirga flocculans
ref|WP_007808048.1|  succinate dehydrogenase                            334   4e-107   Rhodanobacter spathiphylli
ref|WP_010378805.1|  succinate dehydrogenase                            333   6e-107   Xanthomonas
gb|KFA17636.1|  fumarate reductase                                      333   6e-107   Xanthomonas campestris pv. musacearum NCPPB 4384
ref|WP_040485178.1|  fumarate reductase                                 334   7e-107   Lutibaculum baratangense
ref|WP_013743551.1|  succinate dehydrogenase                            333   7e-107   Pusillimonas sp. T7-7
ref|WP_014160740.1|  succinate dehydrogenase                            333   7e-107   Pseudoxanthomonas spadix
ref|XP_002505866.1|  succinate dehydrogenase                            334   8e-107   Micromonas commoda
gb|ESR26478.1|  Succinate dehydrogenase flavoprotein subunit            333   8e-107   Lutibaculum baratangense AMV1
ref|WP_006449603.1|  succinate dehydrogenase                            333   1e-106   Xanthomonas
emb|CBK21813.2|  Succinate dehydrogenase flavoprotein subunit (SDHA)    334   1e-106   Blastocystis hominis
ref|WP_036113622.1|  MULTISPECIES: fumarate reductase                   333   1e-106   Luteibacter
emb|CBK22804.2|  Succinate dehydrogenase flavoprotein subunit (SDHA)    334   1e-106   Blastocystis hominis
ref|WP_012438231.1|  succinate dehydrogenase                            332   2e-106   Xanthomonas campestris
ref|WP_038308686.1|  fumarate reductase                                 332   2e-106   
ref|WP_036140987.1|  fumarate reductase                                 332   2e-106   Luteibacter sp. 9135
emb|CCW17627.1|  Succinate dehydrogenase flavoprotein subunit           323   2e-106   Sphingobium japonicum BiD32
emb|CDS14117.1|  Putative Similar to succinate dehydrogenaseFT fl...    333   2e-106   Lichtheimia ramosa
ref|WP_037490026.1|  fumarate reductase                                 323   3e-106   
ref|WP_039409054.1|  fumarate reductase                                 332   3e-106   Xanthomonas
ref|WP_023904093.1|  succinate dehydrogenase flavoprotein subunit       332   3e-106   Xanthomonas
ref|WP_038689043.1|  fumarate reductase                                 332   3e-106   Stenotrophomonas rhizophila
ref|WP_005995652.1|  succinate dehydrogenase                            332   3e-106   Xanthomonas
emb|CDS14431.1|  Putative Genomic scaffold, msy_sf_7                    332   3e-106   Lichtheimia ramosa
ref|XP_007871954.1|  hypothetical protein PNEG_00097                    333   3e-106   Pneumocystis murina B123
ref|WP_040405724.1|  fumarate reductase                                 332   4e-106   
ref|WP_026601242.1|  fumarate reductase                                 331   4e-106   Methylomonas sp. 11b
ref|WP_022727865.1|  succinate dehydrogenase                            331   5e-106   Fodinicurvata sediminis
ref|WP_024080439.1|  Succinate dehydrogenase flavoprotein subunit       331   6e-106   Magnetospirillum gryphiswaldense
ref|WP_019867976.1|  succinate dehydrogenase                            331   6e-106   Methylovulum miyakonense
ref|WP_011258983.1|  succinate dehydrogenase                            331   6e-106   Xanthomonas oryzae
ref|WP_036360904.1|  fumarate reductase                                 331   6e-106   
ref|WP_017167451.1|  succinate dehydrogenase                            330   8e-106   Xanthomonas phaseoli
ref|WP_022559172.1|  MULTISPECIES: Probable succinate dehydrogena...    330   9e-106   Xanthomonas
ref|WP_012444909.1|  succinate dehydrogenase                            330   9e-106   Xanthomonas oryzae
ref|WP_027287571.1|  fumarate reductase                                 330   9e-106   
ref|WP_011812862.1|  succinate dehydrogenase                            330   9e-106   Halorhodospira halophila
ref|WP_011051316.1|  MULTISPECIES: succinate dehydrogenase              330   1e-105   Xanthomonas
ref|WP_010342654.1|  succinate dehydrogenase                            330   1e-105   Xanthomonas sacchari
ref|WP_017908441.1|  MULTISPECIES: succinate dehydrogenase              330   1e-105   Xanthomonas
ref|WP_036358128.1|  fumarate reductase                                 330   1e-105   Microvirga sp. BSC39
ref|WP_039574263.1|  fumarate reductase                                 330   1e-105   Xanthomonas
ref|WP_029819500.1|  fumarate reductase                                 330   1e-105   Xanthomonas euvesicatoria
ref|WP_005916748.1|  MULTISPECIES: succinate dehydrogenase              330   1e-105   Xanthomonas
ref|WP_003482789.1|  succinate dehydrogenase                            330   1e-105   Xanthomonas
ref|WP_042822585.1|  fumarate reductase                                 330   2e-105   
ref|WP_020482371.1|  succinate dehydrogenase                            330   2e-105   Methylomonas sp. MK1
ref|WP_039514416.1|  fumarate reductase                                 330   2e-105   Xanthomonas arboricola
ref|XP_010478700.1|  PREDICTED: succinate dehydrogenase [ubiquino...    315   2e-105   
ref|WP_038272023.1|  fumarate reductase                                 330   2e-105   Xylella taiwanensis
gb|KFH69943.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    331   3e-105   Mortierella verticillata NRRL 6337
ref|WP_014403064.1|  succinate dehydrogenase                            329   3e-105   Frateuria aurantia
ref|WP_012916315.1|  succinate dehydrogenase                            329   3e-105   Xanthomonas albilineans
emb|CDH57827.1|  succinate dehydrogenase                                331   3e-105   Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_011037281.1|  succinate dehydrogenase                            329   3e-105   Xanthomonas campestris
emb|CDH53199.1|  succinate dehydrogenase                                330   4e-105   Lichtheimia corymbifera JMRC:FSU:9682
gb|EIE82583.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    330   4e-105   Rhizopus delemar RA 99-880
ref|XP_009822820.1|  succinate dehydrogenase [ubiquinone] flavopr...    330   4e-105   Aphanomyces astaci
ref|WP_020401371.1|  succinate dehydrogenase                            328   4e-105   Kordiimonas gwangyangensis
ref|WP_018388058.1|  succinate dehydrogenase                            329   5e-105   Ancylobacter sp. FA202
ref|WP_025769364.1|  fumarate reductase                                 328   5e-105   Thioalkalivibrio sp. HK1
ref|WP_026868485.1|  fumarate reductase                                 328   5e-105   Inquilinus limosus
gb|KGU48262.1|  fumarate reductase                                      328   5e-105   Xanthomonas citri pv. fuscans
ref|WP_034993239.1|  fumarate reductase                                 329   6e-105   
ref|WP_017484505.1|  succinate dehydrogenase                            329   6e-105   
ref|WP_016902591.1|  succinate dehydrogenase                            328   6e-105   
emb|CBN75209.1|  SDH1, succinate dehydrogenase subunit 1                327   7e-105   
ref|WP_007963515.1|  succinate dehydrogenase                            328   7e-105   
ref|WP_029010596.1|  fumarate reductase                                 328   7e-105   
ref|WP_017972291.1|  hypothetical protein                               317   8e-105   
ref|WP_029354673.1|  fumarate reductase                                 328   9e-105   
ref|WP_008932785.1|  succinate dehydrogenase                            328   9e-105   
ref|WP_024280384.1|  fumarate reductase                                 328   1e-104   
ref|WP_002690011.1|  succinate dehydrogenase                            328   1e-104   
ref|WP_002729466.1|  succinate dehydrogenase                            327   1e-104   
emb|CCA28117.1|  unnamed protein product                                318   2e-104   
ref|WP_012455991.1|  succinate dehydrogenase                            328   2e-104   
ref|WP_028796036.1|  fumarate reductase                                 327   2e-104   
dbj|GAK44287.1|  succinate dehydrogenase flavoprotein subunit           327   2e-104   
ref|WP_013818790.1|  succinate dehydrogenase                            327   2e-104   
ref|WP_036134648.1|  fumarate reductase                                 327   2e-104   
ref|WP_029555307.1|  fumarate reductase                                 327   2e-104   
ref|WP_033157417.1|  fumarate reductase                                 327   2e-104   
ref|WP_012385672.1|  succinate dehydrogenase                            327   2e-104   
ref|WP_007564304.1|  succinate dehydrogenase                            327   3e-104   
ref|WP_004426973.1|  succinate dehydrogenase flavoprotein subunit       327   3e-104   
ref|WP_003471717.1|  succinate dehydrogenase flavoprotein subunit       327   3e-104   
ref|WP_020174255.1|  succinate dehydrogenase                            327   3e-104   
ref|WP_039006567.1|  fumarate reductase                                 326   4e-104   
ref|XP_007879755.1|  hypothetical protein PFL1_04040                    328   4e-104   
emb|CEI93846.1|  Putative Succinate dehydrogenase flavoprotein su...    324   4e-104   
ref|WP_020561893.1|  succinate dehydrogenase                            326   4e-104   
ref|WP_027069565.1|  fumarate reductase                                 326   4e-104   
ref|XP_009038442.1|  hypothetical protein AURANDRAFT_37947              327   5e-104   
ref|WP_029941327.1|  fumarate reductase                                 326   5e-104   
gb|EDN71495.1|  Succinate dehydrogenase/fumarate reductase, flavo...    326   6e-104   
ref|WP_033836547.1|  fumarate reductase                                 326   6e-104   
ref|WP_036164702.1|  fumarate reductase                                 325   7e-104   
ref|WP_034211325.1|  fumarate reductase                                 325   8e-104   
ref|WP_012110332.1|  succinate dehydrogenase                            325   8e-104   
ref|WP_039188230.1|  fumarate reductase                                 326   9e-104   
gb|KFB08713.1|  Succinate dehydrogenase flavoprotein subunit            326   9e-104   
ref|WP_036485787.1|  fumarate reductase                                 326   1e-103   
dbj|BAP54728.1|  succinate dehydrogenase/fumarate reductase, flav...    325   1e-103   
ref|WP_003609917.1|  succinate dehydrogenase                            325   1e-103   
ref|WP_010682080.1|  succinate dehydrogenase flavoprotein subunit       325   1e-103   
ref|WP_025282013.1|  MULTISPECIES: fumarate reductase                   325   2e-103   
ref|WP_002802218.1|  succinate dehydrogenase flavoprotein subunit       324   2e-103   
gb|EWM29068.1|  succinate dehydrogenase flavoprotein subunit            323   3e-103   
ref|WP_012113988.1|  succinate dehydrogenase                            325   3e-103   
emb|CEI95666.1|  Putative Succinate flavoprotein subunit                322   3e-103   
ref|WP_008315868.1|  Succinate dehydrogenase flavoprotein subunit       324   3e-103   
ref|WP_007677214.1|  succinate dehydrogenase                            324   3e-103   
ref|WP_011386306.1|  succinate dehydrogenase                            324   3e-103   
ref|WP_015933545.1|  succinate dehydrogenase                            324   4e-103   
ref|WP_043383658.1|  fumarate reductase                                 324   5e-103   
emb|CDI52111.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    325   5e-103   
gb|ETM03646.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    325   6e-103   
ref|XP_008889762.1|  succinate dehydrogenase [ubiquinone] flavopr...    325   6e-103   
gb|EPZ33613.1|  putative succinate dehydrogenase [ubiquinone] fla...    323   6e-103   
ref|WP_015005874.1|  MULTISPECIES: succinate dehydrogenase              323   6e-103   
ref|WP_017970952.1|  succinate dehydrogenase                            323   7e-103   
ref|WP_036193212.1|  fumarate reductase                                 323   7e-103   
ref|WP_015951894.1|  succinate dehydrogenase                            323   8e-103   
ref|WP_034834806.1|  fumarate reductase                                 323   9e-103   
dbj|GAN03015.1|  succinate dehydrogenase                                324   9e-103   
ref|WP_029360109.1|  fumarate reductase                                 323   9e-103   
ref|XP_002186498.1|  succinate dehydrogenase flavoprotein               324   9e-103   
gb|EWM29067.1|  succinate dehydrogenase flavoprotein subunit            324   9e-103   
ref|WP_024831122.1|  fumarate reductase                                 323   1e-102   
gb|EIE88610.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    324   1e-102   
ref|WP_012317466.1|  succinate dehydrogenase                            323   1e-102   
ref|WP_027082086.1|  fumarate reductase                                 322   1e-102   
dbj|GAC97081.1|  hypothetical protein PHSY_004665                       324   1e-102   
ref|WP_020091770.1|  MULTISPECIES: succinate dehydrogenase              323   1e-102   
ref|WP_018700068.1|  succinate dehydrogenase                            323   1e-102   
ref|WP_012254825.1|  succinate dehydrogenase                            322   2e-102   
ref|WP_012335695.1|  MULTISPECIES: succinate dehydrogenase              322   2e-102   
ref|WP_008619925.1|  succinate dehydrogenase flavoprotein subunit       322   2e-102   
emb|CBQ70579.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    323   2e-102   
ref|XP_002293997.1|  succinate dehydrogenase flavoprotein subunit       323   2e-102   
ref|WP_031371458.1|  fumarate reductase                                 322   2e-102   
gb|EPB90074.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    323   3e-102   
ref|WP_043352130.1|  fumarate reductase                                 322   3e-102   
ref|WP_020851880.1|  Succinate dehydrogenase or fumarate reductas...    322   3e-102   
ref|XP_002997801.1|  succinate dehydrogenase flavoprotein subunit...    322   3e-102   
ref|WP_038035730.1|  fumarate reductase                                 322   3e-102   
ref|WP_008285161.1|  succinate dehydrogenase                            321   3e-102   
gb|AAF21611.1|AF018287_5  SdhA                                          321   3e-102   
ref|WP_010893591.1|  succinate dehydrogenase                            321   3e-102   
ref|WP_012778163.1|  succinate dehydrogenase                            321   3e-102   
ref|WP_022688265.1|  succinate dehydrogenase                            315   4e-102   
ref|WP_043755565.1|  fumarate reductase                                 322   4e-102   
ref|WP_015823846.1|  succinate dehydrogenase                            322   4e-102   
ref|WP_043242101.1|  fumarate reductase                                 322   4e-102   
ref|WP_019960266.1|  succinate dehydrogenase                            321   4e-102   
ref|WP_004446645.1|  succinate dehydrogenase                            321   5e-102   
ref|WP_004089284.1|  succinate dehydrogenase                            321   5e-102   
dbj|BAQ47765.1|  fumarate reductase                                     321   5e-102   
ref|WP_015457609.1|  succinate dehydrogenase flavoprotein subunit       321   5e-102   
emb|CEG67800.1|  Putative Succinate dehydrogenase flavoprotein su...    319   5e-102   
gb|KIA58440.1|  fumarate reductase                                      321   5e-102   
ref|WP_038230147.1|  fumarate reductase                                 321   5e-102   
dbj|GAC72599.1|  succinate dehydrogenase, flavoprotein subunit          322   5e-102   
ref|WP_040123071.1|  fumarate reductase                                 321   5e-102   
ref|WP_015446511.1|  MULTISPECIES: succinate dehydrogenase              321   6e-102   
ref|WP_007508843.1|  succinate dehydrogenase                            321   6e-102   
ref|WP_017943581.1|  succinate dehydrogenase                            320   6e-102   
ref|WP_004617937.1|  succinate dehydrogenase subunit A                  320   6e-102   
ref|WP_008519354.1|  succinate dehydrogenase                            321   6e-102   
ref|WP_043950129.1|  fumarate reductase                                 321   7e-102   
ref|XP_011387114.1|  putative succinate dehydrogenase flavoprotei...    322   7e-102   
ref|WP_004272160.1|  succinate dehydrogenase                            320   7e-102   
ref|WP_013477744.1|  succinate dehydrogenase                            320   8e-102   
emb|CCA67790.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    311   9e-102   
gb|ETP55265.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    322   9e-102   
ref|WP_019013640.1|  succinate dehydrogenase                            320   9e-102   
ref|WP_029641425.1|  fumarate reductase                                 320   9e-102   
ref|WP_029016453.1|  MULTISPECIES: fumarate reductase                   320   1e-101   
ref|WP_009868841.1|  COG1053: Succinate dehydrogenase/fumarate re...    320   1e-101   
ref|WP_013077357.1|  succinate dehydrogenase                            320   1e-101   
emb|CEP10579.1|  hypothetical protein                                   321   1e-101   
ref|WP_013168093.1|  succinate dehydrogenase                            320   1e-101   
ref|XP_003329108.2|  succinate dehydrogenase [ubiquinone] flavopr...    321   1e-101   
ref|WP_038362751.1|  fumarate reductase                                 320   2e-101   
ref|WP_010667269.1|  succinate dehydrogenase flavoprotein subunit       315   2e-101   
emb|CCI44157.1|  unnamed protein product                                321   2e-101   
ref|WP_012013391.1|  succinate dehydrogenase                            319   2e-101   
ref|WP_039710429.1|  fumarate reductase                                 319   2e-101   
ref|WP_039576769.1|  fumarate reductase                                 319   3e-101   
ref|WP_043957243.1|  fumarate reductase                                 319   3e-101   
emb|CEG67799.1|  Putative Succinate dehydrogenase flavoprotein su...    320   3e-101   
ref|WP_017970217.1|  succinate dehydrogenase                            318   3e-101   
ref|WP_012151618.1|  succinate dehydrogenase                            319   3e-101   
ref|WP_011477823.1|  succinate dehydrogenase                            318   4e-101   
ref|WP_036206266.1|  fumarate reductase                                 318   4e-101   
ref|WP_035602727.1|  fumarate reductase                                 318   4e-101   
ref|WP_025828321.1|  fumarate reductase                                 319   4e-101   
ref|XP_007513731.1|  succinate dehydrogenase flavoprotein subunit       323   5e-101   
ref|WP_037553784.1|  fumarate reductase                                 318   6e-101   
ref|WP_012592521.1|  succinate dehydrogenase                            318   7e-101   
ref|WP_025294347.1|  fumarate reductase                                 318   7e-101   
ref|WP_010423907.1|  succinate dehydrogenase                            318   8e-101   
ref|WP_012172268.1|  succinate dehydrogenase                            318   9e-101   
ref|WP_023907917.1|  succinate dehydrogenase                            317   1e-100   
ref|WP_029923315.1|  fumarate reductase                                 317   1e-100   
ref|XP_003195850.1|  succinate dehydrogenase flavoprotein subunit...    318   1e-100   
ref|WP_026609797.1|  fumarate reductase                                 317   1e-100   
ref|WP_029167290.1|  fumarate reductase                                 317   1e-100   
ref|WP_014132334.1|  succinate dehydrogenase                            317   1e-100   
ref|WP_013417790.1|  succinate dehydrogenase                            317   1e-100   
ref|WP_029909414.1|  fumarate reductase                                 317   2e-100   
gb|ELU06144.1|  hypothetical protein CAPTEDRAFT_163030                  314   2e-100   
ref|WP_014075521.1|  succinate dehydrogenase                            317   2e-100   
ref|WP_037499414.1|  fumarate reductase                                 317   2e-100   
ref|WP_026784678.1|  fumarate reductase                                 317   2e-100   
ref|WP_026605851.1|  fumarate reductase                                 317   2e-100   
ref|WP_012561469.1|  succinate dehydrogenase                            317   3e-100   
ref|XP_007002512.1|  hypothetical protein TREMEDRAFT_38067              318   3e-100   
emb|CCJ28744.1|  unnamed protein product                                328   3e-100   
gb|KHD06474.1|  fumarate reductase                                      316   3e-100   
ref|WP_025896915.1|  fumarate reductase                                 316   3e-100   
ref|WP_018997660.1|  succinate dehydrogenase                            316   3e-100   
ref|WP_011470557.1|  succinate dehydrogenase                            317   3e-100   
ref|WP_036514740.1|  fumarate reductase                                 316   3e-100   
ref|WP_020085765.1|  succinate dehydrogenase                            317   3e-100   
ref|WP_026878076.1|  fumarate reductase                                 316   3e-100   
ref|WP_022700674.1|  succinate dehydrogenase                            316   3e-100   
ref|WP_004085196.1|  succinate dehydrogenase                            316   3e-100   
ref|WP_009338456.1|  succinate dehydrogenase                            316   3e-100   
ref|XP_007364698.1|  succinate dehydrogenase                            317   4e-100   
emb|CEG10205.1|  Succinate dehydrogenase flavoprotein subunit           316   4e-100   
ref|WP_035049134.1|  fumarate reductase                                 316   4e-100   
ref|WP_024575588.1|  MULTISPECIES: fumarate reductase                   316   4e-100   
dbj|GAL96641.1|  succinate dehydrogenase                                316   4e-100   
ref|WP_020161533.1|  MULTISPECIES: succinate dehydrogenase              316   4e-100   
ref|WP_027157586.1|  fumarate reductase                                 316   5e-100   
gb|KIR88429.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    317   6e-100   
ref|WP_027300425.1|  fumarate reductase                                 315   6e-100   
emb|CCF54561.1|  probable SDH1-succinate dehydrogenase (ubiquinon...    317   6e-100   
ref|WP_037513816.1|  fumarate reductase                                 315   6e-100   
ref|WP_002717948.1|  succinate dehydrogenase, flavoprotein subunit      316   6e-100   
ref|WP_018266243.1|  succinate dehydrogenase                            316   6e-100   
ref|WP_042085816.1|  fumarate reductase                                 315   6e-100   
gb|EMD34419.1|  hypothetical protein CERSUDRAFT_117293                  317   6e-100   
ref|WP_006557560.1|  succinate dehydrogenase                            315   7e-100   
ref|WP_043550399.1|  fumarate reductase                                 315   7e-100   
ref|WP_043339324.1|  fumarate reductase                                 315   7e-100   
ref|WP_024880602.1|  MULTISPECIES: fumarate reductase                   316   7e-100   
ref|XP_004349768.1|  succinate dehydrogenase flavoprotein subunit       317   7e-100   
gb|KIR29305.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    316   8e-100   
gb|KGB77017.1|  succinate dehydrogenase flavoprotein subunit            316   9e-100   
ref|WP_007674696.1|  succinate dehydrogenase                            315   9e-100   
ref|WP_026816043.1|  fumarate reductase                                 315   9e-100   
ref|WP_013500257.1|  succinate dehydrogenase                            315   9e-100   
gb|KIR47531.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    316   1e-99    
ref|WP_020180855.1|  succinate dehydrogenase                            315   1e-99    
ref|XP_003036033.1|  hypothetical protein SCHCODRAFT_74617              316   1e-99    
ref|WP_023507503.1|  Succinate dehydrogenase flavoprotein subunit       315   1e-99    
ref|WP_036109590.1|  fumarate reductase                                 315   1e-99    
ref|WP_002706931.1|  succinate dehydrogenase                            315   1e-99    
ref|WP_032139332.1|  fumarate reductase                                 315   1e-99    
ref|WP_020186824.1|  succinate dehydrogenase                            315   1e-99    
ref|WP_018062149.1|  succinate dehydrogenase                            315   1e-99    
ref|WP_020559204.1|  succinate dehydrogenase                            314   2e-99    
ref|WP_037233457.1|  fumarate reductase                                 303   2e-99    
ref|WP_018308276.1|  succinate dehydrogenase                            315   2e-99    
ref|WP_011648214.1|  MULTISPECIES: succinate dehydrogenase              314   2e-99    
ref|WP_028466127.1|  fumarate reductase                                 314   2e-99    
ref|WP_026789816.1|  fumarate reductase                                 314   2e-99    
ref|WP_031448320.1|  fumarate reductase                                 314   2e-99    
ref|WP_036291653.1|  fumarate reductase                                 314   2e-99    
ref|WP_034339430.1|  fumarate reductase                                 314   3e-99    
ref|WP_008599979.1|  Succinate dehydrogenase flavoprotein subunit       314   3e-99    
gb|KDE04492.1|  succinate dehydrogenase [ubiquinone] flavoprotein...    315   3e-99    
ref|WP_035080874.1|  fumarate reductase                                 313   3e-99    
ref|WP_024265974.1|  succinate dehydrogenase flavoprotein subunit       313   3e-99    
ref|WP_010921356.1|  succinate dehydrogenase                            313   3e-99    
ref|WP_006116623.1|  succinate dehydrogenase                            314   3e-99    
ref|WP_006023451.1|  MULTISPECIES: succinate dehydrogenase flavop...    313   4e-99    
ref|WP_003629438.1|  succinate dehydrogenase                            313   4e-99    
ref|WP_003042949.1|  succinate dehydrogenase flavoprotein subunit       313   4e-99    
ref|WP_017931590.1|  succinate dehydrogenase                            313   4e-99    
ref|WP_028969758.1|  fumarate reductase                                 313   5e-99    



>ref|XP_011097110.1| PREDICTED: LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] 
flavoprotein subunit 1, mitochondrial-like [Sesamum 
indicum]
Length=627

 Score =   506 bits (1304),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPDAVVPGL AAGEAACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAVVPGLFAAGEAACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGE+T+AWLDKLRNSNGSLPTS 
Sbjct  434  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGERTVAWLDKLRNSNGSLPTSK  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLKDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  554  LLINACITMHSAEARKESRGAHAREDFTKRDDEHWMKHTLGYWENEKVRLDYRPVHMNTL  613

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  614  DDEVESFPPKARVY  627



>gb|KJB48415.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=533

 Score =   501 bits (1290),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPD+VVPGLMAAGEAACASVHGAN
Sbjct  280  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGSDPDSVVPGLMAAGEAACASVHGAN  339

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPG+KQKPLEKDAG +TI+WLDK+RNSNGSLPTSN
Sbjct  340  RLGANSLLDIVVFGRACANRVAEIQRPGQKQKPLEKDAGARTISWLDKIRNSNGSLPTSN  399

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDVK++DRSLIWNSDLIE++ELEN
Sbjct  400  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRSLIWNSDLIESIELEN  459

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  460  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  519

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  520  DDEVESFPPKARVY  533



>gb|EYU29487.1| hypothetical protein MIMGU_mgv1a0028802mg, partial [Erythranthe 
guttata]
 gb|EYU29488.1| hypothetical protein MIMGU_mgv1a0028802mg, partial [Erythranthe 
guttata]
Length=542

 Score =   501 bits (1290),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PDA++PGL AAGEAACASVHGAN
Sbjct  289  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAIIPGLFAAGEAACASVHGAN  348

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTS 
Sbjct  349  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSK  408

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGCKLID AWESF+DVKVEDRSLIWNSDLIET+ELEN
Sbjct  409  IRLNMQRIMQNNAAVFRTQETLEEGCKLIDKAWESFNDVKVEDRSLIWNSDLIETIELEN  468

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDEKWMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  469  LLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  528

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  529  DDEIETFPPKARVY  542



>emb|CDP02029.1| unnamed protein product [Coffea canephora]
Length=632

 Score =   504 bits (1298),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGNDPDAV+PGL+AAGEAACASVHGAN
Sbjct  379  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAVIPGLLAAGEAACASVHGAN  438

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEK AGEKTIAWLDKLRNSNGS+PTS 
Sbjct  439  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKTAGEKTIAWLDKLRNSNGSIPTSK  498

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AW+SFHDVK++DR+LIWNSDLIETVELEN
Sbjct  499  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWDSFHDVKLKDRNLIWNSDLIETVELEN  558

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  559  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  618

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  619  DDEIESFPPKARVY  632



>gb|KEH27557.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=533

 Score =   499 bits (1286),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPDA+VPGLMAAGEAACASVHGAN
Sbjct  280  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDALVPGLMAAGEAACASVHGAN  339

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAG+KTIAWLDKLRNSNGSLPTS 
Sbjct  340  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLPTSK  399

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQ+VMQNNAAVFRTQETLEEGC+LID  WESFHDVKVEDRSLIWNSDLIET+ELEN
Sbjct  400  IRLNMQKVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKVEDRSLIWNSDLIETIELEN  459

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINAC+TM+SAEARKESRGAHAREDFT RDDEKWMKHTLG+WENEKVRLDYRPVH+NTL
Sbjct  460  LLINACVTMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGFWENEKVRLDYRPVHLNTL  519

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  520  DDEVESFPPKARVY  533



>ref|XP_003518027.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Glycine max]
Length=634

 Score =   503 bits (1295),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEV+T+KG+DPDAVVPGLMAAGE ACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVITIKGDDPDAVVPGLMAAGETACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRV+EIQRPGEKQKPLEKDAG KTIAWLDKLRNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVSEIQRPGEKQKPLEKDAGMKTIAWLDKLRNSNGSLPTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  501  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLKDRSLIWNSDLIETIELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYW+NEKVRLDYRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWDNEKVRLDYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  621  DDEVESFPPKARVY  634



>ref|XP_008453738.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Cucumis melo]
Length=635

 Score =   503 bits (1295),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGNDPDAV+PGLMAAGEAACASVHGAN
Sbjct  382  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAVIPGLMAAGEAACASVHGAN  441

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPG KQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  442  RLGANSLLDIVVFGRACANRVAEIGRPGAKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  501

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGCKLID AWESFHDV+V+DR+LIWN+DLIET+ELEN
Sbjct  502  IRLNMQRIMQNNAAVFRTQETLEEGCKLIDKAWESFHDVQVKDRNLIWNTDLIETIELEN  561

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLG+WENEKVRLDYRPVHMNTL
Sbjct  562  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGFWENEKVRLDYRPVHMNTL  621

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  622  DDEVETFPPKARVY  635



>gb|KCW56781.1| hypothetical protein EUGRSUZ_I024522, partial [Eucalyptus grandis]
Length=592

 Score =   501 bits (1290),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  339  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  398

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEKQKPLEKDA EKTIAWLDK+RNSNGSLPTS 
Sbjct  399  RLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLEKDAAEKTIAWLDKIRNSNGSLPTSK  458

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ NAAVFRTQETLEEGCKLID AWESFHDV+V+DRSLIWNSDLIET+ELEN
Sbjct  459  IRLNMQRVMQTNAAVFRTQETLEEGCKLIDKAWESFHDVQVKDRSLIWNSDLIETLELEN  518

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLG+WENEKVRLDYRPVHMNTL
Sbjct  519  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGFWENEKVRLDYRPVHMNTL  578

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  579  DDEIESFPPKARVY  592



>ref|XP_004166314.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cucumis sativus]
Length=367

 Score =   493 bits (1269),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 233/253 (92%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGNDPDA++PGLMAAGEAACASVHGANR
Sbjct  115  VDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAIIPGLMAAGEAACASVHGANR  174

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LGANSLLDIVVFGRACANRVAEI RPG +QKPLEKDAGEKTIAWLDKLRNSNGSL TS I
Sbjct  175  LGANSLLDIVVFGRACANRVAEIGRPGAQQKPLEKDAGEKTIAWLDKLRNSNGSLATSKI  234

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RLNMQRVMQNNAAVFRTQETLEEGCKLID AWESF DV+V+DR+LIWN+DLIET+ELENL
Sbjct  235  RLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFRDVRVKDRNLIWNTDLIETIELENL  294

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            LINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLG+WENEKVRLDYRPVHMNTLD
Sbjct  295  LINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGFWENEKVRLDYRPVHMNTLD  354

Query  61   DEIETFPPKARVY  23
            DEIETFPPKARVY
Sbjct  355  DEIETFPPKARVY  367



>gb|KJB48417.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=630

 Score =   502 bits (1293),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPD+VVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGSDPDSVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPG+KQKPLEKDAG +TI+WLDK+RNSNGSLPTSN
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIQRPGQKQKPLEKDAGARTISWLDKIRNSNGSLPTSN  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDVK++DRSLIWNSDLIE++ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRSLIWNSDLIESIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  557  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  617  DDEVESFPPKARVY  630



>ref|XP_002530482.1| succinate dehydrogenase, putative [Ricinus communis]
 gb|EEF31905.1| succinate dehydrogenase, putative [Ricinus communis]
Length=622

 Score =   502 bits (1292),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 238/254 (94%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVTVKGNDPD+VVPGLMAAGEAACASVHGAN
Sbjct  369  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKGNDPDSVVPGLMAAGEAACASVHGAN  428

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGE+TIAWLDKLRNSNGSLPTS 
Sbjct  429  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGERTIAWLDKLRNSNGSLPTSK  488

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR MQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIETVELEN
Sbjct  489  IRLNMQRTMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLKDRSLIWNSDLIETVELEN  548

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDD+ WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  549  LLINACITMHSAEARKESRGAHAREDFTKRDDKDWMKHTLGYWENEKVRLDYRPVHMNTL  608

Query  64   DDEIETFPPKARVY  23
            DDE+ET PPKARVY
Sbjct  609  DDEMETIPPKARVY  622



>gb|KJB48416.1| hypothetical protein B456_008G068200 [Gossypium raimondii]
Length=628

 Score =   502 bits (1292),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPD+VVPGLMAAGEAACASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGSDPDSVVPGLMAAGEAACASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPG+KQKPLEKDAG +TI+WLDK+RNSNGSLPTSN
Sbjct  435  RLGANSLLDIVVFGRACANRVAEIQRPGQKQKPLEKDAGARTISWLDKIRNSNGSLPTSN  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDVK++DRSLIWNSDLIE++ELEN
Sbjct  495  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRSLIWNSDLIESIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  555  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  614

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  615  DDEVESFPPKARVY  628



>gb|KDP30152.1| hypothetical protein JCGZ_18113 [Jatropha curcas]
Length=639

 Score =   502 bits (1292),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN
Sbjct  386  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  445

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEKQKPLEKDAGE+TIAWLDK+RN+NGS+PTS 
Sbjct  446  RLGANSLLDIVVFGRACANRVAEINRPGEKQKPLEKDAGERTIAWLDKIRNANGSIPTSE  505

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AW+SFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  506  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWDSFHDVKLTDRSLIWNSDLIETIELEN  565

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRL+YRPVHMNTL
Sbjct  566  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLNYRPVHMNTL  625

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  626  DDEVETFPPKARVY  639



>ref|XP_010029813.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Eucalyptus grandis]
Length=627

 Score =   501 bits (1290),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEKQKPLEKDA EKTIAWLDK+RNSNGSLPTS 
Sbjct  434  RLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLEKDAAEKTIAWLDKIRNSNGSLPTSK  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ NAAVFRTQETLEEGCKLID AWESFHDV+V+DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRVMQTNAAVFRTQETLEEGCKLIDKAWESFHDVQVKDRSLIWNSDLIETLELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLG+WENEKVRLDYRPVHMNTL
Sbjct  554  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGFWENEKVRLDYRPVHMNTL  613

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  614  DDEIESFPPKARVY  627



>ref|XP_009794665.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Nicotiana sylvestris]
Length=629

 Score =   501 bits (1289),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PDAVVPGLMAAGEAACASVHGAN
Sbjct  376  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVVPGLMAAGEAACASVHGAN  435

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGE QKPLEKDAGE+TIAWLDK+RNSNGSLPTS 
Sbjct  436  RLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIAWLDKIRNSNGSLPTSK  495

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDV+++DRSLIWNSDLIET+ELEN
Sbjct  496  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRSLIWNSDLIETIELEN  555

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRL+YRPVHMNTL
Sbjct  556  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLEYRPVHMNTL  615

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  616  DDEVETFPPKARVY  629



>ref|XP_003611986.1| Succinate dehydrogenase [Medicago truncatula]
 gb|AES94944.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=626

 Score =   501 bits (1289),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPDA+VPGLMAAGEAACASVHGAN
Sbjct  373  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDALVPGLMAAGEAACASVHGAN  432

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAG+KTIAWLDKLRNSNGSLPTS 
Sbjct  433  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLPTSK  492

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQ+VMQNNAAVFRTQETLEEGC+LID  WESFHDVKVEDRSLIWNSDLIET+ELEN
Sbjct  493  IRLNMQKVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKVEDRSLIWNSDLIETIELEN  552

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINAC+TM+SAEARKESRGAHAREDFT RDDEKWMKHTLG+WENEKVRLDYRPVH+NTL
Sbjct  553  LLINACVTMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGFWENEKVRLDYRPVHLNTL  612

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  613  DDEVESFPPKARVY  626



>ref|XP_009794664.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Nicotiana sylvestris]
Length=630

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PDAVVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGE QKPLEKDAGE+TIAWLDK+RNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIAWLDKIRNSNGSLPTSK  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDV+++DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRSLIWNSDLIETIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRL+YRPVHMNTL
Sbjct  557  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLEYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  617  DDEVETFPPKARVY  630



>gb|KDO79531.1| hypothetical protein CISIN_1g046556mg [Citrus sinensis]
Length=633

 Score =   499 bits (1284),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPD VVPGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLE +AGE+T+AWLDK+RNSNGS+PTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWN+DLIET+ELEN
Sbjct  500  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  620  DDEIESFPPKARVY  633



>gb|KJB17788.1| hypothetical protein B456_003G015500 [Gossypium raimondii]
Length=630

 Score =   499 bits (1284),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT++GNDPD+VVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIRGNDPDSVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEK KPLEKDA EKT+AWLDKLRNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIHRPGEKLKPLEKDASEKTVAWLDKLRNSNGSLPTSK  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  W+SFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWDSFHDVKLKDRSLIWNSDLIETIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  557  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  617  DDEIESFPPKARVY  630



>ref|XP_006425687.1| hypothetical protein CICLE_v10025149mg [Citrus clementina]
 ref|XP_006466784.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Citrus sinensis]
 gb|ESR38927.1| hypothetical protein CICLE_v10025149mg [Citrus clementina]
Length=632

 Score =   499 bits (1284),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPD VVPGLMAAGEAACASVHGAN
Sbjct  379  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGAN  438

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLE +AGE+T+AWLDK+RNSNGS+PTS 
Sbjct  439  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSK  498

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWN+DLIET+ELEN
Sbjct  499  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELEN  558

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  559  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  618

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  619  DDEIESFPPKARVY  632



>ref|XP_011025771.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Populus euphratica]
Length=633

 Score =   498 bits (1283),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEKQKPLEKDAGE+TIA LDKLRNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEINRPGEKQKPLEKDAGERTIARLDKLRNSNGSLPTSQ  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQ+NAAVFRTQETLEEGC LID AWESFHDVKV+DRSLIWNSDLIETVELEN
Sbjct  500  IRLNMQRIMQSNAAVFRTQETLEEGCHLIDKAWESFHDVKVKDRSLIWNSDLIETVELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE EKVRLDYRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEKEKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  620  DDEVETFPPKARVY  633



>ref|XP_011099603.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Sesamum indicum]
Length=628

 Score =   498 bits (1283),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+K +DPDAV+PGL AAGEAACASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKDDDPDAVIPGLFAAGEAACASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPG+KQKPL KDAGEKTIAWLDKLRNSNGSLPTS 
Sbjct  435  RLGANSLLDIVVFGRACANRVAEIQRPGDKQKPLGKDAGEKTIAWLDKLRNSNGSLPTSK  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AW+SFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  495  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWDSFHDVKLKDRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  555  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  614

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  615  DDEVESFPPKARVY  628



>ref|XP_010942023.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Elaeis guineensis]
Length=633

 Score =   498 bits (1282),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KGNDPDAVVPGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGNDPDAVVPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKIHDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKH+LGYWENEKVRL YRPVHM+TL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHSLGYWENEKVRLAYRPVHMHTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  620  DDEIESFPPKARVY  633



>ref|XP_007046957.1| Succinate dehydrogenase 1-1 isoform 1 [Theobroma cacao]
 gb|EOX91114.1| Succinate dehydrogenase 1-1 isoform 1 [Theobroma cacao]
Length=631

 Score =   498 bits (1281),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVTV+G++PD+VVPGLMAAGEAACASVHGAN
Sbjct  378  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTVRGSNPDSVVPGLMAAGEAACASVHGAN  437

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEK KPLEKDA EKTIAWLDK+RNSNGSLPTS 
Sbjct  438  RLGANSLLDIVVFGRACANRVAEIHRPGEKLKPLEKDASEKTIAWLDKIRNSNGSLPTSK  497

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  498  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDEAWESFHDVKLKDRSLIWNSDLIETIELEN  557

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  558  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  617

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  618  DDEIESFPPKARVY  631



>ref|XP_010254866.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Nelumbo nucifera]
Length=634

 Score =   497 bits (1280),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVV +KGND DAVVPGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVRIKGNDQDAVVPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAE+ +PGEKQKPLE DAGEKTIAWLDKLRNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAELHKPGEKQKPLESDAGEKTIAWLDKLRNSNGSLPTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  501  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLKDRSLIWNSDLIETIELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE W+KHTLGYWENEKVRLDYRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTKRDDENWLKHTLGYWENEKVRLDYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  621  DDEVESFPPKARVY  634



>ref|XP_010679713.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=635

 Score =   497 bits (1280),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGNDPDA+VPGL+AAGEAACASVHGAN
Sbjct  382  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDALVPGLLAAGEAACASVHGAN  441

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+KQKPL KDAGEKTI WLDKLRNSNGSLPTS 
Sbjct  442  RLGANSLLDIVVFGRACANRVAEISKPGDKQKPLAKDAGEKTIQWLDKLRNSNGSLPTSQ  501

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQ TLEEGC+LID  WESFHDVKV+DRSLIWNSDL+ET+ELEN
Sbjct  502  IRLNMQRVMQNNAAVFRTQSTLEEGCQLIDKTWESFHDVKVQDRSLIWNSDLMETIELEN  561

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  562  LLINACITMHSAEARKESRGAHAREDFTTRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  621

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  622  DDEIETFPPKARVY  635



>ref|XP_011003741.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Populus euphratica]
Length=636

 Score =   497 bits (1279),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  383  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTLKGDDPDAVVPGLMAAGEAACASVHGAN  442

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI+RPGE+QKPLEKDAGE+TIAWLDKLRNSNGSL TS 
Sbjct  443  RLGANSLLDIVVFGRACANRVAEIRRPGEEQKPLEKDAGERTIAWLDKLRNSNGSLSTSQ  502

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR MQNNAAVFRTQETLEEGC LID AWESFHDVKV+DRSLIWNSDLIETVELEN
Sbjct  503  IRLNMQRTMQNNAAVFRTQETLEEGCHLIDKAWESFHDVKVKDRSLIWNSDLIETVELEN  562

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINAC+TM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  563  LLINACVTMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  622

Query  64   DDEIETFPPKARVY  23
            DDEIE FPPKARVY
Sbjct  623  DDEIEPFPPKARVY  636



>ref|XP_009624858.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Nicotiana tomentosiformis]
Length=629

 Score =   496 bits (1278),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PD+VVPGLMAAGEAACASVHGAN
Sbjct  376  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDSVVPGLMAAGEAACASVHGAN  435

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGE QKPLEKDAGE+TIAWLDK+RNSNGSLPTS 
Sbjct  436  RLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIAWLDKIRNSNGSLPTSK  495

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQ+TLEEGC+LID  WESFHDV+++DRSLIWNSDLIET+ELEN
Sbjct  496  IRLNMQRVMQNNAAVFRTQDTLEEGCQLIDKTWESFHDVQLKDRSLIWNSDLIETIELEN  555

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRL+YRPVHMNTL
Sbjct  556  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLEYRPVHMNTL  615

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  616  DDEVESFPPKARVY  629



>gb|EPS73346.1| hypothetical protein M569_01410, partial [Genlisea aurea]
Length=289

 Score =   484 bits (1245),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 229/253 (91%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VDVTKEPIPVLPTV Y MGGIPTNH+GEVVT++G+DPD VVPGL AAGEAACASVHGANR
Sbjct  37   VDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIRGDDPDYVVPGLFAAGEAACASVHGANR  96

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LGANSLLDIVVFGRACANRVAEI+RPGEKQKPLE DAGEKTIAWLDKLRNSNGSLPTS I
Sbjct  97   LGANSLLDIVVFGRACANRVAEIRRPGEKQKPLESDAGEKTIAWLDKLRNSNGSLPTSKI  156

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RLNMQRVMQNNAAVFRTQETLEEGC+LID AWESF DVK++DRSLIWNSDLIETVELENL
Sbjct  157  RLNMQRVMQNNAAVFRTQETLEEGCQLIDEAWESFSDVKLKDRSLIWNSDLIETVELENL  216

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            LINAC+TM+SAEARKESRGAHAREDFT+RDD+ WMKHTLG+WENEKVRLDYRPVH+NTLD
Sbjct  217  LINACVTMHSAEARKESRGAHAREDFTQRDDKNWMKHTLGFWENEKVRLDYRPVHLNTLD  276

Query  61   DEIETFPPKARVY  23
            DEIE FPPKARVY
Sbjct  277  DEIEYFPPKARVY  289



>ref|XP_010547500.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Tarenaya hassleriana]
Length=633

 Score =   494 bits (1273),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT++GNDPDAV+PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIEGNDPDAVIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEKQKPLEKDAGEKTIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIQKPGEKQKPLEKDAGEKTIAWLDKIRNSNGSLPTSE  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID +WES+ DV+V+DRSLIWNSDLIETVELEN
Sbjct  500  IRLNMQRVMQNNAAVFRTQETLEEGCHLIDQSWESYGDVRVKDRSLIWNSDLIETVELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KVRLDYRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            D+E+ETFPPKARVY
Sbjct  620  DNEVETFPPKARVY  633



>gb|KGN53253.1| hypothetical protein Csa_4G038700 [Cucumis sativus]
Length=635

 Score =   494 bits (1273),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 233/253 (92%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGNDPDA++PGLMAAGEAACASVHGANR
Sbjct  383  VDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAIIPGLMAAGEAACASVHGANR  442

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LGANSLLDIVVFGRACANRVAEI RPG +QKPLEKDAGEKTIAWLDKLRNSNGSL TS I
Sbjct  443  LGANSLLDIVVFGRACANRVAEIGRPGAQQKPLEKDAGEKTIAWLDKLRNSNGSLATSKI  502

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RLNMQRVMQNNAAVFRTQETLEEGCKLID AWESF DV+V+DR+LIWN+DLIET+ELENL
Sbjct  503  RLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFRDVRVKDRNLIWNTDLIETIELENL  562

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            LINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLG+WENEKVRLDYRPVHMNTLD
Sbjct  563  LINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGFWENEKVRLDYRPVHMNTLD  622

Query  61   DEIETFPPKARVY  23
            DEIETFPPKARVY
Sbjct  623  DEIETFPPKARVY  635



>ref|XP_009350004.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Pyrus x bretschneideri]
Length=633

 Score =   494 bits (1272),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPD  +PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDVTIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGEKTIAWLDKIRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESFHDV+++DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGAQLIDKAWESFHDVQLKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDEKWMKHTLGYWEN KVRLDYRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENGKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  620  DDEIETFPPKARVY  633



>ref|XP_007156038.1| hypothetical protein PHAVU_003G253200g [Phaseolus vulgaris]
 gb|ESW28032.1| hypothetical protein PHAVU_003G253200g [Phaseolus vulgaris]
Length=620

 Score =   494 bits (1271),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEV+T+KG+DPDAVVPGLMAAGE ACASVHGAN
Sbjct  367  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVITIKGDDPDAVVPGLMAAGETACASVHGAN  426

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPG+KQKPLEKDAG K+IAWLDKLRNSNGSLPTS 
Sbjct  427  RLGANSLLDIVVFGRACANRVAEICRPGDKQKPLEKDAGMKSIAWLDKLRNSNGSLPTSK  486

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDVK++DR LIWNSDLIET+ELEN
Sbjct  487  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRGLIWNSDLIETLELEN  546

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDF+KRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  547  LLINACITMHSAEARKESRGAHAREDFSKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  606

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  607  DDEVESFPPKARVY  620



>ref|XP_010263681.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010263682.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010263683.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Nelumbo nucifera]
Length=533

 Score =   491 bits (1263),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVV +KGNDPDAVVPGLMAAGEAACASVHGAN
Sbjct  280  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVHIKGNDPDAVVPGLMAAGEAACASVHGAN  339

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLE DAGEKTIAWLDKLR+SNGSLPTS 
Sbjct  340  RLGANSLLDIVVFGRACANRVAEILKPGEKQKPLESDAGEKTIAWLDKLRHSNGSLPTSK  399

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  400  IRLNMQRVMQNNAAVFRTQETLEEGCRLIDKAWESFHDVKLKDRSLIWNSDLIETIELEN  459

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKRDDE W+KHTLGYW NEKVRLDYRPVHM TL
Sbjct  460  LLINASITMHSAEARKESRGAHAREDFTKRDDENWLKHTLGYWVNEKVRLDYRPVHMKTL  519

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  520  DDEVESFPPKARVY  533



>ref|XP_004149154.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cucumis sativus]
Length=635

 Score =   494 bits (1271),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 233/253 (92%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGNDPDA++PGLMAAGEAACASVHGANR
Sbjct  383  VDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAIIPGLMAAGEAACASVHGANR  442

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LGANSLLDIVVFGRACANRVAEI RPG+ QKPLEKDAGEKTIAWLDKLRNSNGSL TS I
Sbjct  443  LGANSLLDIVVFGRACANRVAEIGRPGKFQKPLEKDAGEKTIAWLDKLRNSNGSLATSKI  502

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RLNMQRVMQNNAAVFRTQETLEEGCKLID AWESF DV+V+DR+LIWN+DLIET+ELENL
Sbjct  503  RLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFRDVRVKDRNLIWNTDLIETIELENL  562

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            LINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLG+WENEKVRLDYRPVHMNTLD
Sbjct  563  LINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGFWENEKVRLDYRPVHMNTLD  622

Query  61   DEIETFPPKARVY  23
            DEIETFPPKARVY
Sbjct  623  DEIETFPPKARVY  635



>ref|XP_004512040.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Cicer arietinum]
Length=623

 Score =   493 bits (1269),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG++PDA+VPGLMAAGE ACASVHGAN
Sbjct  370  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDNPDALVPGLMAAGETACASVHGAN  429

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTS 
Sbjct  430  RLGANSLLDIVVFGRACANRVAEINRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSK  489

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESF DV+V+DR+LIWN+DLIET+ELEN
Sbjct  490  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFSDVQVKDRTLIWNTDLIETIELEN  549

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLG+WENEKVRLDYRPVH+NTL
Sbjct  550  LLINACITMHSAEARKESRGAHAREDFTKRDDESWMKHTLGFWENEKVRLDYRPVHLNTL  609

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  610  DDEVESFPPKARVY  623



>ref|XP_010485332.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Camelina sativa]
Length=525

 Score =   489 bits (1258),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  272  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  331

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLD+LRNSNGSLPTS 
Sbjct  332  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTST  391

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  392  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSLIWNSDLIETLELEN  451

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  452  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  511

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  512  DDEIDTFPPKARVY  525



>ref|XP_007156937.1| hypothetical protein PHAVU_002G029800g [Phaseolus vulgaris]
 gb|ESW28931.1| hypothetical protein PHAVU_002G029800g [Phaseolus vulgaris]
Length=631

 Score =   492 bits (1267),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNH+GEVVT+KG++PDAV+PGLMAAGE ACASVHGAN
Sbjct  378  GVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIKGDNPDAVIPGLMAAGETACASVHGAN  437

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPGEKQKPLEKDAG+KTIAWLDKLRNSNGSLPTS 
Sbjct  438  RLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLPTSK  497

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ+NAAVFRTQETLEEGC+LID  WESF DVKV+DRSLIWNSDLIET+ELEN
Sbjct  498  IRLNMQRVMQSNAAVFRTQETLEEGCQLIDKTWESFQDVKVKDRSLIWNSDLIETIELEN  557

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDF  RDDEKWMKHT+GYWENEKVRLDYRPVH+NTL
Sbjct  558  LLINACITMYSAEARKESRGAHAREDFKVRDDEKWMKHTVGYWENEKVRLDYRPVHLNTL  617

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  618  DDEVESFPPKARVY  631



>ref|XP_006340609.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like [Solanum tuberosum]
Length=630

 Score =   492 bits (1266),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HG+VVT KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVTKKGDDPDAVIPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGE+QKPLEKDAGE+TIAWLDK+RNSNGSLPTSN
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIQKPGEEQKPLEKDAGERTIAWLDKIRNSNGSLPTSN  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDV+++DR LIWN+DLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRGLIWNTDLIETIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHT+G+WE+EKVRL+YRPVHMNTL
Sbjct  557  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTIGFWEDEKVRLEYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  617  DDEVESFPPKARVY  630



>ref|XP_002269407.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Vitis vinifera]
 emb|CBI17530.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   493 bits (1270),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+KGNDPDAVVPGLMAAGEAACASVHGAN
Sbjct  417  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGNDPDAVVPGLMAAGEAACASVHGAN  476

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKD+GEKTIAWLDKLRNSNGS+PTS 
Sbjct  477  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDSGEKTIAWLDKLRNSNGSIPTSK  536

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGCKLID AWESFHDV+++DRSLIWNSDL ET+ELEN
Sbjct  537  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFHDVQLKDRSLIWNSDLSETIELEN  596

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE W++HTLGYWENEKVRLDYRPVHMN L
Sbjct  597  LLINACITMHSAEARKESRGAHAREDFTKRDDENWIRHTLGYWENEKVRLDYRPVHMNPL  656

Query  64   DDEIETFPPKARVY  23
            DDEIE+ PPKARVY
Sbjct  657  DDEIESIPPKARVY  670



>ref|XP_009408578.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Musa acuminata subsp. malaccensis]
Length=636

 Score =   492 bits (1267),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV ++G+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  383  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIEGDDPDAVVPGLMAAGEAACASVHGAN  442

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTS 
Sbjct  443  RLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSK  502

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWNSDLIETVELEN
Sbjct  503  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKIHDRSLIWNSDLIETVELEN  562

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKW+KHTLGYWEN KV+L YRPVHMNTL
Sbjct  563  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWLKHTLGYWENGKVKLTYRPVHMNTL  622

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  623  DDEVESFPPKARVY  636



>ref|XP_008338495.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Malus domestica]
Length=633

 Score =   491 bits (1265),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPD  +PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDVTIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGEKTIAWLDKIRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESFHDV+++DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGVQLIDKAWESFHDVQLKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFT RDDEKWMKHTLGYWEN+KVRLDYRPVHMNTL
Sbjct  560  LLINASITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENKKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  620  DDEIETFPPKARVY  633



>gb|ACG43057.1| succinate dehydrogenase flavoprotein subunit,mitochondrial precursor 
[Zea mays]
Length=619

 Score =   491 bits (1263),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PDAV+PGLMAAGEAACASVHGAN
Sbjct  366  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDAVIPGLMAAGEAACASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA+I +PGEKQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  RLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI   WESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  486  IRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDRSLIWNSDLIETLELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDEKWMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  546  LLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLAYRPVHMNTL  605

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  606  DDEVESFPPKARVY  619



>ref|XP_002310225.1| Succinate dehydrogenase flavoprotein subunit [Populus trichocarpa]
 gb|EEE90675.1| Succinate dehydrogenase flavoprotein subunit [Populus trichocarpa]
Length=633

 Score =   491 bits (1264),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPG+  KPLEKDAGE+TIA LDKLRNSNGS+PTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHRPGKLNKPLEKDAGERTIARLDKLRNSNGSIPTSQ  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQ+NAAVFRTQETLEEGC LID AWESFHDVKV+DRSLIWNSDLIETVELEN
Sbjct  500  IRLNMQRIMQSNAAVFRTQETLEEGCHLIDKAWESFHDVKVKDRSLIWNSDLIETVELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE EKVRLDYRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEKEKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  620  DDEVETFPPKARVY  633



>ref|XP_009371587.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Pyrus x bretschneideri]
Length=633

 Score =   491 bits (1263),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+KG+DPD+++PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGDDPDSIIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGEKTIAWLDKIRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESFH+V+++DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGVQLIDKAWESFHEVQLKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDEKW+KH+LGYWENEKVRL+YRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTTRDDEKWIKHSLGYWENEKVRLNYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  620  DDEIETFPPKARVY  633



>ref|NP_001146722.1| uncharacterized protein LOC100280324 [Zea mays]
 gb|ACL54621.1| unknown [Zea mays]
Length=619

 Score =   490 bits (1261),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KGN+PDAV+PGLMAAGEAACASVHGAN
Sbjct  366  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGNNPDAVIPGLMAAGEAACASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA+I +PGEKQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  RLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI   WESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  486  IRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDRSLIWNSDLIETLELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDEKWMKH+LGYWENEKVRL YRPVHM TL
Sbjct  546  LLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLAYRPVHMKTL  605

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  606  DDEVESFPPKARVY  619



>ref|XP_010263680.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Nelumbo nucifera]
Length=637

 Score =   491 bits (1263),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVV +KGNDPDAVVPGLMAAGEAACASVHGAN
Sbjct  384  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVHIKGNDPDAVVPGLMAAGEAACASVHGAN  443

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLE DAGEKTIAWLDKLR+SNGSLPTS 
Sbjct  444  RLGANSLLDIVVFGRACANRVAEILKPGEKQKPLESDAGEKTIAWLDKLRHSNGSLPTSK  503

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  504  IRLNMQRVMQNNAAVFRTQETLEEGCRLIDKAWESFHDVKLKDRSLIWNSDLIETIELEN  563

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKRDDE W+KHTLGYW NEKVRLDYRPVHM TL
Sbjct  564  LLINASITMHSAEARKESRGAHAREDFTKRDDENWLKHTLGYWVNEKVRLDYRPVHMKTL  623

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  624  DDEVESFPPKARVY  637



>ref|XP_010444736.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Camelina sativa]
Length=533

 Score =   487 bits (1253),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  280  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  339

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLD+LRNSNGSLPTS 
Sbjct  340  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTST  399

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  400  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSLIWNSDLIETLELEN  459

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  460  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  519

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  520  DDEIDTFPPKARVY  533



>ref|XP_008338100.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Malus domestica]
Length=633

 Score =   490 bits (1261),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+KG+DPD+++PGLMAAGE ACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGDDPDSIIPGLMAAGETACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPL KDAGEKTIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLAKDAGEKTIAWLDKIRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESFH+V+++DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGAQLIDKAWESFHEVQLKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDEKW+KHTLGYWENEKVRLDYRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTTRDDEKWIKHTLGYWENEKVRLDYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  620  DDEIETFPPKARVY  633



>ref|XP_004509252.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Cicer arietinum]
Length=627

 Score =   490 bits (1261),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT KG++PD +VPGLMAAGE ACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTPKGDNPDEIVPGLMAAGETACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAG KTI+WLDKLRNSNGSLPTS 
Sbjct  434  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGMKTISWLDKLRNSNGSLPTSK  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DVK+EDRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDGAWESFRDVKLEDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA IT++SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  554  LLINASITVHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  613

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  614  DDEVESFPPKARVY  627



>ref|NP_001146352.1| uncharacterized protein LOC100279930 [Zea mays]
 gb|ACL53755.1| unknown [Zea mays]
 gb|ACN36155.1| unknown [Zea mays]
 gb|ACN36156.1| unknown [Zea mays]
 tpg|DAA59497.1| TPA: succinate dehydrogenase flavoprotein subunit [Zea mays]
Length=619

 Score =   489 bits (1259),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PDAVVPGLMAAGEAACASVHGAN
Sbjct  366  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDAVVPGLMAAGEAACASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA+I +PGEKQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  RLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI   WESFHDVK+ D+SLIWNSDLIET+ELEN
Sbjct  486  IRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDQSLIWNSDLIETLELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDEKWMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  546  LLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLAYRPVHMNTL  605

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  606  DDEVESFPPKARVY  619



>ref|XP_010550391.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Tarenaya hassleriana]
Length=634

 Score =   489 bits (1260),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVTVKGNDPDAV+PGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTVKGNDPDAVIPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG KQ+PLEKDAGEKTI WLDK+RNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEICKPGGKQRPLEKDAGEKTIEWLDKIRNSNGSLPTSQ  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID AW+S+ DVKV+DRSLIWNSDLIETVELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDRAWDSYGDVKVKDRSLIWNSDLIETVELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KVRL+YRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVRLEYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  621  DDEVETFPPKARVY  634



>ref|XP_006383209.1| hypothetical protein POPTR_0005s12530g [Populus trichocarpa]
 gb|ERP61006.1| hypothetical protein POPTR_0005s12530g [Populus trichocarpa]
Length=638

 Score =   489 bits (1258),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 234/256 (91%), Positives = 245/256 (96%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  383  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTLKGDDPDAVVPGLMAAGEAACASVHGAN  442

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGE--KQKPLEKDAGEKTIAWLDKLRNSNGSLPT  431
            RLGANSLLDIVVFGRACANRVA+I RPG+  KQKPLEKDAGE+TIAWLDKLRNSNGSL T
Sbjct  443  RLGANSLLDIVVFGRACANRVAKIHRPGKLNKQKPLEKDAGERTIAWLDKLRNSNGSLST  502

Query  430  SNIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVEL  251
            S+IRLNMQR MQNNAAVFRTQETLEEGC LID AWESFHDVKV+DRSLIWNSDLIET+EL
Sbjct  503  SHIRLNMQRTMQNNAAVFRTQETLEEGCHLIDKAWESFHDVKVKDRSLIWNSDLIETLEL  562

Query  250  ENLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMN  71
            ENLLINAC+TM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMN
Sbjct  563  ENLLINACVTMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMN  622

Query  70   TLDDEIETFPPKARVY  23
            TLDDEIE FPPKARVY
Sbjct  623  TLDDEIEPFPPKARVY  638



>ref|XP_008787307.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Phoenix dactylifera]
Length=633

 Score =   489 bits (1258),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KGNDPDAVVPGLMAAGEAACASVHG+N
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGNDPDAVVPGLMAAGEAACASVHGSN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG KQKPLEKDAG +TIAWLDKLRNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEICKPGRKQKPLEKDAGVRTIAWLDKLRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+L+D  WESFHDVK+ DRSLIWNSDL+ET+ELEN
Sbjct  500  IRLNMQRVMQNNAAVFRTQETLEEGCQLVDKTWESFHDVKIRDRSLIWNSDLMETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKH+LGYW+NEKVRL YRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHSLGYWDNEKVRLAYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  620  DDEVESFPPKARVY  633



>ref|XP_004287904.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Fragaria vesca subsp. vesca]
Length=634

 Score =   488 bits (1257),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PDAV+PGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVIPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRT ETL EG +LID AWESF+DV+V+DR+LIWNSDLIET+ELEN
Sbjct  501  IRLNMQRIMQNNAAVFRTHETLVEGAELIDKAWESFNDVQVKDRTLIWNSDLIETIELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDEKWMKH+LGYWENEKVRLDYRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLDYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  621  DDEIDTFPPKARVY  634



>ref|XP_009406751.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=635

 Score =   488 bits (1256),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV + G+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  382  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVCINGDDPDAVVPGLMAAGEAACASVHGAN  441

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+KQKPLE+DAGE+TIAWLDKLRNSNGSLPTS 
Sbjct  442  RLGANSLLDIVVFGRACANRVAEICKPGQKQKPLEEDAGERTIAWLDKLRNSNGSLPTSK  501

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ NAAVFRTQETLEEGC+LID AWESFH+VK+ DRSLIWNSDLIET+ELEN
Sbjct  502  IRLNMQRVMQTNAAVFRTQETLEEGCQLIDKAWESFHEVKIRDRSLIWNSDLIETIELEN  561

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKW+KHTLGYWE EKVRL YRPVHMNTL
Sbjct  562  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWLKHTLGYWEKEKVRLAYRPVHMNTL  621

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  622  DDEIESFPPKARVY  635



>ref|XP_010942844.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X2 [Elaeis guineensis]
Length=618

 Score =   487 bits (1254),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG+DPDA+VPGLMAAGEAACASVHGAN
Sbjct  365  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDDPDAIVPGLMAAGEAACASVHGAN  424

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGE+TIAWLDKLRNSNGSL TS 
Sbjct  425  RLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKDAGERTIAWLDKLRNSNGSLLTSK  484

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  485  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKIRDRSLIWNSDLIETIELEN  544

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKR+D+ W+KH+LGYWENEKVRL YRPVHMNTL
Sbjct  545  LLINACITMHSAEARKESRGAHAREDFTKREDQNWLKHSLGYWENEKVRLAYRPVHMNTL  604

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  605  DDEVESFPPKARVY  618



>ref|XP_010444735.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Camelina sativa]
 ref|XP_010444737.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X3 [Camelina sativa]
Length=634

 Score =   488 bits (1256),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLD+LRNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTST  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSLIWNSDLIETLELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  561  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  620

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  621  DDEIDTFPPKARVY  634



>tpg|DAA42707.1| TPA: hypothetical protein ZEAMMB73_508415 [Zea mays]
Length=700

 Score =   490 bits (1261),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KGN+PDAV+PGLMAAGEAACASVHGAN
Sbjct  447  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGNNPDAVIPGLMAAGEAACASVHGAN  506

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA+I +PGEKQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  507  RLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  566

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI   WESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  567  IRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDRSLIWNSDLIETLELEN  626

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDEKWMKH+LGYWENEKVRL YRPVHM TL
Sbjct  627  LLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWENEKVRLAYRPVHMKTL  686

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  687  DDEVESFPPKARVY  700



>ref|XP_008241667.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Prunus mume]
Length=633

 Score =   488 bits (1255),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT KGNDPD ++PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKKGNDPDVIIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLEKD+GE+TIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQQPLEKDSGEQTIAWLDKIRNSNGSLPTSQ  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESF +V+V+DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGSQLIDKAWESFDNVQVKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SA+ARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVH+NTL
Sbjct  560  LLINACITMHSADARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHLNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  620  DDEIESFPPKARVY  633



>gb|KFK28359.1| succinate dehydrogenase [Arabis alpina]
Length=629

 Score =   488 bits (1255),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  376  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  435

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLEKDAGEKTIAWLD+LRNSNGSLPTS+
Sbjct  436  RLGANSLLDIVVFGRACANRVAEINKPGEKQRPLEKDAGEKTIAWLDRLRNSNGSLPTSS  495

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  496  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFADVQVKDRSLIWNSDLIETLELEN  555

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  556  LLINAAITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  615

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  616  DDEIETFPPKARVY  629



>ref|NP_201477.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Arabidopsis 
thaliana]
 sp|O82663.1|SDHA1_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial; AltName: Full=Flavoprotein subunit 
1 of complex II; Short=FP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32928.1|AF367341_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AAL32015.1|AF436833_1 AT5g66760/MSN2_16 [Arabidopsis thaliana]
 emb|CAA05025.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis 
thaliana]
 dbj|BAA97282.1| succinate dehydrogenase flavoprotein alpha subunit [Arabidopsis 
thaliana]
 gb|AAK74032.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AAM70521.1| AT5g66760/MSN2_16 [Arabidopsis thaliana]
 gb|AED98260.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Arabidopsis 
thaliana]
Length=634

 Score =   487 bits (1254),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLD+LRNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTST  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRS+IWNSDLIET+ELEN
Sbjct  501  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSMIWNSDLIETLELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  561  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  620

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  621  DDEIDTFPPKARVY  634



>ref|XP_010464904.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Camelina sativa]
 ref|XP_010464913.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Camelina sativa]
 ref|XP_010464922.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X3 [Camelina sativa]
Length=634

 Score =   487 bits (1253),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLEKDAGEKTIAWLD+LRNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEKDAGEKTIAWLDRLRNSNGSLPTST  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  501  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSLIWNSDLIETLELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  561  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  620

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  621  DDEIDTFPPKARVY  634



>ref|XP_006280112.1| hypothetical protein CARUB_v10026004mg, partial [Capsella rubella]
 gb|EOA13010.1| hypothetical protein CARUB_v10026004mg, partial [Capsella rubella]
Length=689

 Score =   489 bits (1258),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  436  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  495

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLD+LRNSNGSLPTS+
Sbjct  496  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTSS  555

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  556  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSLIWNSDLIETLELEN  615

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  616  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  675

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  676  DDEIDTFPPKARVY  689



>ref|NP_001058845.1| Os07g0134800 [Oryza sativa Japonica Group]
 sp|Q6ZDY8.1|SDHA_ORYSJ RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial; AltName: Full=Flavoprotein subunit 
of complex II; Short=FP; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAC83515.1| putative succinate dehydrogenase flavoprotein alpha subunit [Oryza 
sativa Japonica Group]
 dbj|BAF20759.1| Os07g0134800 [Oryza sativa Japonica Group]
 dbj|BAG89728.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81474.1| hypothetical protein OsI_24801 [Oryza sativa Indica Group]
Length=630

 Score =   486 bits (1252),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PD+VVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDSVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAE  +PGEKQKPL+K AGEKTIAWLDKLRN+NGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGEKTIAWLDKLRNANGSLPTSK  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGCKLI  AWES+HDVK+ DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVKISDRSLIWNSDLIETIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE+WMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  557  LLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSLGYWENEKVRLAYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            D E+E+FPPKARVY
Sbjct  617  DSEVESFPPKARVY  630



>ref|XP_010942839.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Elaeis guineensis]
Length=634

 Score =   487 bits (1253),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG+DPDA+VPGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDDPDAIVPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGE+TIAWLDKLRNSNGSL TS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKDAGERTIAWLDKLRNSNGSLLTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKIRDRSLIWNSDLIETIELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKR+D+ W+KH+LGYWENEKVRL YRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTKREDQNWLKHSLGYWENEKVRLAYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  621  DDEVESFPPKARVY  634



>gb|ADZ75464.1| succinate dehydrogenase [Litchi chinensis]
Length=628

 Score =   486 bits (1252),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG DPDAV+PGLMAAGEAACASVHG+N
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGKDPDAVIPGLMAAGEAACASVHGSN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPL KDAG++TIAWLDK+RNSNGS+PTS 
Sbjct  435  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLVKDAGQRTIAWLDKIRNSNGSIPTSK  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETL EGC+LID AW+SFH+VK+ DRSLIWNSDLIET+ELEN
Sbjct  495  IRLNMQRIMQNNAAVFRTQETLAEGCQLIDKAWDSFHNVKLADRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFT RDD+ WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  555  LLINARITMHSAEARKESRGAHAREDFTIRDDQNWMKHTLGYWENEKVRLDYRPVHMNTL  614

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  615  DDEVESFPPKARVY  628



>ref|XP_003558573.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial [Brachypodium distachyon]
Length=617

 Score =   486 bits (1250),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD+V+PGL+AAGEAACASVHGAN
Sbjct  364  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDNPDSVIPGLLAAGEAACASVHGAN  423

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAG+KTIAWLDKLRNSNGSLPTS 
Sbjct  424  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLPTSK  483

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETL EGC+LI  A ESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  484  IRLNMQRVMQNNAAVFRTQETLAEGCELITKAQESFHDVKISDRSLIWNSDLIETIELEN  543

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDEKWMKH+LGYWE+EKVRL+YRPVHMNTL
Sbjct  544  LLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLGYWEDEKVRLEYRPVHMNTL  603

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  604  DDEIETFPPKARVY  617



>ref|XP_004972473.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Setaria italica]
Length=619

 Score =   486 bits (1250),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD+V+ GL+AAGEAACASVHGAN
Sbjct  366  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDSVISGLLAAGEAACASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA+I +PG+KQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  RLGANSLLDIVVFGRACANRVADISKPGQKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGCKLI  AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  486  IRLNMQRVMQNNAAVFRTQETLEEGCKLISKAWESFHDVKLSDRSLIWNSDLIETIELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDEKWMKHTLGYWENEKVRL YRPVHMNTL
Sbjct  546  LLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENEKVRLAYRPVHMNTL  605

Query  64   DDEIETFPPKARVY  23
            D+E+E+FPPKARVY
Sbjct  606  DEEVESFPPKARVY  619



>gb|EEE66523.1| hypothetical protein OsJ_23002 [Oryza sativa Japonica Group]
Length=661

 Score =   487 bits (1253),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PD+VVPGLMAAGEAACASVHGAN
Sbjct  408  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDSVVPGLMAAGEAACASVHGAN  467

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAE  +PGEKQKPL+K AGEKTIAWLDKLRN+NGSLPTS 
Sbjct  468  RLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGEKTIAWLDKLRNANGSLPTSK  527

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGCKLI  AWES+HDVK+ DRSLIWNSDLIET+ELEN
Sbjct  528  IRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVKISDRSLIWNSDLIETIELEN  587

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE+WMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  588  LLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSLGYWENEKVRLAYRPVHMNTL  647

Query  64   DDEIETFPPKARVY  23
            D E+E+FPPKARVY
Sbjct  648  DSEVESFPPKARVY  661



>ref|XP_007202009.1| hypothetical protein PRUPE_ppa002787mg [Prunus persica]
 gb|EMJ03208.1| hypothetical protein PRUPE_ppa002787mg [Prunus persica]
Length=633

 Score =   486 bits (1250),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT KG+DPD ++PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKKGDDPDVIIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLEKD+GE+TIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQQPLEKDSGEQTIAWLDKIRNSNGSLPTSQ  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESF +V+V+DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGSQLIDKAWESFDNVQVKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINAC+TM+SAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVH+NTL
Sbjct  560  LLINACVTMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHLNTL  619

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  620  DDEIESFPPKARVY  633



>ref|XP_006658260.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Oryza brachyantha]
Length=634

 Score =   486 bits (1250),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PD+VVPGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDSVVPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+KQKPLEK AG+KTIAWLDKLRN+NGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEISKPGDKQKPLEKSAGQKTIAWLDKLRNANGSLPTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI  AWES+HDVK+ DRSLIWNSDLIET+ELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCQLITKAWESYHDVKISDRSLIWNSDLIETIELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE+WMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSLGYWENEKVRLAYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            D E+E+FPPKARVY
Sbjct  621  DAEVESFPPKARVY  634



>ref|XP_003537582.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform 1 [Glycine max]
Length=630

 Score =   486 bits (1250),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNH+GEVVT+KG++PDAVVPGLMAAGE ACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIKGDNPDAVVPGLMAAGETACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI+RPGEKQKPLEKDAG++TIAWLDKLRNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIRRPGEKQKPLEKDAGQRTIAWLDKLRNSNGSLPTSQ  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ NAAVFRTQETLEEGC+LID  WESFHDV+V+DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQTNAAVFRTQETLEEGCQLIDKTWESFHDVQVKDRSLIWNSDLIETIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDF  RDD  WMKHT+G+WENEKVRLDYRPVH+N L
Sbjct  557  LLINACITMYSAEARKESRGAHAREDFKVRDDGSWMKHTVGFWENEKVRLDYRPVHLNVL  616

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  617  DDEVESFPPKARVY  630



>ref|XP_004232400.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial [Solanum lycopersicum]
Length=629

 Score =   485 bits (1249),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 224/254 (88%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HG+VVT  G+DPDAV+PGLMAAGEAACASVHGAN
Sbjct  376  GVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVTKNGDDPDAVIPGLMAAGEAACASVHGAN  435

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PG +QKPLEKDAGE+TIAWLDK+RNSNGSLPTS 
Sbjct  436  RLGANSLLDIVVFGRACANRVAEIQKPGAEQKPLEKDAGERTIAWLDKIRNSNGSLPTSK  495

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQRVMQNNAAVFRTQETLEEGC+LID  WESFHDV+++DR LIWN+DLIET+ELEN
Sbjct  496  IRLDMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRGLIWNTDLIETIELEN  555

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDEKWMKHT+GYWE+EKVRL+YRPVHMNTL
Sbjct  556  LLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTIGYWEDEKVRLEYRPVHMNTL  615

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  616  DDEVESFPPKARVY  629



>gb|KHG24770.1| SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 
1, mitochondrial [Gossypium arboreum]
Length=636

 Score =   485 bits (1249),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/260 (89%), Positives = 243/260 (93%), Gaps = 6/260 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT++GNDPD+VVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIRGNDPDSVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPG------EKQKPLEKDAGEKTIAWLDKLRNSNG  443
            RLGANSLLDIVVFGRACANRVAEI RPG      EK KPLEKDA EKT+AWLDKLRNSNG
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIHRPGKFYISGEKLKPLEKDASEKTVAWLDKLRNSNG  496

Query  442  SLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIE  263
            SLPTS IRLNMQRVMQNNAAVFRTQETLEEGC+LID   +SFHDVK++DRSLIWNSDLIE
Sbjct  497  SLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTLDSFHDVKLKDRSLIWNSDLIE  556

Query  262  TVELENLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRP  83
            T+ELENLL NACITM+SAEARKESRGAHAREDFTKRDD+ WMKHTLGYWENEKVRLDYRP
Sbjct  557  TIELENLLTNACITMHSAEARKESRGAHAREDFTKRDDKNWMKHTLGYWENEKVRLDYRP  616

Query  82   VHMNTLDDEIETFPPKARVY  23
            VHMNTLDDEIE+FPPKARVY
Sbjct  617  VHMNTLDDEIESFPPKARVY  636



>ref|XP_002866741.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43000.1| succinate dehydrogenase 1-1 [Arabidopsis lyrata subsp. lyrata]
Length=634

 Score =   485 bits (1248),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG++PDAVVPGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVVPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLD+LRNSNGSLPTS+
Sbjct  441  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRLRNSNGSLPTSS  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRS+IWNSDLIET+ELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSMIWNSDLIETLELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  561  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  620

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  621  DDEIDTFPPKARVY  634



>ref|XP_003517234.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform 1 [Glycine max]
Length=630

 Score =   484 bits (1246),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNH+GEVVT+KG++PDAVV GLMAAGE ACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIKGDNPDAVVSGLMAAGETACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI+RPGEKQKPLEKDAG++TIAWLDKLRNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIRRPGEKQKPLEKDAGQRTIAWLDKLRNSNGSLPTSQ  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDV+V+DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQVKDRSLIWNSDLIETIELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDF  RDD  WMKHT+G+WENEKVRLDYRPVH+N L
Sbjct  557  LLINACITMYSAEARKESRGAHAREDFKVRDDGNWMKHTVGFWENEKVRLDYRPVHLNVL  616

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  617  DDEVESFPPKARVY  630



>ref|XP_002463806.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
 gb|EER90804.1| hypothetical protein SORBIDRAFT_01g006490 [Sorghum bicolor]
Length=620

 Score =   484 bits (1245),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+ +KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  367  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLHIKGDDPDAVVPGLMAAGEAACASVHGAN  426

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPL K  GE TIAWLDKLRN+NGSLPTS 
Sbjct  427  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLGKGVGENTIAWLDKLRNANGSLPTSK  486

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI  AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  487  IRLNMQRVMQNNAAVFRTQETLEEGCELISKAWESFHDVKISDRSLIWNSDLIETIELEN  546

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDF+ RDDE WMKHTLGYWENEKVRL YRPVHMNTL
Sbjct  547  LLINACITMYSAEARKESRGAHAREDFSTRDDESWMKHTLGYWENEKVRLAYRPVHMNTL  606

Query  64   DDEIETFPPKARVY  23
            DDE+++FPPKARVY
Sbjct  607  DDEVQSFPPKARVY  620



>dbj|BAK08049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   483 bits (1243),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD V+PGLMAAGEAACASVHGAN
Sbjct  366  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDTVIPGLMAAGEAACASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+KQKPLEK AGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  RLGANSLLDIVVFGRACANRVAEISKPGDKQKPLEKGAGEKTIAWLDKLRNANGSLPTSK  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLN QR+MQNNAAVFRTQETLEEGC+LI  AWES+HDVK+ DRSLIWNSDLIET+ELEN
Sbjct  486  IRLNTQRIMQNNAAVFRTQETLEEGCQLISKAWESYHDVKINDRSLIWNSDLIETIELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDE WMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  546  LLINACITMYSAEARKESRGAHAREDFTTRDDEHWMKHSLGYWENEKVRLAYRPVHMNTL  605

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  606  DDEIESFPPKARVY  619



>ref|XP_008783478.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial isoform X1 [Phoenix dactylifera]
Length=634

 Score =   483 bits (1244),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG+DPD +VPGLMAAGEAACASVHGAN
Sbjct  381  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDDPDCIVPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEK AGE+TIAWLDKLRNSNGSL TS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKYAGERTIAWLDKLRNSNGSLSTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID AWESFHDVK+ DRSLIWNSDLIETVELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKIRDRSLIWNSDLIETVELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE W+KH+LGYWENEKV L YRPVHMNTL
Sbjct  561  LLINACITMHSAEARKESRGAHAREDFTKRDDENWLKHSLGYWENEKVTLAYRPVHMNTL  620

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  621  DDEVESFPPKARVY  634



>ref|XP_003557614.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like [Brachypodium distachyon]
Length=620

 Score =   483 bits (1242),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD V+ GLMAAGEAACASVHGAN
Sbjct  367  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDTVIHGLMAAGEAACASVHGAN  426

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI RPG+KQKPLEK AGEKTIAWLDKLRN+NGSLPTS 
Sbjct  427  RLGANSLLDIVVFGRACANRVAEISRPGDKQKPLEKGAGEKTIAWLDKLRNANGSLPTSK  486

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLN QR+MQNNAAVFRTQETLEEGC+LI  AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  487  IRLNTQRIMQNNAAVFRTQETLEEGCQLISKAWESFHDVKISDRSLIWNSDLIETIELEN  546

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDE+WMKH++GYWENEKVRL YRPVHMNTL
Sbjct  547  LLINACITMYSAEARKESRGAHAREDFTTRDDERWMKHSMGYWENEKVRLAYRPVHMNTL  606

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  607  DDEIESFPPKARVY  620



>ref|XP_004981575.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X2 [Setaria italica]
Length=594

 Score =   481 bits (1237),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD VVPGLMAAGEAACASVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDNPDTVVPGLMAAGEAACASVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEK  GEKTIAWLDKLRN+NGSLPTS 
Sbjct  401  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKGVGEKTIAWLDKLRNANGSLPTSK  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETL+EGC LI  AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  461  IRLNMQRVMQNNAAVFRTQETLKEGCGLISKAWESFHDVKISDRSLIWNSDLIETIELEN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDE WMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  521  LLINACITMHSAEARKESRGAHAREDFTTRDDENWMKHSLGYWENEKVRLAYRPVHMNTL  580

Query  64   DDEIETFPPKARVY  23
            DDE+++FPPKARVY
Sbjct  581  DDEVQSFPPKARVY  594



>ref|XP_004981574.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit, mitochondrial-like isoform X1 [Setaria italica]
Length=620

 Score =   482 bits (1240),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD VVPGLMAAGEAACASVHGAN
Sbjct  367  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDNPDTVVPGLMAAGEAACASVHGAN  426

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEK  GEKTIAWLDKLRN+NGSLPTS 
Sbjct  427  RLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKGVGEKTIAWLDKLRNANGSLPTSK  486

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETL+EGC LI  AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  487  IRLNMQRVMQNNAAVFRTQETLKEGCGLISKAWESFHDVKISDRSLIWNSDLIETIELEN  546

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFT RDDE WMKH+LGYWENEKVRL YRPVHMNTL
Sbjct  547  LLINACITMHSAEARKESRGAHAREDFTTRDDENWMKHSLGYWENEKVRLAYRPVHMNTL  606

Query  64   DDEIETFPPKARVY  23
            DDE+++FPPKARVY
Sbjct  607  DDEVQSFPPKARVY  620



>ref|XP_006393871.1| hypothetical protein EUTSA_v10003821mg [Eutrema salsugineum]
 dbj|BAJ33900.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31157.1| hypothetical protein EUTSA_v10003821mg [Eutrema salsugineum]
Length=626

 Score =   480 bits (1235),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  373  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  432

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE+DAG KTI WL+KLRNS GSLPTS+
Sbjct  433  RLGANSLLDIVVFGRACANRVAEINKPGEKQRPLEEDAGRKTIEWLNKLRNSRGSLPTSS  492

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  493  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  552

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRLDYRPVHM+TL
Sbjct  553  LLINAAITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLDYRPVHMDTL  612

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  613  DDEIETFPPKARVY  626



>gb|EMS68611.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Triticum urartu]
Length=606

 Score =   479 bits (1233),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD V+PGLMAAGEAACASVHGAN
Sbjct  353  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDTVIPGLMAAGEAACASVHGAN  412

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+KQKPLEK AGEKTIAWLDKLRN+NGSLPTS 
Sbjct  413  RLGANSLLDIVVFGRACANRVAEISKPGDKQKPLEKGAGEKTIAWLDKLRNANGSLPTSK  472

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLN QR+MQNNAAVFRTQETLEEGC+LI  AWES+HDVK+ DRSLIWNSDLIET+EL+N
Sbjct  473  IRLNTQRIMQNNAAVFRTQETLEEGCQLISKAWESYHDVKISDRSLIWNSDLIETIELKN  532

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDFT RDDE+WMKH+LGYWENEKVRL YR VHMNTL
Sbjct  533  LLINACITMYSAEARKESRGAHAREDFTTRDDERWMKHSLGYWENEKVRLAYRRVHMNTL  592

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  593  DDEIESFPPKARVY  606



>gb|KHF98130.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial -like protein [Gossypium arboreum]
Length=621

 Score =   478 bits (1230),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 240/254 (94%), Gaps = 9/254 (4%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT++G+DPD+VVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIRGSDPDSVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANR         KQKPLEKDAGE+TIAWLDK+RNSNGSLPTSN
Sbjct  437  RLGANSLLDIVVFGRACANR---------KQKPLEKDAGERTIAWLDKIRNSNGSLPTSN  487

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDVK++DRSLIWNSDLIE++ELEN
Sbjct  488  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRSLIWNSDLIESIELEN  547

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLG+WENEKVRLDYRPVHMNTL
Sbjct  548  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGFWENEKVRLDYRPVHMNTL  607

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  608  DDEVESFPPKARVY  621



>gb|KHN41982.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Glycine soja]
Length=627

 Score =   477 bits (1228),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 240/254 (94%), Gaps = 3/254 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNH+GEVVT+KG++PDAVVPGLMAAGE ACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIKGDNPDAVVPGLMAAGETACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI+   EKQKPLEKDAG++TIAWLDKLRNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIR---EKQKPLEKDAGQRTIAWLDKLRNSNGSLPTSQ  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ NAAVFRTQETLEEGC+LID  WESFHDV+VEDRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRVMQTNAAVFRTQETLEEGCQLIDKTWESFHDVQVEDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDF  RDDE WMKHT+G+WENEKVRLDYRPVH+N L
Sbjct  554  LLINACITMYSAEARKESRGAHAREDFKVRDDESWMKHTVGFWENEKVRLDYRPVHLNVL  613

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  614  DDEVESFPPKARVY  627



>ref|XP_008344291.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial, partial [Malus domestica]
Length=626

 Score =   476 bits (1225),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 237/247 (96%), Gaps = 0/247 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPD  +PGLMAAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDVTIPGLMAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAGEKTIAWLDK+RNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGEKTIAWLDKIRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEG +LID AWESFHDV+++DRSLIWNSDLIET+ELEN
Sbjct  500  IRLNMQRIMQNNAAVFRTQETLEEGVQLIDKAWESFHDVQLKDRSLIWNSDLIETIELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFT RDDEKWMKHTLGYWEN+KVRLDYRPVHMNTL
Sbjct  560  LLINASITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENKKVRLDYRPVHMNTL  619

Query  64   DDEIETF  44
            DDEIETF
Sbjct  620  DDEIETF  626



>emb|CDY57124.1| BnaA09g52600D [Brassica napus]
Length=627

 Score =   476 bits (1225),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+GSLPTS+
Sbjct  434  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGSLPTSS  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  554  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  613

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  614  DDEIETFPPKARVY  627



>emb|CDX81369.1| BnaC09g07800D [Brassica napus]
Length=628

 Score =   475 bits (1223),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+GSLPTS+
Sbjct  435  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGSLPTSS  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  495  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  555  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  614

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  615  DDEIETFPPKARVY  628



>emb|CDY30754.1| BnaC07g16540D [Brassica napus]
Length=627

 Score =   475 bits (1223),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+GSLPTS+
Sbjct  434  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGSLPTSS  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  554  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  613

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  614  DDEIDTFPPKARVY  627



>ref|XP_009103488.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X1 [Brassica rapa]
 emb|CDY53847.1| BnaA07g37420D [Brassica napus]
Length=627

 Score =   475 bits (1222),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+GSLPTS+
Sbjct  434  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGSLPTSS  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  554  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  613

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  614  DDEIDTFPPKARVY  627



>ref|XP_009103489.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial isoform X2 [Brassica rapa]
Length=626

 Score =   475 bits (1222),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  373  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  432

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+GSLPTS+
Sbjct  433  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGSLPTSS  492

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  493  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  552

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  553  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  612

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  613  DDEIDTFPPKARVY  626



>emb|CDY49839.1| BnaC02g43980D [Brassica napus]
Length=628

 Score =   474 bits (1221),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+GSLPTS+
Sbjct  435  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGSLPTSS  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  495  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  555  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  614

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  615  DDEIDTFPPKARVY  628



>dbj|BAK02783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   474 bits (1220),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HG+VV +KG++PD ++PGLMAAGEAACASVHGAN
Sbjct  368  GVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVDIKGDNPDTIIPGLMAAGEAACASVHGAN  427

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGE QKPLEKDAGEKTIAWLDKLRN+NGSLPTSN
Sbjct  428  RLGANSLLDIVVFGRACANRVAEISKPGETQKPLEKDAGEKTIAWLDKLRNANGSLPTSN  487

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETL EGCKLI  A +SF+DVK+ DRSLIWNSDLIET+ELEN
Sbjct  488  IRLNMQRIMQNNAAVFRTQETLTEGCKLISEAQKSFNDVKLSDRSLIWNSDLIETIELEN  547

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEAR+ESRGAHAREDF  RDD+KWMKH+LGYWE+EKVRL+YRPVHMNTL
Sbjct  548  LLINACITMHSAEARQESRGAHAREDFKTRDDDKWMKHSLGYWEDEKVRLEYRPVHMNTL  607

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  608  DDEVETFPPKARVY  621



>gb|KFK40220.1| hypothetical protein AALP_AA3G346200 [Arabis alpina]
Length=637

 Score =   474 bits (1219),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 224/254 (88%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GV+VT+EPIPVLPTV Y MGGIPTN+HGEVVTV+G+D +++VPGLMAAGEAACASVHGAN
Sbjct  384  GVNVTREPIPVLPTVHYNMGGIPTNYHGEVVTVRGDDLNSIVPGLMAAGEAACASVHGAN  443

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK KPLEKDAGEK+I WLD++RNSNGSLPTS 
Sbjct  444  RLGANSLLDIVVFGRACANRVAEIQKPGEKLKPLEKDAGEKSIEWLDRIRNSNGSLPTSK  503

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  WESF DVKV+DRSLIWNSDLIET+ELEN
Sbjct  504  IRLNMQRVMQNNAAVFRTQETLEEGCHLIDKEWESFGDVKVKDRSLIWNSDLIETMELEN  563

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KVRL+YRPVHMNTL
Sbjct  564  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVRLEYRPVHMNTL  623

Query  64   DDEIETFPPKARVY  23
            DDEI+TFPPKARVY
Sbjct  624  DDEIDTFPPKARVY  637



>ref|XP_010467662.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial-like [Camelina sativa]
Length=630

 Score =   473 bits (1216),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEVVTV+G+D DA+VPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVVTVRGDDTDAIVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK +PLEKDAGEK+I WLD++RNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIQKPGEKLRPLEKDAGEKSIEWLDRVRNSNGSLPTSK  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVTDRSLIWNSDLIETMELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL+NACITM+SAEARKESRGAHAREDFTKRDD  WMKHTLGYWE   V+LDYRPVHMNTL
Sbjct  557  LLVNACITMHSAEARKESRGAHAREDFTKRDDANWMKHTLGYWEEGNVKLDYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPKARVY
Sbjct  617  DDEVDTFPPKARVY  630



>gb|KHN36125.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Glycine soja]
Length=627

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 238/254 (94%), Gaps = 3/254 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNH+GEVVT+KG++PDAVV GLMAAGE ACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIKGDNPDAVVSGLMAAGETACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI+   EKQKPLEKDAG++TIAWLDKLRNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIR---EKQKPLEKDAGQRTIAWLDKLRNSNGSLPTSQ  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID  WESFHDV+V DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQVRDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITMYSAEARKESRGAHAREDF  RDD  WMKHT+G+WENEKVRLDYRPVH+N L
Sbjct  554  LLINACITMYSAEARKESRGAHAREDFKVRDDGNWMKHTVGFWENEKVRLDYRPVHLNVL  613

Query  64   DDEIETFPPKARVY  23
            DDE+E+FPPKARVY
Sbjct  614  DDEVESFPPKARVY  627



>ref|XP_010489548.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial [Camelina sativa]
Length=630

 Score =   471 bits (1213),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEVVTV+G+D DA+VPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVVTVRGDDTDAIVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK +PLEKDAGEK+I WLD++RNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIQKPGEKLRPLEKDAGEKSIEWLDRMRNSNGSLPTSK  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVTDRSLIWNSDLIETMELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL+NACITM+SAEARKESRGAHAREDFTKRDD  WMKHTLGYWE   V+L+YRPVHMNTL
Sbjct  557  LLVNACITMHSAEARKESRGAHAREDFTKRDDANWMKHTLGYWEEGNVKLEYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPKARVY
Sbjct  617  DDEVDTFPPKARVY  630



>emb|CAN74538.1| hypothetical protein VITISV_023718 [Vitis vinifera]
Length=587

 Score =   469 bits (1207),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 238/254 (94%), Gaps = 5/254 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+KGNDPDAVVPGLMAAGEAACASVHGAN
Sbjct  339  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGNDPDAVVPGLMAAGEAACASVHGAN  398

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+       D+GEKTIAWLDKLRNSNGS+PTS 
Sbjct  399  RLGANSLLDIVVFGRACANRVAEIHKPGKFL-----DSGEKTIAWLDKLRNSNGSIPTSK  453

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGCKLID AWESFHDV+++DRSLIWNSDL ET+ELEN
Sbjct  454  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFHDVQLKDRSLIWNSDLSETIELEN  513

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE W++HTLGYWENEKVRLDYRPVHMN L
Sbjct  514  LLINACITMHSAEARKESRGAHAREDFTKRDDENWIRHTLGYWENEKVRLDYRPVHMNPL  573

Query  64   DDEIETFPPKARVY  23
            DDEIE+ PPKARVY
Sbjct  574  DDEIESIPPKARVY  587



>ref|XP_009112332.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X1 [Brassica rapa]
Length=628

 Score =   471 bits (1211),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAA ASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAAFASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+G+LPTS+
Sbjct  435  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGALPTSS  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  495  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  555  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  614

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  615  DDEIETFPPKARVY  628



>ref|XP_009112333.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Brassica rapa]
Length=627

 Score =   470 bits (1210),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT+KG+DPDAVVPGLMAAGEAA ASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAAFASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQ+PLE++AG+KTI WL+KLR+S+G+LPTS+
Sbjct  434  RLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLNKLRHSSGALPTSS  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DV+V+DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFTKR+D +WMKHTLGYWE+EKVRL+YRPVHM+TL
Sbjct  554  LLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVRLEYRPVHMDTL  613

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  614  DDEIETFPPKARVY  627



>ref|NP_179435.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis 
thaliana]
 sp|Q9ZPX5.1|SDHA2_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial; AltName: Full=Flavoprotein subunit 
2 of complex II; Short=FP; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD15493.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis 
thaliana]
 dbj|BAC43712.1| putative succinate dehydrogenase flavoprotein subunit [Arabidopsis 
thaliana]
 gb|AAO64873.1| At2g18450 [Arabidopsis thaliana]
 gb|AEC06769.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 2 [Arabidopsis 
thaliana]
Length=632

 Score =   469 bits (1207),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEV+T++G+DPDAVVPGLMAAGEAACASVHGAN
Sbjct  379  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVITLRGDDPDAVVPGLMAAGEAACASVHGAN  438

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK KPLEKDAGEK+I WLD++RNSNGSLPTS 
Sbjct  439  RLGANSLLDIVVFGRACANRVAEIQKPGEKLKPLEKDAGEKSIEWLDRIRNSNGSLPTSK  498

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV DRS+IWNSDLIET+ELEN
Sbjct  499  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVTDRSMIWNSDLIETMELEN  558

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL+NACITM+SAEARKESRGAHAREDFTKRDD  WMKHTLGYWE   V+L+YRPVHM TL
Sbjct  559  LLVNACITMHSAEARKESRGAHAREDFTKRDDANWMKHTLGYWEEGNVKLEYRPVHMKTL  618

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPK RVY
Sbjct  619  DDEVDTFPPKPRVY  632



>emb|CDY29234.1| BnaA06g25230D [Brassica napus]
Length=633

 Score =   469 bits (1206),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEV+TV+G+DPD++VPGLMAAGEAA ASVHGAN
Sbjct  380  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVITVRGDDPDSIVPGLMAAGEAASASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK +PLE DAGEK+I WL +LRNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIQKPGEKLRPLENDAGEKSIEWLHRLRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV+D+SLIWNSDL+ET+ELEN
Sbjct  500  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVKDKSLIWNSDLVETMELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KV+L+YRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVKLEYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPKARVY
Sbjct  620  DDEVDTFPPKARVY  633



>ref|XP_009150830.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial [Brassica rapa]
Length=632

 Score =   468 bits (1205),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEV+TV+G+DPD++VPGLMAAGEAA ASVHGAN
Sbjct  379  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVITVRGDDPDSIVPGLMAAGEAASASVHGAN  438

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK +PLE DAGEK+I WL +LRNSNGSLPTS 
Sbjct  439  RLGANSLLDIVVFGRACANRVAEIQKPGEKLRPLENDAGEKSIEWLHRLRNSNGSLPTSK  498

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV+D+SLIWNSDL+ET+ELEN
Sbjct  499  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVKDKSLIWNSDLVETMELEN  558

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KV+L+YRPVHMNTL
Sbjct  559  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVKLEYRPVHMNTL  618

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPKARVY
Sbjct  619  DDEVDTFPPKARVY  632



>ref|XP_006856022.1| hypothetical protein AMTR_s00059p00054360 [Amborella trichopoda]
 gb|ERN17489.1| hypothetical protein AMTR_s00059p00054360 [Amborella trichopoda]
Length=631

 Score =   468 bits (1205),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEVV +KG+DP+AVVPGLMAAGEAACASVHGAN
Sbjct  378  GVDVTKEPIPVIPTVHYNMGGIPTNYHGEVVDIKGDDPNAVVPGLMAAGEAACASVHGAN  437

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPL  DAG+KTIAWLDKLRNSNGSLPTS 
Sbjct  438  RLGANSLLDIVVFGRACANRVAEIYKPGEKQKPLPSDAGQKTIAWLDKLRNSNGSLPTSK  497

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ +AAVFRTQETLEEGC LID AWESFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  498  IRLNMQRVMQTHAAVFRTQETLEEGCTLIDKAWESFHDVKLHDRSLIWNSDLIETIELEN  557

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDF  RDDE WMKHTLGYWEN KV L YRPVHM TL
Sbjct  558  LLINACITMHSAEARKESRGAHAREDFPMRDDENWMKHTLGYWENGKVGLAYRPVHMYTL  617

Query  64   DDEIETFPPKARVY  23
            D+E+E FPPKARVY
Sbjct  618  DEEVEPFPPKARVY  631



>ref|XP_010414323.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 2, mitochondrial-like [Camelina sativa]
Length=630

 Score =   468 bits (1204),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEVVTV+G+D DA+VPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVVTVRGDDTDAIVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGE  KPLEKDAGEK+I WLD++RNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFGRACANRVAEIQKPGEILKPLEKDAGEKSIKWLDRIRNSNGSLPTSK  496

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC L+D  W+SF DVKV DRSLIWNSDLIET+ELEN
Sbjct  497  IRLNMQRVMQNNAAVFRTQETLEEGCDLMDKTWDSFGDVKVTDRSLIWNSDLIETMELEN  556

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL+NACITM+SAEARKESRGAHAREDFTKRDD  WMKHTLGYWE   V+L+YRPVHMNTL
Sbjct  557  LLVNACITMHSAEARKESRGAHAREDFTKRDDVNWMKHTLGYWEEGNVKLEYRPVHMNTL  616

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPKARVY
Sbjct  617  DDEVDTFPPKARVY  630



>ref|XP_002886171.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62430.1| succinate dehydrogenase 1-2 [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score =   467 bits (1202),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEV+TV+G+DP+A+VPGLMAAGEAACASVHGAN
Sbjct  378  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVITVRGDDPNAIVPGLMAAGEAACASVHGAN  437

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK KPLEKDAG K+I WLD++RNSNGSLPTS 
Sbjct  438  RLGANSLLDIVVFGRACANRVAEIQKPGEKLKPLEKDAGAKSIKWLDRIRNSNGSLPTSK  497

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV DRS+IWNSDLIET+ELEN
Sbjct  498  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVTDRSMIWNSDLIETMELEN  557

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL+NACITM+SAEARKESRGAHAREDFTKRDD  WMKHTLGYWE   V+L+YRPVHMNTL
Sbjct  558  LLVNACITMHSAEARKESRGAHAREDFTKRDDANWMKHTLGYWEEGNVKLEYRPVHMNTL  617

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPK RVY
Sbjct  618  DDEVDTFPPKPRVY  631



>ref|XP_006409150.1| hypothetical protein EUTSA_v10022591mg [Eutrema salsugineum]
 gb|ESQ50603.1| hypothetical protein EUTSA_v10022591mg [Eutrema salsugineum]
Length=634

 Score =   467 bits (1202),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEVVT++ +DPD++VPGLMAAGEAACASVHGAN
Sbjct  381  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVVTIRDDDPDSIVPGLMAAGEAACASVHGAN  440

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK KPLEK AGEK+I WLD++RNSNGSLPTS 
Sbjct  441  RLGANSLLDIVVFGRACANRVAEIQKPGEKLKPLEKAAGEKSIEWLDRIRNSNGSLPTSK  500

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W SF DVKV+DRSLIWNSDL+ET+ELEN
Sbjct  501  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWNSFGDVKVKDRSLIWNSDLVETMELEN  560

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL+N CITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KV+L+YRPVHMNT+
Sbjct  561  LLVNGCITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVKLEYRPVHMNTM  620

Query  64   DDEIETFPPKARVY  23
            DDE+++FPPKARVY
Sbjct  621  DDEVDSFPPKARVY  634



>emb|CDY36482.1| BnaC03g48410D [Brassica napus]
Length=633

 Score =   465 bits (1197),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN+HGEV+TV+G+D D++VPGLMAAGEAA ASVHGAN
Sbjct  380  GVDVTREPIPVLPTVHYNMGGIPTNYHGEVITVRGDDSDSIVPGLMAAGEAASASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQ+PGEK +PLE DAGEK+I WL +LRNSNGSLPTS 
Sbjct  440  RLGANSLLDIVVFGRACANRVAEIQKPGEKLRPLENDAGEKSIEWLHRLRNSNGSLPTSK  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV+D+SLIWNSDL+ET+ELEN
Sbjct  500  IRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVKDKSLIWNSDLVETMELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWE  KV+L+YRPVHMNTL
Sbjct  560  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVKLEYRPVHMNTL  619

Query  64   DDEIETFPPKARVY  23
            DDE++TFPPKARVY
Sbjct  620  DDEVDTFPPKARVY  633



>ref|XP_010113491.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Morus 
notabilis]
 gb|EXC35518.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1 [Morus 
notabilis]
Length=627

 Score =   463 bits (1192),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 234/254 (92%), Gaps = 13/254 (5%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KGND DAVVPGLMAAGE+ACASVHGAN
Sbjct  387  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDSDAVVPGLMAAGESACASVHGAN  446

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGR             EKQKPLEKDAGEKTIAWLDK+RNSNGS+PTSN
Sbjct  447  RLGANSLLDIVVFGR-------------EKQKPLEKDAGEKTIAWLDKIRNSNGSIPTSN  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQ NAAVFRTQETLEEGC+LID A +SFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQTNAAVFRTQETLEEGCQLIDKARKSFHDVKLKDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEARKESRGAHAREDFTKRDDE WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  554  LLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTL  613

Query  64   DDEIETFPPKARVY  23
            DDEIETFPPKARVY
Sbjct  614  DDEIETFPPKARVY  627



>gb|AIZ74343.1| succinate dehydrogenase [Pinus massoniana]
Length=635

 Score =   458 bits (1179),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNH GEVV + G++PDAV+PGL AAGEA+CASVHGAN
Sbjct  382  GVDVTKEPIPVLPTVHYNMGGIPTNHFGEVVNIIGDNPDAVIPGLFAAGEASCASVHGAN  441

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA++ RPGEKQKPL  +AGE+TIAW+DKLRN+NGSLPTS 
Sbjct  442  RLGANSLLDIVVFGRACANRVADLYRPGEKQKPLPGNAGERTIAWMDKLRNANGSLPTSK  501

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC LID  W+SF DVKV DRSLIWNSDLIET+ELEN
Sbjct  502  IRLNMQRVMQNNAAVFRTQETLEEGCTLIDETWKSFGDVKVTDRSLIWNSDLIETIELEN  561

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDFT RDD  WM+HTLGYWEN KVRL YRPVH+NTL
Sbjct  562  LLINASITMHSAEARKESRGAHAREDFTTRDDANWMRHTLGYWENGKVRLAYRPVHLNTL  621

Query  64   DDEIETFPPKARVY  23
            D+E+ETFPPKARVY
Sbjct  622  DEEVETFPPKARVY  635



>gb|KHG24771.1| SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 
1, mitochondrial [Gossypium arboreum]
Length=616

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 230/254 (91%), Gaps = 14/254 (6%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT++GNDPD+VVPGLMAAGEAACASVHGAN
Sbjct  377  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIRGNDPDSVVPGLMAAGEAACASVHGAN  436

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFG              EK KPLEKDA EKT+AWLDKLRNSNGSLPTS 
Sbjct  437  RLGANSLLDIVVFG--------------EKLKPLEKDASEKTVAWLDKLRNSNGSLPTSK  482

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LID   +SFHDVK++DRSLIWNSDLIET+ELEN
Sbjct  483  IRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTLDSFHDVKLKDRSLIWNSDLIETIELEN  542

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL NACITM+SAEARKESRGAHAREDFTKRDD+ WMKHTLGYWENEKVRLDYRPVHMNTL
Sbjct  543  LLTNACITMHSAEARKESRGAHAREDFTKRDDKNWMKHTLGYWENEKVRLDYRPVHMNTL  602

Query  64   DDEIETFPPKARVY  23
            DDEIE+FPPKARVY
Sbjct  603  DDEIESFPPKARVY  616



>gb|EMT18500.1| Succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial 
[Aegilops tauschii]
Length=608

 Score =   451 bits (1161),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/259 (83%), Positives = 235/259 (91%), Gaps = 5/259 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HG+VV +KG++PD ++PGLMAAGEAACASVHGAN
Sbjct  350  GVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVDIKGDNPDTIIPGLMAAGEAACASVHGAN  409

Query  604  RLGANSLLDIVVFGRACANRVA-----EIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGS  440
            RLGANSLLDIVVFGRACANR+       I   G  QKPLEKDAGEKTIAWLDKLRN+NGS
Sbjct  410  RLGANSLLDIVVFGRACANRLILVPWYTIFIIGGTQKPLEKDAGEKTIAWLDKLRNANGS  469

Query  439  LPTSNIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIET  260
            LPTS IRLNMQR+MQNNAAVFRTQETL EGC+LI  A +SFHDVK+ DRSLIWNSDLIET
Sbjct  470  LPTSKIRLNMQRIMQNNAAVFRTQETLTEGCELISEAQKSFHDVKLSDRSLIWNSDLIET  529

Query  259  VELENLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPV  80
            +ELENLLINACITM+SAEAR+ESRGAHAREDF  RDD+KWMKH+LGYWE+EKVRL+YRPV
Sbjct  530  IELENLLINACITMHSAEARQESRGAHAREDFKTRDDDKWMKHSLGYWEDEKVRLEYRPV  589

Query  79   HMNTLDDEIETFPPKARVY  23
            HMNTLDDE+ETFPPKARVY
Sbjct  590  HMNTLDDEVETFPPKARVY  608



>ref|XP_001780340.1| predicted protein [Physcomitrella patens]
 gb|EDQ54899.1| predicted protein [Physcomitrella patens]
Length=631

 Score =   450 bits (1158),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 231/254 (91%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T KG+DPD ++PGLMAAGEAACASVHGAN
Sbjct  378  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTKKGDDPDCMIPGLMAAGEAACASVHGAN  437

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIV+FGRACANRVAE+ +PG+KQ  L KDAGEKTIAWLDKLR +NG +PT+N
Sbjct  438  RLGANSLLDIVIFGRACANRVAEMFKPGQKQPELPKDAGEKTIAWLDKLRYANGDIPTAN  497

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQRVMQNNAAVFRTQETLEEGCKLID   +S   VK  DRSL WN+DLIET+ELEN
Sbjct  498  IRNKMQRVMQNNAAVFRTQETLEEGCKLIDETVDSLSRVKTNDRSLTWNTDLIETIELEN  557

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA +TM+SAEARKESRGAHAREDFT RDDEKWMKHTLGYWEN++VRLDYRPVHMNTL
Sbjct  558  LLINASVTMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENDRVRLDYRPVHMNTL  617

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  618  DDEVETFPPKARVY  631



>ref|XP_001762172.1| predicted protein [Physcomitrella patens]
 gb|EDQ72964.1| predicted protein [Physcomitrella patens]
Length=595

 Score =   445 bits (1144),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT KGNDPD ++PGLMAAGEAACASVHGAN
Sbjct  342  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTKKGNDPDCMIPGLMAAGEAACASVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAE  +PG+ Q  L KDAGEKTIAWLDKLR +NG LPTS 
Sbjct  402  RLGANSLLDIVVFGRACANRVAEKFKPGQSQPELPKDAGEKTIAWLDKLRYANGDLPTSE  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQNNAAVFRTQETLEEGCKLID   +SF  VK+ DRSL WN+DLIET+ELEN
Sbjct  462  IRNRMQRTMQNNAAVFRTQETLEEGCKLIDETVDSFSRVKINDRSLTWNTDLIETIELEN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM+SAEARKESRGAHAREDF+ RDDEKWMKHTLG+W+  +V+LDYRPVHMNTL
Sbjct  522  LLINASITMHSAEARKESRGAHAREDFSVRDDEKWMKHTLGFWDENRVKLDYRPVHMNTL  581

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  582  DDEVETFPPKARVY  595



>ref|XP_002970038.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
 gb|EFJ29162.1| hypothetical protein SELMODRAFT_440964 [Selaginella moellendorffii]
Length=628

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+ GE VT K  DPD ++PGLMAAGEAACASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNYRGEGVTTKDGDPDCLIPGLMAAGEAACASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN +AEI +PG+KQKPL K+AGE TIAWL+KLR +NG LPT++
Sbjct  435  RLGANSLLDIVVFGRACANTMAEIYKPGDKQKPLPKNAGEGTIAWLNKLRYANGDLPTAS  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQRVMQNNAAVFRTQETLEEGCKLI+  W+SF  VK  DRSLIWNSDLIET+ELEN
Sbjct  495  IRLSMQRVMQNNAAVFRTQETLEEGCKLINEIWDSFSRVKTSDRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM SAEARKESRGAHAREDF KRDDE WMKHTLG+WE+ KVRLDYRPVHMNTL
Sbjct  555  LLINAVITMQSAEARKESRGAHAREDFAKRDDENWMKHTLGFWEDGKVRLDYRPVHMNTL  614

Query  64   DDEIETFPPKARVY  23
            D E+E FPPKARVY
Sbjct  615  DKEVEPFPPKARVY  628



>ref|XP_002985229.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
 gb|EFJ13723.1| hypothetical protein SELMODRAFT_446158 [Selaginella moellendorffii]
Length=628

 Score =   440 bits (1131),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+ GE VT K  DPD ++PGLMAAGEAACASVHGAN
Sbjct  375  GVDVTKEPIPVLPTVHYNMGGIPTNYRGEGVTTKDGDPDCLIPGLMAAGEAACASVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN +AEI +PG+KQKPL K+AGE TIAWL+KLR +NG +PT++
Sbjct  435  RLGANSLLDIVVFGRACANTMAEIYKPGDKQKPLPKNAGEGTIAWLNKLRYANGDIPTAS  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQRVMQNNAAVFRTQETLEEGCKLI+  W+SF  VK  DRSLIWNSDLIET+ELEN
Sbjct  495  IRLSMQRVMQNNAAVFRTQETLEEGCKLINEIWDSFSRVKTSDRSLIWNSDLIETIELEN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINA ITM SAEARKESRGAHAREDF KRDDE WMKHTLG+WE+ KVRLDYRPVHMNTL
Sbjct  555  LLINAVITMQSAEARKESRGAHAREDFAKRDDENWMKHTLGFWEDGKVRLDYRPVHMNTL  614

Query  64   DDEIETFPPKARVY  23
            D E+E FPPKARVY
Sbjct  615  DKEVEPFPPKARVY  628



>gb|KEH27558.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit [Medicago 
truncatula]
Length=593

 Score =   433 bits (1113),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTNHHGEVVT+KG+DPDA+VPGLMAAGEAACASVHGAN
Sbjct  373  GVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDALVPGLMAAGEAACASVHGAN  432

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PGEKQKPLEKDAG+KTIAWLDKLRNSNGSLPTS 
Sbjct  433  RLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGQKTIAWLDKLRNSNGSLPTSK  492

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQ+VMQNNAAVFRTQETLEEGC+LID  WESFHDVKVEDRSLIWNSDLIET+ELEN
Sbjct  493  IRLNMQKVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKVEDRSLIWNSDLIETIELEN  552

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLG  122
            LLINAC+TM+SAEARKESRGAHAREDFT RDDEKWMKHTLG
Sbjct  553  LLINACVTMHSAEARKESRGAHAREDFTTRDDEKWMKHTLG  593



>tpg|DAA59498.1| TPA: hypothetical protein ZEAMMB73_792658 [Zea mays]
Length=586

 Score =   421 bits (1083),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PDAVVPGLMAAGEAACASVHGAN
Sbjct  366  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDAVVPGLMAAGEAACASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVA+I +PGEKQKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  RLGANSLLDIVVFGRACANRVADISKPGEKQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQNNAAVFRTQETLEEGC+LI   WESFHDVK+ D+SLIWNSDLIET+ELEN
Sbjct  486  IRLNMQRVMQNNAAVFRTQETLEEGCELISKTWESFHDVKLSDQSLIWNSDLIETLELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLG  122
            LLINACITMYSAEARKESRGAHAREDFT RDDEKWMKH+LG
Sbjct  546  LLINACITMYSAEARKESRGAHAREDFTTRDDEKWMKHSLG  586



>gb|EMT27843.1| Succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial 
[Aegilops tauschii]
Length=742

 Score =   414 bits (1063),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 209/221 (95%), Gaps = 0/221 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +KG++PD V+PGLMAAGEAACASVHGAN
Sbjct  522  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDTVIPGLMAAGEAACASVHGAN  581

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEI +PG+KQKPLEK AGEKTIAWLDKLRN+NGSLPTS 
Sbjct  582  RLGANSLLDIVVFGRACANRVAEISKPGDKQKPLEKGAGEKTIAWLDKLRNANGSLPTSK  641

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLN QR+MQNNAAVFRTQETLEEGC+LI  AWES+HDVK+ D+SLIWNSDLIET+ELEN
Sbjct  642  IRLNTQRIMQNNAAVFRTQETLEEGCQLISKAWESYHDVKISDQSLIWNSDLIETIELEN  701

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLG  122
            LLINACITMYSAEARKESRGAHAREDFT RDDE+WMKH+LG
Sbjct  702  LLINACITMYSAEARKESRGAHAREDFTTRDDERWMKHSLG  742



>gb|EMS46614.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Triticum urartu]
Length=591

 Score =   400 bits (1028),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 211/254 (83%), Gaps = 30/254 (12%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HG+VV +KG++PD ++PGLMAAGEAACASVHG  
Sbjct  368  GVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVDIKGDNPDTIIPGLMAAGEAACASVHG--  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
                                        E QKPLEKDAGEKTIAWLDKLRN+NGSLPTS 
Sbjct  426  ----------------------------ETQKPLEKDAGEKTIAWLDKLRNANGSLPTSK  457

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETL EGC+LI  A +SFHDVK+ DRSLIWNSDLIET+ELEN
Sbjct  458  IRLNMQRIMQNNAAVFRTQETLTEGCELISEAQKSFHDVKLSDRSLIWNSDLIETIELEN  517

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LLINACITM+SAEAR+ESRGAHAREDF  RDD+KWMKH+LGYWE+EKVRL+YRPVHMNTL
Sbjct  518  LLINACITMHSAEARQESRGAHAREDFKTRDDDKWMKHSLGYWEDEKVRLEYRPVHMNTL  577

Query  64   DDEIETFPPKARVY  23
            DDE+ETFPPKARVY
Sbjct  578  DDEVETFPPKARVY  591



>ref|XP_004509253.1| PREDICTED: succinate dehydrogenase [ubiquinone] flavoprotein 
subunit 1, mitochondrial-like isoform X2 [Cicer arietinum]
Length=582

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT KG++PD +VPGLMAAGE ACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTPKGDNPDEIVPGLMAAGETACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAG KTI+WLDKLRNSNGSLPTS 
Sbjct  434  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGMKTISWLDKLRNSNGSLPTSK  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQNNAAVFRTQETLEEGC+LID AWESF DVK+EDRSLIWNSDLIET+ELEN
Sbjct  494  IRLNMQRIMQNNAAVFRTQETLEEGCQLIDGAWESFRDVKLEDRSLIWNSDLIETIELEN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTK  158
            LLINA IT++SAEARKESRGAHAREDFT+
Sbjct  554  LLINASITVHSAEARKESRGAHAREDFTR  582



>ref|XP_005846959.1| hypothetical protein CHLNCDRAFT_56196 [Chlorella variabilis]
 gb|EFN54857.1| hypothetical protein CHLNCDRAFT_56196 [Chlorella variabilis]
Length=558

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/259 (69%), Positives = 213/259 (82%), Gaps = 5/259 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGG+PTN+HGEVV  K  +PDAVVPGLMAAGEAA ASVHGAN
Sbjct  300  GVDVTKEPIPVIPTVHYNMGGVPTNYHGEVVVPKDGNPDAVVPGLMAAGEAASASVHGAN  359

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA RV EI +PG   KPL  DAG++TIA LDKLR++NGS+ T+ 
Sbjct  360  RLGANSLLDIVVFGRACALRVGEILKPGTPHKPLPADAGQETIARLDKLRHANGSMTTAT  419

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQ++MQNNAAVFRTQETL EGC LID    ++ D+K+ DR L+WN+DL+E +ELEN
Sbjct  420  IRRNMQKIMQNNAAVFRTQETLAEGCDLIDECAATYQDIKLADRGLVWNTDLVEALELEN  479

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE-----NEKVRLDYRPV  80
            LL+NA +TM+SAE RKESRGAHAREDFT RDD+ WMKHTLG+++       KV++DYRPV
Sbjct  480  LLMNAAVTMHSAEQRKESRGAHAREDFTARDDKDWMKHTLGWFDWSAPGANKVKIDYRPV  539

Query  79   HMNTLDDEIETFPPKARVY  23
            HM  L  +++  PPKARVY
Sbjct  540  HMQPLTKDMDHIPPKARVY  558



>ref|XP_001689842.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
 gb|EDP09580.1| succinate dehydrogenase subunit A [Chlamydomonas reinhardtii]
Length=635

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 181/256 (71%), Positives = 206/256 (80%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGG+PTN+ GEV+    ++PD VVPGL AAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVLPTVHYNMGGVPTNYMGEVLAPTPDNPDKVVPGLFAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANR+ +I +P    KPL   AGE  +A LDKLRN+ G+L T+ 
Sbjct  440  RLGANSLLDIVVFGRACANRIGQIMKPNTPHKPLPATAGEGAVARLDKLRNAKGNLRTAE  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQ+VMQNNAAVFRTQE+LEEGCKLID    SF DVK  DR L+WN+DLIET+ELEN
Sbjct  500  IRRNMQKVMQNNAAVFRTQESLEEGCKLIDETMASFQDVKTTDRGLVWNTDLIETLELEN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW--ENEKVRLDYRPVHMN  71
            LLINA +TM+SAE RKESRGAHAREDFT+RDD  WMKHTLG+    N+KV + YRPVHM 
Sbjct  560  LLINAAVTMHSAEKRKESRGAHAREDFTQRDDANWMKHTLGFLPSTNDKVNISYRPVHMK  619

Query  70   TLDDEIETFPPKARVY  23
             L +E+   PPK RVY
Sbjct  620  PLSEEMPFIPPKPRVY  635



>ref|XP_011396968.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24082.1| Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Auxenochlorella protothecoides]
Length=621

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/256 (69%), Positives = 208/256 (81%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPV+PTV Y MGG+PTNHHGEVV     +PDAVVPGLMAAGEAA ASVHGAN
Sbjct  366  GVDVTREPIPVIPTVHYNMGGVPTNHHGEVVRPTAANPDAVVPGLMAAGEAASASVHGAN  425

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA RV E  +PG+   PL + AG++ IA LD++RN+ GSLP S+
Sbjct  426  RLGANSLLDIVVFGRACALRVGETVKPGQTHAPLPEGAGDEAIARLDRIRNAKGSLPASS  485

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQRVMQ +AAVFRTQ TLEEGC  ID   +SF D+ V+DRS++WN+D++E +ELEN
Sbjct  486  IRRTMQRVMQRDAAVFRTQSTLEEGCAAIDACVDSFADLGVKDRSMVWNTDMVEALELEN  545

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGY--WENEKVRLDYRPVHMN  71
             LINA ITM+SAEARKESRGAH+REDF +RDD+ WMKHT+ +  W  +KVR+DYRPVH  
Sbjct  546  CLINAAITMHSAEARKESRGAHSREDFKERDDKDWMKHTVAWFDWGKDKVRVDYRPVHDQ  605

Query  70   TLDDEIETFPPKARVY  23
             LDDE+   PPKARVY
Sbjct  606  PLDDEMPHIPPKARVY  621



>ref|XP_002949632.1| succinate dehydrogenase subunit A, mitochondrial [Volvox carteri 
f. nagariensis]
 gb|EFJ49184.1| succinate dehydrogenase subunit A, mitochondrial [Volvox carteri 
f. nagariensis]
Length=641

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/256 (72%), Positives = 205/256 (80%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+ GEV+     +PD VVPGL AAGEAACASVHGAN
Sbjct  386  GVDVTKEPIPVLPTVHYNMGGIPTNYMGEVLAPTKENPDKVVPGLFAAGEAACASVHGAN  445

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACANRV EI +P    KPL   AGE  IA LDKLRN+ G+L T+ 
Sbjct  446  RLGANSLLDIVVFGRACANRVGEIMKPNTPHKPLPASAGEHAIARLDKLRNAKGNLRTAE  505

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQ+VMQNNAAVFRTQETL EGCKLID    SF DVKV DR L+WN+DL+ET+ELEN
Sbjct  506  IRRNMQKVMQNNAAVFRTQETLAEGCKLIDECAASFSDVKVTDRGLVWNTDLVETLELEN  565

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            LL+NA ITM+ AE RKESRGAHAREDFT+RDD KW+KHTLGY  +   KV + YRPVHM 
Sbjct  566  LLLNAAITMHGAEQRKESRGAHAREDFTERDDAKWLKHTLGYMPSVENKVSISYRPVHMQ  625

Query  70   TLDDEIETFPPKARVY  23
             L +E+   PPKARVY
Sbjct  626  PLSEEMPYIPPKARVY  641



>ref|WP_043100651.1| fumarate reductase [Xanthomonadaceae bacterium 3.5X]
 gb|KGI78126.1| fumarate reductase [Xanthomonadaceae bacterium 3.5X]
Length=595

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV  KG+DPDAVVPGL A GEA C SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHKKGDDPDAVVPGLFAIGEAGCVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AEI +PG   K L   A +K ++  DKLR++NG   T++
Sbjct  401  RLGSNSLLDLVVFGRAAAHRCAEIIQPGAAHKDLPSSALDKALSRFDKLRHANGGTATAD  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR+ MQ+ MQ++AAV+RTQETL+EGC  I     SF DV+V DRS++WNSDL+ET+EL N
Sbjct  461  IRMKMQKTMQSDAAVYRTQETLQEGCDKISQVHASFEDVRVSDRSMVWNSDLVETLELSN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TMYSAE RKESRGAHAREDF  RDDE WMKHTL    E  K   D+RPVHMNT
Sbjct  521  LLDQAVATMYSAEQRKESRGAHAREDFPDRDDEHWMKHTLVSVDEKGKPSFDFRPVHMNT  580

Query  67   LDDEIETFPPKARVY  23
            L DE+ET PPK RVY
Sbjct  581  LSDEVETVPPKKRVY  595



>ref|XP_005707862.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
2 [Galdieria sulphuraria]
 gb|EME31342.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
2 [Galdieria sulphuraria]
Length=632

 Score =   357 bits (917),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 210/266 (79%), Gaps = 12/266 (5%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN  G+VVT+K  +P++VVPGL AAGEAACASVHGAN
Sbjct  367  GVDVTKEPIPVLPTVHYNMGGIPTNWKGQVVTIKDGNPNSVVPGLYAAGEAACASVHGAN  426

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA  VA++ RPG+ Q PL +DAGE++IA LD+ R++NGSL TS 
Sbjct  427  RLGANSLLDIVVFGRACARTVADLYRPGQTQPPLPEDAGEESIARLDQYRHANGSLKTSE  486

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQN+A+VFR  + L+EGCK ++  +ES  DVK+ DRS+I+N+DL+ET+ELEN
Sbjct  487  IRLHMQRTMQNHASVFRVSQVLQEGCKAMNECYESLQDVKISDRSMIFNTDLVETLELEN  546

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK-----------VR  98
            LL NA IT+Y AEAR ESRGAH+RED+ KRDD  WMKHTLG+  + K           VR
Sbjct  547  LLQNALITIYGAEARHESRGAHSREDYPKRDDSNWMKHTLGWISSPKQPFIAAGQKSYVR  606

Query  97   LDYRPVHMNTLD-DEIETFPPKARVY  23
            LDYRPV   TLD  E E+FPP  RVY
Sbjct  607  LDYRPVISETLDAAEQESFPPAQRVY  632



>ref|XP_005707863.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
1 [Galdieria sulphuraria]
 gb|EME31343.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit isoform 
1 [Galdieria sulphuraria]
Length=661

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 210/266 (79%), Gaps = 12/266 (5%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN  G+VVT+K  +P++VVPGL AAGEAACASVHGAN
Sbjct  396  GVDVTKEPIPVLPTVHYNMGGIPTNWKGQVVTIKDGNPNSVVPGLYAAGEAACASVHGAN  455

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA  VA++ RPG+ Q PL +DAGE++IA LD+ R++NGSL TS 
Sbjct  456  RLGANSLLDIVVFGRACARTVADLYRPGQTQPPLPEDAGEESIARLDQYRHANGSLKTSE  515

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQN+A+VFR  + L+EGCK ++  +ES  DVK+ DRS+I+N+DL+ET+ELEN
Sbjct  516  IRLHMQRTMQNHASVFRVSQVLQEGCKAMNECYESLQDVKISDRSMIFNTDLVETLELEN  575

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK-----------VR  98
            LL NA IT+Y AEAR ESRGAH+RED+ KRDD  WMKHTLG+  + K           VR
Sbjct  576  LLQNALITIYGAEARHESRGAHSREDYPKRDDSNWMKHTLGWISSPKQPFIAAGQKSYVR  635

Query  97   LDYRPVHMNTLD-DEIETFPPKARVY  23
            LDYRPV   TLD  E E+FPP  RVY
Sbjct  636  LDYRPVISETLDAAEQESFPPAQRVY  661



>ref|XP_005644633.1| succinate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE20089.1| succinate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=606

 Score =   354 bits (908),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 170/259 (66%), Positives = 206/259 (80%), Gaps = 5/259 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN  G+VV    ++PDA+VPGL AAGEAA ASVHGAN
Sbjct  348  GVDVTKEPIPVIPTVHYNMGGIPTNLRGQVVLPTKDNPDAIVPGLYAAGEAASASVHGAN  407

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA  ++E  +PGE Q  L  DAG+ TI+ LDKLR+S G L  + 
Sbjct  408  RLGANSLLDIVVFGRACAITISEEGKPGESQPELAADAGQDTISRLDKLRHSQGPLSVAQ  467

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR N+Q+ MQ +AAVFRTQETLEEGCK +D+  ES +DV ++DRS++WN+DL+E +ELEN
Sbjct  468  IRSNLQKTMQADAAVFRTQETLEEGCKKVDDIVESLNDVGLKDRSMVWNTDLVEAMELEN  527

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE-----NEKVRLDYRPV  80
            LLIN  +T++SAE RKESRGAHAREDFT RDD+ WMKHT+GY++      +KVR+DYRPV
Sbjct  528  LLINGAVTIHSAEQRKESRGAHAREDFTTRDDKHWMKHTVGYFDYKAPGKDKVRIDYRPV  587

Query  79   HMNTLDDEIETFPPKARVY  23
            H   +D E+E  PPKAR Y
Sbjct  588  HDQPMDSEMEHVPPKARTY  606



>ref|XP_003082803.1| succinate dehydrogenase flavoprotein alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL56758.1| Succinate dehydrogenase/fumarate reductase,flavoprotein subunit 
[Ostreococcus tauri]
Length=681

 Score =   354 bits (909),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 199/254 (78%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+ GEVV  K  D DA+VPGLMAAGEAACASVHGAN
Sbjct  428  GVDVTKEPIPVIPTVHYNMGGIPTNYKGEVVAPKNGDMDAIVPGLMAAGEAACASVHGAN  487

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN V+E  +PG   + +  DAG   +  LDK+RNS GS PT+ 
Sbjct  488  RLGANSLLDIVVFGRACANTVSEKLKPGTPHRQIAADAGSNAVERLDKIRNSKGSAPTAM  547

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQ+VMQ++AAVFRTQE+L  GCK ID+      ++K+ DRSL+WN+DL+E +EL N
Sbjct  548  LRRTMQKVMQDDAAVFRTQESLANGCKRIDDVAAQLDNLKLTDRSLVWNTDLVEALELHN  607

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            L+ NA  TM+SAE RKESRGAHAREDF  R D+ WMKHTL Y EN KV++DYRP H  TL
Sbjct  608  LMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDTWMKHTLAYVENGKVKIDYRPNHHYTL  667

Query  64   DDEIETFPPKARVY  23
            DDE+E  PPKARVY
Sbjct  668  DDEMEVIPPKARVY  681



>ref|WP_028770211.1| fumarate reductase [Silanimonas lenta]
Length=597

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/256 (67%), Positives = 204/256 (80%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGG+ TN+HGEVVT+K  DPDAVVPGL A GEAAC SVHGAN
Sbjct  343  GVDVTKQPIPVLPTVHYNMGGLQTNYHGEVVTLKDGDPDAVVPGLYAIGEAACVSVHGAN  402

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  RPG+  K L  DA +K++A LD+LR++ GS PT+ 
Sbjct  403  RLGSNSLLDLVVFGRAVANRCAETIRPGQPHKRLASDALDKSLANLDRLRHAKGSTPTAE  462

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR+MQN+AAVFRT E+L+ G K I  A  SF DV+V DRSL+WNSDLIET+EL+N
Sbjct  463  IRLNMQRIMQNDAAVFRTGESLQAGVKKIREAHASFADVRVSDRSLVWNSDLIETLELQN  522

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--VRLDYRPVHMN  71
            LL  A +TM SAE RKESRGAHARED+ +R+D +WMKHTL  W +EK   R+DYRPVH+ 
Sbjct  523  LLAQAVVTMVSAENRKESRGAHAREDYPERNDAEWMKHTL-CWIDEKGETRIDYRPVHLY  581

Query  70   TLDDEIETFPPKARVY  23
            T  D ++  PPKAR Y
Sbjct  582  TQTDAVQPIPPKARKY  597



>ref|XP_001422453.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00770.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=633

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/254 (67%), Positives = 197/254 (78%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+ GEVV  K  DPDA+VPGL+AAGEAACASVHGAN
Sbjct  380  GVDVTKEPIPVIPTVHYNMGGIPTNYKGEVVAPKNGDPDAIVPGLLAAGEAACASVHGAN  439

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN VA+  + G   + +  DAG   I  LDK+RNS GS PT+ 
Sbjct  440  RLGANSLLDIVVFGRACANTVADKLKRGAPHREIASDAGSNAIERLDKIRNSKGSAPTAM  499

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQ+VMQ +AAVFRTQETL  GCK ID+      ++K+ DRSL+WN+DL+E +EL N
Sbjct  500  LRKTMQKVMQEDAAVFRTQETLANGCKRIDDVAAQLDNLKLTDRSLVWNTDLVEALELHN  559

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            L+ NA  TM+SAE RKESRGAHAREDF  R D+ WMKHTL Y EN KV++DYRP H  TL
Sbjct  560  LMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDVWMKHTLAYVENGKVKIDYRPNHHYTL  619

Query  64   DDEIETFPPKARVY  23
            D E++  PPKARVY
Sbjct  620  DAEMDVIPPKARVY  633



>ref|XP_005711554.1| succinate dehydrogenase (Complex II) flavoprotein subunit precursor 
[Chondrus crispus]
 emb|CDF41260.1| succinate dehydrogenase (Complex II) flavoprotein subunit precursor 
[Chondrus crispus]
Length=636

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 204/263 (78%), Gaps = 9/263 (3%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN  GEVVTVK  DP+ VVPGL AAGEAACASVHGAN
Sbjct  374  GVDVTKEPIPVLPTVHYNMGGIPTNWRGEVVTVKDGDPNYVVPGLFAAGEAACASVHGAN  433

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRA A R  EI +P    +PL K AGE+ IA +DK+R ++G + TS 
Sbjct  434  RLGANSLLDIVVFGRATAMRCGEIIKPDTPVRPLPKGAGEEAIADMDKVRYADGEIRTSA  493

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR +MQ++MQ+NAAVFRTQE+L +GCKLID  +ESF  VK+ DR +IWN+D++ET+EL N
Sbjct  494  IREDMQKIMQDNAAVFRTQESLSQGCKLIDECYESFGKVKITDRDMIWNTDMVETLELRN  553

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--------VRLDY  89
            LL NA ITM+ AEARKESRGAHAREDFT+RDDE WMKHTLG+  + +          +DY
Sbjct  554  LLQNAVITMHGAEARKESRGAHAREDFTERDDEVWMKHTLGWVSSHEEKKNSRGFAHIDY  613

Query  88   RPVHMNTLDD-EIETFPPKARVY  23
            RPV   +LDD E E FPP  RVY
Sbjct  614  RPVVSKSLDDSEQEAFPPAKRVY  636



>ref|WP_027071780.1| fumarate reductase [Luteimonas sp. J29]
Length=596

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 201/255 (79%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT++PIPV+PTV Y MGGIPTN+HGEVV +K  +PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTRQPIPVIPTVHYNMGGIPTNYHGEVVQLKDGNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  RPG+  K L  DA +K+++ LD+LRN++G  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIRPGQPHKRLAGDALDKSLSNLDRLRNASGDTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ++AAVFRTQETLEEG + I    ESF DV+V DRSL+WNSDL+ET+EL+N
Sbjct  462  IRDRMQRSMQSHAAVFRTQETLEEGVRQIREIRESFADVRVSDRSLVWNSDLVETLELQN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW-ENEKVRLDYRPVHMNT  68
            LL  A +T+ SAE RKESRGAHAREDF  RDD  W KHTL +  E    R+DYRPVHM T
Sbjct  522  LLGQALVTIVSAENRKESRGAHAREDFPDRDDGNWQKHTLCWLDEAGNTRIDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            LDDE+E  PP ARVY
Sbjct  582  LDDEVEVVPPVARVY  596



>ref|WP_007508942.1| MULTISPECIES: succinate dehydrogenase [Rhodanobacter]
 gb|EIM03811.1| succinate dehydrogenase flavoprotein subunit [Rhodanobacter denitrificans]
Length=595

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIP+LPTV Y MGGIPTN+HGEVV  KG+D DAVVPGL A GEAAC SVHG N
Sbjct  341  GVDVTKEPIPILPTVHYNMGGIPTNYHGEVVQKKGDDVDAVVPGLFAIGEAACVSVHGGN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+ +PG   K L   A +K +A  D LR++ G LPT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVAHRCAELIQPGAAHKDLPASALDKALARFDGLRHAGGELPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQ +AAVFRT ETL+EGC  ID   +SF  VKV DRSL+WNSDLIET+EL N
Sbjct  461  IRLDMQRTMQADAAVFRTGETLKEGCTKIDKVRDSFKQVKVTDRSLVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SAE R ESRGAHAREDF +R+D +WMKHTL    EN K   DYRPVHM T
Sbjct  521  LLDQAVGTMHSAEQRPESRGAHAREDFPERNDAEWMKHTLVKVDENGKTSFDYRPVHMFT  580

Query  67   LDDEIETFPPKARVY  23
            L DE+E  PPK RVY
Sbjct  581  LSDEVEVVPPKKRVY  595



>ref|WP_006889695.1| succinate dehydrogenase [Methylobacter tundripaludum]
 gb|EGW21719.1| succinate dehydrogenase, flavoprotein subunit [Methylobacter 
tundripaludum SV96]
Length=594

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 201/253 (79%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VD+TKEPIPVLPTV Y MGGIPTN+  EVVT++G+DPDAVVPGLMA GEAAC SVHGANR
Sbjct  342  VDITKEPIPVLPTVHYNMGGIPTNYKAEVVTLRGDDPDAVVPGLMAIGEAACVSVHGANR  401

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LG+NSLLD+VVFGR+ A R AE+ +PG +QKPL  +A +K IA  DK+RN+NGS  TS+I
Sbjct  402  LGSNSLLDLVVFGRSAAIRCAELIKPGSRQKPLASNACDKAIARFDKIRNANGSRSTSDI  461

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RL+MQ+VMQ  AAVFRT  TL EG   +    ++F DVKV D+SLIWN+DL+ET+EL+NL
Sbjct  462  RLDMQKVMQAKAAVFRTGTTLTEGVNAMAEVRKTFADVKVVDKSLIWNTDLVETLELDNL  521

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            L  A + + +A  R ESRG HAREDF KRDDE W+KHTL + + ++V++DYRPVHM TL 
Sbjct  522  LSQATVAINAAGNRTESRGGHAREDFPKRDDENWLKHTLTWLDGDQVKIDYRPVHMYTLT  581

Query  61   DEIETFPPKARVY  23
            DE++  PPK RVY
Sbjct  582  DEVDVIPPKERVY  594



>ref|WP_004153153.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia]
 emb|CCP16042.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia RA8]
Length=596

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAV+PGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKDGDNPDAVIPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLASDACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_008268193.1| succinate dehydrogenase [Stenotrophomonas sp. SKA14]
 gb|EED40833.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas 
sp. SKA14]
Length=596

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLASDACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_012510712.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
 gb|ACF51242.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas 
maltophilia R551-3]
Length=596

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAV+PGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKDGDNPDAVIPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLAADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_015448068.1| succinate dehydrogenase [Rhodanobacter denitrificans]
 gb|AGG89471.1| succinate dehydrogenase, flavoprotein subunit [Rhodanobacter 
denitrificans]
Length=595

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIP+LPTV Y MGGIPTN+HGEVV  KG+D DAVVPGL A GEAAC SVHG N
Sbjct  341  GVDVTKEPIPILPTVHYNMGGIPTNYHGEVVQKKGDDVDAVVPGLFAIGEAACVSVHGGN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+ +PG   K L   A +K +A  D LR++ G LPT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVAHRCAELIQPGAAHKDLPASALDKALARFDGLRHAGGELPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQ +AAVFRT ETL+EGC  ID   +SF  VKV DRSL+WNSDLIET+EL N
Sbjct  461  IRLDMQRTMQVDAAVFRTGETLKEGCTKIDKVRDSFKQVKVTDRSLVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SAE R ESRGAHAREDF +R+D +WMKHTL    EN K   DYRPVHM T
Sbjct  521  LLDQAVGTMHSAEQRPESRGAHAREDFPERNDAEWMKHTLVKVDENGKTSFDYRPVHMFT  580

Query  67   LDDEIETFPPKARVY  23
            L DE+E  PPK RVY
Sbjct  581  LSDEVEVVPPKKRVY  595



>ref|XP_005539527.1| succinate dehydrogenase flavoprotein subunit precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM83491.1| succinate dehydrogenase flavoprotein subunit precursor [Cyanidioschyzon 
merolae strain 10D]
Length=691

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 206/263 (78%), Gaps = 9/263 (3%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN  GEV+    +DPDAVVPGL+AAGEAACASVHGAN
Sbjct  429  GVDVTKEPIPVLPTVHYNMGGIPTNWRGEVLRPTASDPDAVVPGLLAAGEAACASVHGAN  488

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA+ VAE  RPG   KPL  +AGE  IA LD+  ++NGS+ T++
Sbjct  489  RLGANSLLDIVVFGRACAHAVAEQVRPGMPHKPLPANAGEDAIANLDRFLHANGSIKTAD  548

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ++MQN+AAVFR ++TLEEGCKLID  +   ++V++ DRSLIWN+DLIET+EL+N
Sbjct  549  LRLRMQKIMQNHAAVFRAKDTLEEGCKLIDECYSDLNEVRIADRSLIWNTDLIETLELQN  608

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--------VRLDY  89
            LL NA  TM+SAE RKESRGAHAR+DF KRDDE WMKHTL +   +         VR+ Y
Sbjct  609  LLQNAVATMHSAEQRKESRGAHARDDFPKRDDEHWMKHTLAWVHAQDALPANASPVRIGY  668

Query  88   RPVHMNTLDDEIET-FPPKARVY  23
            RPVH  +LD+  +T FPP  RVY
Sbjct  669  RPVHDWSLDESEQTPFPPAQRVY  691



>emb|CCP11050.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia SKK35]
Length=596

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>dbj|GAN44243.1| fumarate reductase [Mizugakiibacter sediminis]
Length=595

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 197/256 (77%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +K  +PDAVVPGL A GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVQLKDGNPDAVVPGLFAVGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE+ +PG   K L     +K +   D +R++NGS PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVANRCAEVIKPGAPHKDLPASVLDKALGRFDAIRHANGSTPTAE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQR MQ +AAVFRT E+L+EGC+ I     SF DV++ DRSL+WNSDL+ET+EL+N
Sbjct  461  IRLNMQRTMQRDAAVFRTGESLKEGCRKIAEVRASFADVRISDRSLVWNSDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--VRLDYRPVHMN  71
            LL  A  TM+SAE R ESRGAHAREDF +RDDE WMKHTL  W ++K  VR  YRPVH  
Sbjct  521  LLGQAVATMFSAEQRTESRGAHAREDFPERDDENWMKHTL-CWVDDKSNVRFGYRPVHDY  579

Query  70   TLDDEIETFPPKARVY  23
            TL DE++  PPK RVY
Sbjct  580  TLTDEVKPIPPKKRVY  595



>ref|WP_027491859.1| fumarate reductase [Rhodanobacter sp. OR444]
Length=595

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIP+LPTV Y MGGIPTN+HGEVV  KG+D DAVVPGL A GEAAC SVHG N
Sbjct  341  GVDVTREPIPILPTVHYNMGGIPTNYHGEVVQKKGDDIDAVVPGLFAIGEAACVSVHGGN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+ +PG   K L   A +K +A  D LR++NG LPT+ 
Sbjct  401  RLGSNSLLDLVVFGRAAAHRCAELIQPGAAHKDLPASALDKALARFDGLRHANGELPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQ +AAVFRT ETL+EGC  ID   +SF  VKV DRS++WNSDLIET+EL N
Sbjct  461  IRLDMQRTMQADAAVFRTGETLKEGCTKIDKVHDSFKQVKVSDRSMVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SAE R ESRGAHAREDF +R+D +WMKHTL    E  K   DYRPVHM T
Sbjct  521  LLDQAVATMHSAEQRPESRGAHAREDFPERNDAEWMKHTLVKVDERGKTSFDYRPVHMFT  580

Query  67   LDDEIETFPPKARVY  23
            L DE+E  PPK RVY
Sbjct  581  LTDEVEVVPPKKRVY  595



>ref|WP_024890019.1| fumarate reductase [Luteimonas huabeiensis]
Length=596

 Score =   344 bits (883),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV +K  DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVEKQPIPVIPTVHYNMGGIPTNYHGEVVQLKNGDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P  + KPL  DA +K +A LDKLRN+NGS PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPNARHKPLPADACDKALANLDKLRNANGSTPTAA  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL EG + I     SF DV+V DRSL+WNSDLIET+EL+N
Sbjct  462  IRDRMQRTMQADAAVFRTSKTLAEGVEKIREIHASFADVRVSDRSLVWNSDLIETLELQN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGY-WENEKVRLDYRPVHMNT  68
            LL  A  T+ SAE RKESRGAHA EDF  RDD  W KHTL +  EN +  +DYRPVHM T
Sbjct  522  LLGQALATIVSAENRKESRGAHAHEDFPDRDDVNWHKHTLCWVGENGETTIDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            LDDE+E  PPKARVY
Sbjct  582  LDDEVEVVPPKARVY  596



>ref|WP_032128866.1| fumarate reductase [Stenotrophomonas maltophilia]
 gb|KGM23634.1| fumarate reductase [Stenotrophomonas maltophilia]
Length=596

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAV+PGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKDGDNPDAVIPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLASDACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_008434627.1| succinate dehydrogenase [Rhodanobacter thiooxydans]
 gb|EIM01299.1| succinate dehydrogenase flavoprotein subunit [Rhodanobacter thiooxydans 
LCS2]
Length=595

 Score =   344 bits (882),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIP+LPTV Y MGGIPTN+HGEVV  KG+D DAVVPGL A GEAAC SVHG N
Sbjct  341  GVDVTREPIPILPTVHYNMGGIPTNYHGEVVQKKGDDVDAVVPGLFAIGEAACVSVHGGN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+ +PG   K L   A ++ +A  D LR++NG LPT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVAHRCAELIQPGAAHKDLPASALDQALARFDGLRHANGELPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQ +AAVFRT ETL+EGC  ID   +SF  VKV DRS++WNSDLIET+EL N
Sbjct  461  IRLDMQRTMQADAAVFRTGETLKEGCTKIDKVHDSFKQVKVSDRSMVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SAE R ESRGAHAREDF +R+D +WMKHTL    E+ K   DYRPVHM T
Sbjct  521  LLDQAVATMHSAEQRPESRGAHAREDFPERNDAEWMKHTLVKVDEHGKTSFDYRPVHMFT  580

Query  67   LDDEIETFPPKARVY  23
            L DE+E  PPK RVY
Sbjct  581  LTDEVEVVPPKKRVY  595



>ref|WP_031432226.1| fumarate reductase [Methylomarinum vadi]
Length=594

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 200/254 (79%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIP+LPTV Y MGGIPTN+  EVV  K  DPDAVVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPILPTVHYNMGGIPTNYKAEVVCPKNGDPDAVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGR+ A R AE+ +PG   KPL +DA E+ +   DK+R+ NGS PT++
Sbjct  401  RLGSNSLLDLVVFGRSAAIRCAELVKPGMAHKPLPEDACEQALERFDKIRHGNGSRPTAD  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQ+VMQ+ AAVFRT ETL +G + ++   ESF +VKV D+SLIWN+DL+ET+EL+N
Sbjct  461  IRLDMQKVMQSKAAVFRTGETLAKGVEEMNQVAESFAEVKVSDKSLIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL  A +T+ +A  R ESRG HAREDF  RDDE W+KHTL + EN +VR+DYRPVHM TL
Sbjct  521  LLGQASVTLNAAHNRTESRGGHAREDFPYRDDENWLKHTLTWRENGQVRIDYRPVHMYTL  580

Query  64   DDEIETFPPKARVY  23
             DE++  PPK RVY
Sbjct  581  TDEVDVIPPKERVY  594



>ref|WP_034220123.1| fumarate reductase [Arenimonas donghaensis]
 gb|KFL37802.1| succinate dehydrogenase [Arenimonas donghaensis DSM 18148 = HO3-R19]
Length=596

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGG+ TN+HGEVVT++  +PD VVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGLQTNYHGEVVTLRDGNPDTVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   K L   A EK++A LDKLRN++G  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGAPHKSLAASACEKSLANLDKLRNASGGTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQ+VMQNNAAVFRT +TL EG   I     SF DV+V DRSLIWNSDLIET+EL+N
Sbjct  462  IRDNMQQVMQNNAAVFRTGDTLREGVSKISEVHASFADVRVSDRSLIWNSDLIETLELQN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL  A  TM SAE RKESRGAHAREDF++RDD+ W KHTL + ++  + RLDYRPVHM T
Sbjct  522  LLGQAVATMVSAENRKESRGAHAREDFSERDDDNWHKHTLCWVDDAGQTRLDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPKAR Y
Sbjct  582  LSKDVDVVPPKARTY  596



>ref|WP_042614012.1| fumarate reductase [Stenotrophomonas maltophilia]
 gb|KIP85903.1| fumarate reductase [Stenotrophomonas maltophilia]
Length=596

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN HGEVV + G++PDAV+PGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNFHGEVVRIDGDNPDAVIPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR + G  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGATHKPLPADACDKALGLLDKLRYAKGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ +AAVFRT +TL+EGC+ +   ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQADAAVFRTSQTLKEGCEKMAGIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWHKHTLVKVDDKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L DE++  PPK RVY
Sbjct  582  LTDEVDVVPPKPRVY  596



>ref|WP_024958618.1| fumarate reductase [Stenotrophomonas maltophilia]
 gb|AIL09050.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas 
maltophilia]
Length=596

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/254 (66%), Positives = 192/254 (76%), Gaps = 1/254 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAVVPGL A GEAAC SVHGANR
Sbjct  343  VDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGANR  402

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS I
Sbjct  403  LGSNSLLDLVVFGRAVANRCAETIKPGASHKPLPADACDKALGLLDKLRHANGDTPTSVI  462

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            R  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL NL
Sbjct  463  RDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNNL  522

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNTL  65
            L+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM TL
Sbjct  523  LLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYTL  582

Query  64   DDEIETFPPKARVY  23
             D++   PPK RVY
Sbjct  583  TDDVSVVPPKPRVY  596



>ref|WP_024868052.1| fumarate reductase [Pseudoxanthomonas suwonensis]
Length=597

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPV+PTV Y MGGIPTN+HGEVV   G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  R G   KPL  DA EK ++ LDKLRN+NG  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIRKGAPHKPLASDACEKALSQLDKLRNANGGTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ + + + SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSKTLKEGCEKMADIFASFEDVKVSDRSLVWNSDLIETYELHN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL+NA  T+ SAE RKESRGAHA ED+ +RDD  W KHTL   + +  K   DYRPVHM 
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPERDDANWQKHTLVTVDAQTGKTSFDYRPVHMY  581

Query  70   TLDDEIETFPPKARVY  23
            TL  +++  PPK RVY
Sbjct  582  TLSKDVDVVPPKPRVY  597



>ref|WP_028919050.1| fumarate reductase [Pseudoxanthomonas suwonensis]
Length=597

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPV+PTV Y MGGIPTN+HGEVV   G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  R G   KPL  DA EK ++ LDKLRN+NG  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIRKGAPHKPLASDACEKALSQLDKLRNANGGTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ + + + SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSKTLKEGCEKMADIFASFEDVKVSDRSLVWNSDLIETYELHN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL+NA  T+ SAE RKESRGAHA ED+ +RDD  W KHTL   + +  K   DYRPVHM 
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPERDDANWQKHTLVTVDAQTGKTSFDYRPVHMY  581

Query  70   TLDDEIETFPPKARVY  23
            TL  +++  PPK RVY
Sbjct  582  TLSKDVDVVPPKPRVY  597



>ref|WP_018718364.1| succinate dehydrogenase [Arhodomonas aquaeolei]
Length=597

 Score =   342 bits (876),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 196/256 (77%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+ GEVV  +  DPDAVVPGLMA GEA C SVHGAN
Sbjct  342  GVDVTKEPIPVLPTVHYNMGGIPTNYRGEVVAPRDGDPDAVVPGLMAIGEAGCVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAE-IQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTS  428
            RLG+NSLLD+VVFGR+ A R AE +   G   +PL  D+ E  +A LD+LRN+NGS PT+
Sbjct  402  RLGSNSLLDLVVFGRSAAIRAAELVDEAGANHRPLPADSAEPALARLDRLRNANGSEPTA  461

Query  427  NIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELE  248
             IR  MQR MQN AAVFRT ETLEEGCK I+  + SF +V V DRSLIWN+DL+ET+ELE
Sbjct  462  RIRDRMQRTMQNYAAVFRTGETLEEGCKRIEEIYASFENVSVSDRSLIWNTDLVETMELE  521

Query  247  NLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMN  71
            NLL NA  ++ SA  R ESRGAHARED ++RDDE WMKHT+ + +    V +DYRPVHMN
Sbjct  522  NLLANAVTSVQSARNRTESRGAHAREDHSERDDENWMKHTVTWMDRSGNVTIDYRPVHMN  581

Query  70   TLDDEIETFPPKARVY  23
            TL DE+E  PPK RVY
Sbjct  582  TLTDEMEVIPPKKRVY  597



>gb|ESA13975.1| hypothetical protein GLOINDRAFT_346712 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX63398.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
Length=535

 Score =   339 bits (870),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 170/258 (66%), Positives = 203/258 (79%), Gaps = 5/258 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GV+VTKEPIPVLPTV Y MGGIPT + GEV+T+     D +VPGL AAGEAAC SVHGAN
Sbjct  279  GVNVTKEPIPVLPTVHYNMGGIPTRYTGEVLTIDEKGNDKLVPGLYAAGEAACVSVHGAN  338

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA+ + +   PG   KPL  DAG ++IA LDKLRN++GS  T+ 
Sbjct  339  RLGANSLLDIVVFGRACAHHIKDTLEPGMPHKPLSSDAGAESIANLDKLRNASGSKRTAE  398

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQ+ MQ +AAVFRTQE+L+EG K ID  ++SF DV VEDRS+IWNSDLIET+EL+N
Sbjct  399  IRLNMQKAMQRDAAVFRTQESLDEGVKNIDKIFKSFEDVNVEDRSMIWNSDLIETLELQN  458

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK---VRLDYRPVHM  74
            LL NA  TM++A  RKESRGAHARED+  R+DE+WMKHTL  W+++    V+L YRPV  
Sbjct  459  LLTNAAQTMHAAAVRKESRGAHAREDYQTRNDEEWMKHTLS-WQDQNTGMVKLRYRPVTS  517

Query  73   NTLDD-EIETFPPKARVY  23
             TLD+ EI + PPKARVY
Sbjct  518  KTLDETEIASIPPKARVY  535



>ref|WP_017461216.1| succinate dehydrogenase [Dyella ginsengisoli]
Length=595

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV +K  +PD VVPGL A GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVQLKDGNPDLVVPGLFAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE+ +PG   K L   A +K +   D LRN+NGS PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVANRCAEVIKPGAAHKDLPASALDKALTRFDGLRNANGSTPTAK  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ++AAVFRT +TL++G + I   ++SF DVKV DRSL+WNSDLIET+EL N
Sbjct  461  IRAEMQRTMQSDAAVFRTGDTLKDGKRKISEVYDSFKDVKVSDRSLVWNSDLIETLELSN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SAE R ESRGAHAREDF  R+DE+WMKHTL    E  K   ++RPVHM T
Sbjct  521  LLAQAVATMHSAEQRPESRGAHAREDFPDRNDEQWMKHTLVKVDEAGKTSFEFRPVHMYT  580

Query  67   LDDEIETFPPKARVY  23
            + DE+E  PPK RVY
Sbjct  581  MTDEVEVVPPKKRVY  595



>ref|WP_018183055.1| succinate dehydrogenase [Kaistia granuli]
Length=606

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 200/256 (78%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVD+TKEPIPVLPTV Y MGGIPTN+HGEV+   G DPD +VPGLMA GEAAC SVHGAN
Sbjct  351  GVDLTKEPIPVLPTVHYNMGGIPTNYHGEVLNKVGGDPDQIVPGLMAVGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL D+VVFGRA A R  E  +P + QK L K AGE ++A LD+LR ++GS  T+ 
Sbjct  411  RLGSNSLTDLVVFGRAAALRCVETVQPNQAQKELAKGAGENSVARLDRLRYASGSTSTAE  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RLNMQ+VMQ+N AVFRT E L+EG +LI   W+   D+KV DRSLIWNSDL+ET+E EN
Sbjct  471  MRLNMQKVMQSNCAVFRTGEVLDEGHELIHQVWKGSDDIKVTDRSLIWNSDLVETLEFEN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW--ENEKVRLDYRPVHMN  71
            L++ A +TM SA+ARKESRGAHARED+++RDD  WMKH+L Y   +N+ V+LD RPVH  
Sbjct  531  LIVQAVVTMDSAQARKESRGAHAREDYSERDDVNWMKHSLAYIDADNKTVKLDDRPVHTY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I+   PKARVY
Sbjct  591  TMSNDIQYIEPKARVY  606



>ref|WP_010484342.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
Length=596

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLASDACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>gb|KDO21309.1| succinate dehydrogenase flavoprotein subunit [Saprolegnia parasitica 
CBS 223.65]
Length=632

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 201/265 (76%), Gaps = 11/265 (4%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGND--------PDAVVPGLMAAGEAA  629
            GVDVTKEPIPVLPTV Y MGGIPTNH GEVV              PD VV GL AAGEAA
Sbjct  368  GVDVTKEPIPVLPTVHYNMGGIPTNHFGEVVIPDTTGLPDANQMYPDKVVKGLFAAGEAA  427

Query  628  CASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNS  449
            CASVHGANRLGANSLLDIVVFGRACA R+AEI +PGE ++P+  +AGE +++ +D LR +
Sbjct  428  CASVHGANRLGANSLLDIVVFGRACALRIAEISKPGEAKRPMPANAGEASLSMVDSLRYA  487

Query  448  NGSLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDL  269
            NG++PT+++RL MQ+ MQN+AAV+RTQETL EG + ID     F D+KV DRSLIWN+DL
Sbjct  488  NGAIPTADLRLEMQKTMQNDAAVYRTQETLAEGVQKIDKIVPKFKDIKVTDRSLIWNTDL  547

Query  268  IETVELENLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--VRL  95
            IET+EL+NLL  A  TM+ AEARKESRGAHAREDF+ RDD  WMKHTL Y   E+    +
Sbjct  548  IETIELKNLLACASATMHGAEARKESRGAHAREDFSTRDDVNWMKHTLAYHNTEEGTTHI  607

Query  94   DYRPVHMNTLD-DEIETFPPKARVY  23
             YRPVH +TLD +E +T  P ARVY
Sbjct  608  AYRPVHYHTLDEEECKTVAPVARVY  632



>ref|WP_019338331.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
Length=596

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_019466021.1| succinate dehydrogenase [Dyella japonica]
 gb|AIF47700.1| fumarate reductase [Dyella japonica A8]
Length=595

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEVV  +G++ DAVVPGL A GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVIPTVHYNMGGIPTNYHGEVVQKQGDNVDAVVPGLFAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AEI  PG  QK L     +K +A  D LRN+ GS PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVANRCAEIVTPGGAQKDLPASVLDKALARFDGLRNAKGSQPTAK  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ++AAVFRT E+L+EGC+ I    ESF DV V DRSL+WNSDLIET+EL N
Sbjct  461  IRAEMQRTMQSDAAVFRTGESLQEGCEKISKVRESFKDVGVSDRSLVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TMYSA  R+ESRGAHAREDF +RDD  W KHTL    EN K   D+RPVHM T
Sbjct  521  LLDQAVATMYSAAQREESRGAHAREDFPERDDHNWQKHTLVAVDENGKASFDFRPVHMYT  580

Query  67   LDDEIETFPPKARVY  23
            +  ++E  PPK RVY
Sbjct  581  MTSDVEVVPPKKRVY  595



>ref|WP_033830834.1| fumarate reductase [Stenotrophomonas maltophilia]
 gb|EVT72086.1| succinate dehydrogenase [Stenotrophomonas maltophilia 5BA-I-2]
Length=596

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 190/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G +PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKDGENPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR A    PG   K L  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAATITPGAAHKTLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD+ W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPNRDDDNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>gb|EXX63396.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
 gb|EXX63397.1| succinate dehydrogenase flavoprotein subunit SDH1 [Rhizophagus 
irregularis DAOM 197198w]
Length=645

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/258 (66%), Positives = 203/258 (79%), Gaps = 5/258 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GV+VTKEPIPVLPTV Y MGGIPT + GEV+T+     D +VPGL AAGEAAC SVHGAN
Sbjct  389  GVNVTKEPIPVLPTVHYNMGGIPTRYTGEVLTIDEKGNDKLVPGLYAAGEAACVSVHGAN  448

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACA+ + +   PG   KPL  DAG ++IA LDKLRN++GS  T+ 
Sbjct  449  RLGANSLLDIVVFGRACAHHIKDTLEPGMPHKPLSSDAGAESIANLDKLRNASGSKRTAE  508

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQ+ MQ +AAVFRTQE+L+EG K ID  ++SF DV VEDRS+IWNSDLIET+EL+N
Sbjct  509  IRLNMQKAMQRDAAVFRTQESLDEGVKNIDKIFKSFEDVNVEDRSMIWNSDLIETLELQN  568

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK---VRLDYRPVHM  74
            LL NA  TM++A  RKESRGAHARED+  R+DE+WMKHTL  W+++    V+L YRPV  
Sbjct  569  LLTNAAQTMHAAAVRKESRGAHAREDYQTRNDEEWMKHTLS-WQDQNTGMVKLRYRPVTS  627

Query  73   NTLDD-EIETFPPKARVY  23
             TLD+ EI + PPKARVY
Sbjct  628  KTLDETEIASIPPKARVY  645



>ref|WP_014646765.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
 emb|CCH12280.1| Succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia D457]
 gb|KDE90387.1| fumarate reductase [Stenotrophomonas maltophilia M30]
Length=596

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGAAHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_029074935.1| fumarate reductase [Kaistia adipata]
Length=606

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 198/256 (77%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVD+TKEPIPVLPTV Y MGGIPTN+HGEV+   G DPD +VPGLMA GEAAC SVHGAN
Sbjct  351  GVDLTKEPIPVLPTVHYNMGGIPTNYHGEVLNKVGGDPDQIVPGLMAVGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL D+VVFGRA A R  E  +P + Q+ L K AGE  IA LD+LR +NGS  T+ 
Sbjct  411  RLGSNSLTDLVVFGRAAALRCIETVQPNQAQRELAKGAGEDAIARLDRLRYANGSTSTAE  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL+MQ+VMQ+N AVFRT E L+EG +LI   W+   DVKV DRSLIWNSDL+ET+E EN
Sbjct  471  MRLSMQKVMQSNCAVFRTGEVLDEGHELIHQVWKGSDDVKVTDRSLIWNSDLVETLEFEN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW--ENEKVRLDYRPVHMN  71
            L++ A +TM SA+ RKESRGAHARED+++RDD  WMKH+L +   EN+ VRLD RPVH  
Sbjct  531  LIVQAVVTMDSAQNRKESRGAHAREDYSERDDVNWMKHSLAFIDTENKTVRLDDRPVHTY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ ++IE   PKARVY
Sbjct  591  TMSNDIEYIEPKARVY  606



>ref|WP_039454199.1| fumarate reductase, partial [Xanthomonas vasicola]
 gb|KGR48991.1| fumarate reductase, partial [Xanthomonas vasicola]
Length=466

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  212  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  271

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  272  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  331

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  332  IRDNMQRTMQSDAAVFRTSKTLKEGVNKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  391

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  392  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  451

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  452  LSKDVDVVPPKPRVY  466



>ref|XP_008617967.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Saprolegnia diclina VS20]
 gb|EQC28570.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
[Saprolegnia diclina VS20]
Length=632

 Score =   340 bits (871),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 201/265 (76%), Gaps = 11/265 (4%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGND--------PDAVVPGLMAAGEAA  629
            GVDVTKEPIPVLPTV Y MGGIPTNH GEVV              PD VV GL AAGEAA
Sbjct  368  GVDVTKEPIPVLPTVHYNMGGIPTNHFGEVVVPDTTGLPDANQMYPDKVVKGLFAAGEAA  427

Query  628  CASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNS  449
            CASVHGANRLGANSLLDIVVFGRACA R+AEI +PGE ++P+  +AG+ +++ +D LR +
Sbjct  428  CASVHGANRLGANSLLDIVVFGRACALRIAEISKPGEAKRPMPSNAGDASLSMVDSLRYA  487

Query  448  NGSLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDL  269
            NG++PT+++RL MQ+ MQN+AAV+RTQETL EG + ID     F D+KV DRSLIWN+DL
Sbjct  488  NGAIPTADLRLEMQKTMQNDAAVYRTQETLAEGVEKIDKIVPKFKDIKVTDRSLIWNTDL  547

Query  268  IETVELENLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--VRL  95
            IET+EL+NLL  A  TM+ AEARKESRGAHAREDF+ RDD  WMKHTL Y   E+    +
Sbjct  548  IETIELKNLLACASATMHGAEARKESRGAHAREDFSTRDDVNWMKHTLAYHNTEEGTTHI  607

Query  94   DYRPVHMNTLD-DEIETFPPKARVY  23
             YRPVH +TLD +E +T  P ARVY
Sbjct  608  AYRPVHYHTLDEEECKTVAPVARVY  632



>ref|WP_028917287.1| fumarate reductase [Pseudoxanthomonas sp. J35]
Length=597

 Score =   338 bits (868),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 194/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV KEPIPV+PTV Y MGGIPTN+HGEVV   G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKEPIPVIPTVHYNMGGIPTNYHGEVVRKVGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  R G   KPL  DA +K ++ LD+LRN+NG  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIRKGAPHKPLASDACDKALSQLDRLRNANGGTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ + + + SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSKTLKEGCEKMADIFASFEDVKVSDRSLVWNSDLIETYELHN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL+NA  T+ SAE RKESRGAHA ED+ +RDD  W KHTL   + +  K   DYRPVHM 
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPERDDANWQKHTLVTVDAQTGKTSFDYRPVHMY  581

Query  70   TLDDEIETFPPKARVY  23
            TL  +++  PPK RVY
Sbjct  582  TLSKDVDVVPPKPRVY  597



>ref|XP_005841533.1| hypothetical protein GUITHDRAFT_159138 [Guillardia theta CCMP2712]
 gb|EKX54553.1| hypothetical protein GUITHDRAFT_159138 [Guillardia theta CCMP2712]
Length=608

 Score =   338 bits (868),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPV PTV Y MGGIPTN +G+VVT KGND  ++VPGL AAGE  CASVHGAN
Sbjct  354  GVDVTKQPIPVCPTVHYNMGGIPTNQYGQVVTKKGNDNSSIVPGLYAAGECGCASVHGAN  413

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRA A  V+E  +PGEK KPL  +AGE++IA LDKLR SNGSL T+ 
Sbjct  414  RLGANSLLDIVVFGRAAALHVSENSKPGEKHKPLPANAGEQSIANLDKLRYSNGSLKTAE  473

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
             RL +Q+ MQ +AAVFRTQ +LE G K +   ++ F DVK+ DRSLIWN+DLIET+EL+N
Sbjct  474  CRLGLQKTMQRDAAVFRTQTSLENGVKAVTEHYKQFQDVKITDRSLIWNTDLIETLELQN  533

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            +L NA ITMY AEARKESRGAHAREDF +RDD  WMKHT+G+ +++ KV LDYRPV    
Sbjct  534  ILDNAMITMYGAEARKESRGAHAREDFPERDDTNWMKHTVGWIDSKGKVTLDYRPVGTTV  593

Query  67   LDDEIETFPPKARVY  23
             + +    PP  RVY
Sbjct  594  REPDNSPVPPAKRVY  608



>ref|WP_005409078.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
 emb|CAQ45319.1| putative succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia K279a]
 gb|EJP76982.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia Ab55555]
 gb|EMF59005.1| Succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia EPM1]
 gb|KIS38128.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia WJ66]
Length=596

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGASHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_017840176.1| succinate dehydrogenase [Methylomicrobium buryatense]
Length=594

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 195/254 (77%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+  EVVT+K  DPD V+PGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYKAEVVTLKDGDPDKVIPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGR+ A R AE+ +PG   KPL  DA +K +   DKLRN+NGS  TS 
Sbjct  401  RLGSNSLLDLVVFGRSAAIRCAELIKPGTAHKPLANDACDKALERFDKLRNANGSRTTSE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQRVMQ+ AAVFRT  TL EG   +    E+F DV V D+S+IWN+DL+ET+EL+N
Sbjct  461  IRLDMQRVMQSKAAVFRTGSTLAEGLSQLKAIRETFADVSVADKSMIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            L+  A +TM +A  R ESRG HAREDF++RDD  W+KH+L +  + +V++DYRPVH+ TL
Sbjct  521  LMSQAVVTMAAAGNRTESRGGHAREDFSQRDDANWLKHSLLWLNDNEVKIDYRPVHLYTL  580

Query  64   DDEIETFPPKARVY  23
             DE+E  PPK RVY
Sbjct  581  TDEVEAIPPKERVY  594



>ref|XP_003063914.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52287.1| predicted protein [Micromonas pusilla CCMP1545]
Length=640

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 199/256 (78%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGN-DPDAVVPGLMAAGEAACASVHGA  608
            GVDVTKEPIPV+PTV Y MGGIPTN+ GEV+T+  + +PD VVPGL+AAGE A ASVHGA
Sbjct  385  GVDVTKEPIPVIPTVHYNMGGIPTNYKGEVLTIGSDGNPDTVVPGLLAAGECASASVHGA  444

Query  607  NRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTS  428
            NRLGANSLLDIVVFGRACAN V+E  +PG   + L  D GE  IA L+ +R+++G+  T+
Sbjct  445  NRLGANSLLDIVVFGRACANTVSETLKPGMPHRKLASDFGEHAIAHLESVRSASGAHSTA  504

Query  427  NIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELE  248
            ++R  MQRVMQ++AAVFRTQETL EGC  ID       D+ V D+SL+WN+DLIE +EL 
Sbjct  505  SVRKAMQRVMQDDAAVFRTQETLAEGCVKIDEVASRLEDLDVTDKSLVWNTDLIEALELH  564

Query  247  NLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW-ENEKVRLDYRPVHMN  71
            NL+ NA ITM+SAE RKESRGAHAREDF  RDD  WMKHTLG+  E  KV++DYRPVH  
Sbjct  565  NLMPNAQITMHSAEQRKESRGAHAREDFPNRDDVSWMKHTLGFVDEKRKVKIDYRPVHSQ  624

Query  70   TLDDEIETFPPKARVY  23
             LDDE+E  PPKARVY
Sbjct  625  PLDDEMEHVPPKARVY  640



>ref|WP_033833072.1| fumarate reductase [Stenotrophomonas maltophilia]
Length=596

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGAAHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_024297036.1| fumarate reductase [Methylosarcina lacus]
Length=594

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/254 (62%), Positives = 198/254 (78%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIP+LPTV Y MGGIPTN+  EVVT+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPILPTVHYNMGGIPTNYRTEVVTLKDGNPDHVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLDI+VFGR+ A R A++ +PG+  KPL +DA ++ +A  DK+R++ GS  T+ 
Sbjct  401  RLGSNSLLDIIVFGRSAAIRCAQLIKPGDAHKPLRRDAADQALARFDKIRHAQGSRATAE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQ+ MQ  AAVFRTQ TL+EG K +     SF DV ++DRSLIWN+DL+ET+EL+N
Sbjct  461  IRLDMQKTMQTKAAVFRTQSTLDEGIKAMTEIRASFSDVSLKDRSLIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL  A +T+ +A  RKESRG HARED+  RDD  W+KHTL + E  +V++DYRPVH+ TL
Sbjct  521  LLSQAQVTITAAGNRKESRGGHAREDYPGRDDPNWLKHTLTWTEGNQVKIDYRPVHLFTL  580

Query  64   DDEIETFPPKARVY  23
             DE+E FPPK R+Y
Sbjct  581  TDEVEVFPPKERIY  594



>ref|WP_022969875.1| succinate dehydrogenase [Arenimonas oryziterrae]
 gb|KFN42895.1| succinate dehydrogenase [Arenimonas oryziterrae DSM 21050 = YC6267]
Length=597

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 198/256 (77%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGG+ TN+HGEVVT+K  +P+ VVPGL + GEAAC SVHGAN
Sbjct  343  GVDVTKQPIPVLPTVHYNMGGLQTNYHGEVVTLKDGNPNHVVPGLYSIGEAACVSVHGAN  402

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG+  K L   A +K++A LDKLR + G  PT+ 
Sbjct  403  RLGSNSLLDLVVFGRAVANRCAETIKPGQSHKSLPASACDKSLANLDKLRFAKGGTPTAE  462

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR+MQN+AAVFRT ETL++G   I  A++SF DV+V D SL+WNSDLIET+EL+N
Sbjct  463  IRDNMQRIMQNDAAVFRTGETLQQGVTKIRQAYDSFADVRVSDTSLVWNSDLIETLELQN  522

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM SAE RKESRGAHAREDF+KRDD +WMKHTL  W +E  K  +DYRPVH+N
Sbjct  523  LLGQAVATMVSAENRKESRGAHAREDFSKRDDAEWMKHTL-CWVDEQGKTTIDYRPVHLN  581

Query  70   TLDDEIETFPPKARVY  23
             L  ++   PPK R Y
Sbjct  582  VLSSDVSVIPPKERKY  597



>ref|WP_014036803.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
 gb|AEM50913.1| succinate dehydrogenase, flavoprotein subunit [Stenotrophomonas 
maltophilia JV3]
 gb|EQM87596.1| succinate dehydrogenase [Stenotrophomonas maltophilia MF89]
Length=596

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGAAHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_005416133.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia]
 gb|EMI50541.1| succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
maltophilia AU12-09]
Length=596

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ +AVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVQKVGDNDNAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   KPL  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGAAHKPLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_008213919.1| succinate dehydrogenase [Rhodanobacter sp. 115]
 gb|EIL92178.1| succinate dehydrogenase flavoprotein subunit [Rhodanobacter sp. 
115]
Length=595

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIP+LPTV Y MGGIPTN+HGEVV  +G+D DAVVPGL A GEAAC SVHG N
Sbjct  341  GVDVTKEPIPILPTVHYNMGGIPTNYHGEVVQKRGDDVDAVVPGLFAIGEAACVSVHGGN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ++R AE+ +PG   K L   A +K +A  D +R+++G  PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVSHRCAELVKPGAAHKDLPASALDKALARFDAMRHADGDTPTAK  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQ +AAVFRT ETL+EGC  ID    SF  V+V DRS++WNSDLIET+EL N
Sbjct  461  IRLDMQRTMQTDAAVFRTGETLKEGCDKIDAVHASFKHVRVTDRSMVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SAE R ESRGAHAREDF  R+D +WMKHTL    EN K   DYRPVHM+T
Sbjct  521  LLDQAVGTMHSAEQRPESRGAHAREDFPDRNDAEWMKHTLVKVDENGKTSFDYRPVHMHT  580

Query  67   LDDEIETFPPKARVY  23
            L DE++  PPK RVY
Sbjct  581  LTDEVDVVPPKKRVY  595



>ref|WP_025878814.1| MULTISPECIES: fumarate reductase [Stenotrophomonas]
 gb|EZP43249.1| Succinate dehydrogenase flavoprotein subunit [Stenotrophomonas 
sp. RIT309]
Length=596

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G +PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKDGENPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR A    PG   K L  DA +K +  LDKLR++NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAATITPGAAHKTLPADACDKALGLLDKLRHANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +D  ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSQTLKEGCEKMDKIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVSVDEKGKCSFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L D++   PPK RVY
Sbjct  582  LTDDVSVVPPKPRVY  596



>ref|WP_019397705.1| MULTISPECIES: succinate dehydrogenase [Pseudoxanthomonas]
Length=597

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 194/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV KEPIPV+PTV Y MGGIPTN+HGEVV   G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKEPIPVIPTVHYNMGGIPTNYHGEVVRKVGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  + G   KPL  DA +K +A LDKLR++NG  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKKGAPHKPLPSDACDKALAHLDKLRHANGDTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +   ++SF DV+V DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSKTLKEGCEKMAQIYDSFQDVRVSDRSLVWNSDLIETYELHN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL+NA  T+ SAE RKESRGAHA ED+ +RDD  W KHTL   + E  K   DYRPVHM 
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPERDDANWQKHTLVTVDAETGKTSFDYRPVHMY  581

Query  70   TLDDEIETFPPKARVY  23
            TL  +++  PPK RVY
Sbjct  582  TLTKDVDVVPPKPRVY  597



>ref|WP_014149121.1| succinate dehydrogenase [Methylomicrobium alcaliphilum]
 ref|YP_004917940.1| succinate dehydrogenase [Methylomicrobium alcaliphilum 20Z]
 emb|CCE24355.1| succinate dehydrogenase, flavoprotein subunit [Methylomicrobium 
alcaliphilum 20Z]
Length=594

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 195/254 (77%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+  EVVT+K  DPD V+PGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYKAEVVTLKDGDPDKVIPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGR+ A R AE+ +PG   KPL  DA +K +   DKLRN+NGS  TS 
Sbjct  401  RLGSNSLLDLVVFGRSAAIRCAELIKPGTAHKPLANDACDKALERFDKLRNANGSRTTSE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQRVMQ+ AAVFRT  TL EG   +    E+F DV V D+S+IWN+DL+ET+EL+N
Sbjct  461  IRLDMQRVMQSKAAVFRTGSTLAEGLTQLKAIRETFADVNVADKSMIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            L+  A +TM +A  R ESRG HAREDF++RDD  W+KH+L +  + +V++DYRPVH+ TL
Sbjct  521  LMSQAVVTMAAAGNRTESRGGHAREDFSQRDDANWLKHSLLWLNDNEVKIDYRPVHLYTL  580

Query  64   DDEIETFPPKARVY  23
             DE+E  PPK RVY
Sbjct  581  TDEVEAIPPKERVY  594



>ref|WP_005371927.1| MULTISPECIES: succinate dehydrogenase [Methylomicrobium]
 gb|EIC29781.1| succinate dehydrogenase, flavoprotein subunit [Methylomicrobium 
album BG8]
Length=594

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 197/254 (78%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN++ EVVT+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYNTEVVTLKDGNPDHVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLDI+VFGRA A R A++ +PG+  KPL K+A ++ IA  DK+R++ G  PT+ 
Sbjct  401  RLGSNSLLDIIVFGRAAAIRCAQLIKPGDAHKPLRKEAADQAIARFDKIRHAQGGRPTAE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQ  MQ  AAVFRTQ TL+EG K +     SF DV + DRSLIWN+DL+ET+EL+N
Sbjct  461  IRLDMQTTMQAKAAVFRTQSTLDEGIKAMAEIRASFADVSLNDRSLIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL  A +T+ +A  RKESRG HARED+  RDD  W+KHTL +  + +V++DYRPVH+ TL
Sbjct  521  LLSQALVTISAAGNRKESRGGHAREDYPNRDDANWLKHTLTWLPDNQVKIDYRPVHLYTL  580

Query  64   DDEIETFPPKARVY  23
             DE++ FPPK R+Y
Sbjct  581  TDEVDAFPPKERIY  594



>ref|WP_018044518.1| succinate dehydrogenase [Methylobacterium sp. 88A]
Length=606

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 196/256 (77%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  351  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  PG +Q  L KD+ +K +A LD+ R +NG  PT+ 
Sbjct  411  RLGSNSLIDLVVFGRAAGLRCAEIVEPGARQMDLPKDSADKALARLDRFRYANGGTPTAE  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQ+ MQNN AVFRT E LEEG  LI   W+   D+K+ DRSLIWN+DL+ET+E +N
Sbjct  471  LRAEMQKTMQNNCAVFRTGEVLEEGKALIHKVWQGESDIKITDRSLIWNTDLLETLEFDN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            L+  A +TM SA  RKESRGAHAREDF  RDD++WMKHTL + ++  ++V +DYRPVH  
Sbjct  531  LIGQAVVTMESAANRKESRGAHAREDFPDRDDKEWMKHTLSWLDDKSQQVNIDYRPVHTY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ +EI+   PKARVY
Sbjct  591  TMSNEIQYIEPKARVY  606



>ref|WP_038616778.1| fumarate reductase [Dyella jiangningensis]
 gb|AHX12733.1| fumarate reductase [Dyella jiangningensis]
Length=595

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEVV  +G+D DAVVPGL A GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVIPTVHYNMGGIPTNYHGEVVQKRGDDVDAVVPGLFAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AEI  PG   K L     +K +A  D LRN+ GS PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVANRCAEIVTPGAPHKDLPASVLDKALARFDGLRNAKGSQPTAK  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ++AAVFRT E+L+EGC+ I    ESF DV V DRSL+WNSDLIET+EL N
Sbjct  461  IRAEMQRTMQSDAAVFRTGESLKEGCEKISKVRESFKDVGVSDRSLVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TMYSA  R+ESRGAHAREDF  RDD  W KHTL    E+ K   D+RPVHM T
Sbjct  521  LLDQAVATMYSAAQREESRGAHAREDFPDRDDHNWQKHTLVAVDESGKASFDFRPVHMYT  580

Query  67   LDDEIETFPPKARVY  23
            +  ++E  PPK RVY
Sbjct  581  MTSDVEVVPPKKRVY  595



>ref|WP_019183254.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
Length=596

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 190/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  + G   K L  DA +K +  LDKLR +NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKSGAPHKTLPSDACDKALGLLDKLRYANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQN+AAVFRT +TLEEGC  +   ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQNDAAVFRTSKTLEEGCAKMAEIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL    EN K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVNVDENGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_028838112.1| fumarate reductase [Thermomonas fusca]
Length=595

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV +K  +PD+VVPGL A GEAAC SVHGAN
Sbjct  341  GVDVEKQPIPVIPTVHYNMGGIPTNYHGEVVQLKDGNPDSVVPGLYAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR +E  +PG   K L  DA ++++A LDKLRN++G  PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVANRCSETIKPGAPHKELAGDACDRSLANLDKLRNAHGDTPTAE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ +AAVFRT ETL EG K I +   SF DVKV DRSL+WNSDL+ET+EL+N
Sbjct  461  IRNNMQRAMQRDAAVFRTGETLAEGVKAISDIHASFADVKVADRSLVWNSDLVETLELQN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A +T+ SAE RKESRGAHAREDF  RDD+ W KHT+  W +     R+DYRPVHM 
Sbjct  521  LLGQALVTIVSAENRKESRGAHAREDFPDRDDDSWHKHTI-CWADAAGNTRIDYRPVHMY  579

Query  70   TLDDEIETFPPKARVY  23
            TL  ++E  PPK RVY
Sbjct  580  TLSSDVEVVPPKKRVY  595



>ref|WP_011629078.1| succinate dehydrogenase [Alkalilimnicola ehrlichii]
 gb|ABI56683.1| succinate dehydrogenase subunit A [Alkalilimnicola ehrlichii 
MLHE-1]
Length=596

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/256 (65%), Positives = 200/256 (78%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+ GEVVT+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVIPTVHYNMGGIPTNYQGEVVTLKDGNPDQVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEK-QKPLEKDAGEKTIAWLDKLRNSNGSLPTS  428
            RLG+NSLLD+VVFGRA A R AE+ + G+  Q+ L+  AG+  +  L++LRN+ GS PT+
Sbjct  401  RLGSNSLLDLVVFGRAAAIRAAELIKEGDTVQRALQPGAGDLALERLERLRNAKGSKPTA  460

Query  427  NIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELE  248
             IR  MQ  MQN AAVFRT E+L+EGC+ +   + SF DV V DRSLIWNSDL+ET+ELE
Sbjct  461  EIRDGMQETMQNFAAVFRTGESLQEGCERMAAVYASFEDVAVSDRSLIWNSDLVETLELE  520

Query  247  NLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGY-WENEKVRLDYRPVHMN  71
            NLL NA  T+ SA  R+ESRGAHAREDF +RDD+ W KHTL +  ++ KV+LDYRPVHM 
Sbjct  521  NLLGNAVATIESARNREESRGAHAREDFPERDDDNWHKHTLSWVGQDGKVKLDYRPVHMY  580

Query  70   TLDDEIETFPPKARVY  23
            TL DE+E  PPKARVY
Sbjct  581  TLTDEMEVIPPKARVY  596



>ref|WP_043800939.1| fumarate reductase [Arenimonas malthae]
 gb|KFN51677.1| succinate dehydrogenase [Arenimonas malthae CC-JY-1]
Length=596

 Score =   337 bits (863),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 197/256 (77%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGG+ TN+HGEVVT+K  +PD VVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGLQTNYHGEVVTLKNGNPDTVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +PG   K L   A +K++A LDKLR+++G  PT++
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKPGAPHKSLPASACDKSLANLDKLRHASGGTPTAD  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQ+VMQNNAAVFRT ETL EG + I    +SF DV+V DRSL+WNSDLIET+EL+N
Sbjct  462  IRGNMQQVMQNNAAVFRTGETLLEGVQKIREVVKSFEDVRVSDRSLVWNSDLIETLELQN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM SAE RKESRGAHARED+ +RDD  W KHTL  W +E     LDYRPVHM 
Sbjct  522  LLGQAVATMVSAENRKESRGAHAREDYQERDDVNWHKHTL-CWVDEAGNTTLDYRPVHMY  580

Query  70   TLDDEIETFPPKARVY  23
            TL  +++  PPKAR Y
Sbjct  581  TLSKDVDVVPPKARTY  596



>ref|WP_019994878.1| succinate dehydrogenase [Aureimonas ureilytica]
Length=611

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/256 (65%), Positives = 194/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T K  DPDAVVPGLMA GEAAC SVHGAN
Sbjct  356  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTKKDGDPDAVVPGLMAVGEAACVSVHGAN  415

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA A R AE    GE Q PL + AGE ++A LD+ R +NGS  T+ 
Sbjct  416  RLGSNSLIDLVVFGRAAALRCAETVSAGEGQAPLPQGAGENSLARLDRFRYANGSTSTAE  475

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R NMQR MQ+N AVFRT E LEEG + I   W S  DV+V DRSLIWN+DL+ET+E +N
Sbjct  476  LRDNMQRTMQSNCAVFRTGEVLEEGHEKIHQVWRSSDDVRVTDRSLIWNTDLVETLEYDN  535

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW--ENEKVRLDYRPVHMN  71
            L+  A +TM SA AR+ESRGAHAREDF  RDD  WMKHTL +   +N+ VRLD RPVH  
Sbjct  536  LISQAVVTMDSALARQESRGAHAREDFPDRDDANWMKHTLSFCDTQNKTVRLDDRPVHTY  595

Query  70   TLDDEIETFPPKARVY  23
            T+ ++IE   PK RVY
Sbjct  596  TMSNQIEYIAPKKRVY  611



>ref|WP_027172788.1| fumarate reductase [Methylobacterium sp. 10]
Length=606

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 196/256 (77%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  351  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  PG +Q  L KD+ +K +A LD+ R +NG  PT+ 
Sbjct  411  RLGSNSLIDLVVFGRAAGLRCAEIVEPGARQMDLPKDSADKALARLDRFRYANGGTPTAE  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQ+ MQNN AVFRT E LEEG  LI   W+   D+K+ DRSLIWN+DL+ET+E +N
Sbjct  471  LRAEMQKTMQNNCAVFRTGEVLEEGKALIHKVWQGEADIKITDRSLIWNTDLLETLEFDN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE--NEKVRLDYRPVHMN  71
            L+  A +TM SA  RKESRGAHAREDF  RDD++WMKHTL + +  +++V +DYRPVH  
Sbjct  531  LIGQAVVTMESAANRKESRGAHAREDFPDRDDKEWMKHTLSWLDETSQQVNIDYRPVHTY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ +EI+   PKARVY
Sbjct  591  TMSNEIQYIEPKARVY  606



>ref|WP_007082035.1| succinate dehydrogenase [Rhodanobacter fulvus]
 gb|EIL88475.1| succinate dehydrogenase flavoprotein subunit [Rhodanobacter fulvus 
Jip2]
Length=595

 Score =   336 bits (862),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV  +G+D DA+VPGL A GEAAC SVHG N
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVQKRGDDVDAIVPGLFAIGEAACVSVHGGN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+  PG   K L  +  +K++A  D LRN++G  PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVAHRCAELIEPGAAHKDLPTNVLDKSLARFDALRNADGGTPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR+ MQR MQ +AAVFRT ETL EG + I   ++ F DVKV DRSL+WNSDL+ET+EL N
Sbjct  461  IRMAMQRTMQKDAAVFRTGETLAEGKQKISEVFDMFQDVKVSDRSLVWNSDLVETLELSN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM+SAE R ESRGAHAREDF +RDD  WMKHTL  W +E  K R D+RPVHMN
Sbjct  521  LLAQAVATMHSAEQRPESRGAHAREDFPERDDANWMKHTL-VWVDEAGKSRFDFRPVHMN  579

Query  70   TLDDEIETFPPKARVY  23
             + DE++  PP  RVY
Sbjct  580  PMTDEVKAVPPAKRVY  595



>ref|WP_027150677.1| fumarate reductase [Methylobacter tundripaludum]
Length=594

 Score =   336 bits (862),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 198/253 (78%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VD+TKEPIPVLPTV Y MGGIPTN+  EVVT+ G+DPDAVVPGLMA GEAAC SVHGANR
Sbjct  342  VDITKEPIPVLPTVHYNMGGIPTNYKAEVVTLNGDDPDAVVPGLMAIGEAACVSVHGANR  401

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LG+NSLLD+VVFGR+ A R AE+ +PG + KPL  +A +K IA  DK+RN+NGS  TS+I
Sbjct  402  LGSNSLLDLVVFGRSAAIRCAELIKPGSRLKPLASNACDKAIARFDKIRNANGSRSTSDI  461

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RL+MQ+VMQ  AAVFRT  TL EG   +    ++F DVKV D+SLIWN+DL+ET+EL+NL
Sbjct  462  RLDMQKVMQAKAAVFRTGTTLTEGVNAMAEVRKTFADVKVVDKSLIWNTDLVETLELDNL  521

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            L  A + + +A  R ESRG HARED+  RDDE W+KHTL + + ++V++DYRPVHM TL 
Sbjct  522  LSQATVAINAAGNRTESRGGHAREDYPNRDDENWLKHTLTWLDGDQVKIDYRPVHMYTLT  581

Query  61   DEIETFPPKARVY  23
            +E++  PPK RVY
Sbjct  582  NEVDVIPPKERVY  594



>ref|XP_008870100.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Aphanomyces invadans]
 gb|ETW01102.1| succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, 
mitochondrial [Aphanomyces invadans]
Length=628

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 203/265 (77%), Gaps = 11/265 (4%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVT--------VKGNDPDAVVPGLMAAGEAA  629
            GVDVTKEPIPVLPTV Y MGGIPTNH+GEVV         V    PD V+ GL AAGEAA
Sbjct  364  GVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVMPDTSGLPDVNKTYPDKVIKGLFAAGEAA  423

Query  628  CASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNS  449
             ASVHGANRLGANSLLDIVVFGRA A R+AEI +PGE ++PL ++AGE+++  +D +R +
Sbjct  424  SASVHGANRLGANSLLDIVVFGRAAALRIAEISKPGEAKRPLPRNAGEQSLHMVDSIRYA  483

Query  448  NGSLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDL  269
            NG++PT+ +RL MQ+ MQ++AAV+RTQETL EG + ID     F D++V DRSLIWN+DL
Sbjct  484  NGAIPTAELRLEMQKTMQSDAAVYRTQETLAEGVQKIDAITPKFKDIRVTDRSLIWNTDL  543

Query  268  IETVELENLLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRL  95
            IET+EL+NLL  A  TM+ AEARKESRGAHAREDF+ RDD  WMKHTL Y ++E  K  +
Sbjct  544  IETIELKNLLACASATMHGAEARKESRGAHAREDFSARDDVNWMKHTLAYHDDESTKTHI  603

Query  94   DYRPVHMNTLD-DEIETFPPKARVY  23
             YRPVH +TLD DE +T  P ARVY
Sbjct  604  AYRPVHYHTLDEDECKTVAPVARVY  628



>ref|WP_017355966.1| succinate dehydrogenase [Stenotrophomonas maltophilia]
Length=596

 Score =   336 bits (862),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR A+  +PG+  K L  DA +K +  LDKLR +NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCADTIKPGQSHKTLPSDACDKALGLLDKLRYANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQN+AAVFRT +TL+EGC  +   ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQNDAAVFRTSKTLQEGCGKMAEIFDSFQDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL    E  K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDVNWQKHTLVSVDEKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_027839624.1| fumarate reductase [Mastigocoleus testarum]
Length=597

 Score =   336 bits (861),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 194/256 (76%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVV  K  DPDAVVPGLMA GEAAC SVHGAN
Sbjct  343  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVAPKEGDPDAVVPGLMAIGEAACVSVHGAN  402

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  PGE+Q+ L  DAG+  +A LD  R++ G  PT+ 
Sbjct  403  RLGSNSLIDLVVFGRASGLRCAEILTPGERQRELPADAGQNALARLDHFRHAAGGTPTAE  462

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ+ MQ N AVFRT ETL+EG   I + +    D+KVEDRS+IWNSDLIET+E +N
Sbjct  463  LRLKMQKSMQTNCAVFRTGETLDEGVSQIADVYSGLPDIKVEDRSMIWNSDLIETLEFDN  522

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEK--VRLDYRPVHMN  71
            L+  A +TM SA  RKESRG HAREDF  R+D++WMKHTL  W +EK  V LDYRPVH  
Sbjct  523  LISQAAVTMNSAANRKESRGGHAREDFPDRNDDEWMKHTLA-WVDEKGNVSLDYRPVHSY  581

Query  70   TLDDEIETFPPKARVY  23
            T+ +++E   PKARVY
Sbjct  582  TMSNDVEYIAPKARVY  597



>ref|WP_027079842.1| fumarate reductase [Luteimonas mephitis]
Length=597

 Score =   336 bits (861),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGG+PTN+HGEVV +K  +PD VVPGL A GEAAC SVHGAN
Sbjct  343  GVDVEKQPIPVIPTVHYNMGGVPTNYHGEVVQLKDGNPDHVVPGLYAIGEAACVSVHGAN  402

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR  E  RPG   KPL  DA ++++A LD LR++NG  PT+ 
Sbjct  403  RLGSNSLLDLVVFGRAVANRCGETIRPGAAHKPLAGDACDRSLANLDHLRHANGGTPTAV  462

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT ETL EG + I     SF DVKV DRSL+WNSDL+ET EL+N
Sbjct  463  IRDRMQRTMQADAAVFRTGETLAEGVEKIREIRASFADVKVSDRSLVWNSDLVETFELQN  522

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL  A  T+ +AE R+ESRGAHAREDF +RDD +W KH+L + ++E K R+DYRPVHM T
Sbjct  523  LLGQALATIVAAENRQESRGAHAREDFPERDDAQWQKHSLCWVDDEGKTRIDYRPVHMYT  582

Query  67   LDDEIETFPPKARVY  23
            LDDE+E  PP  RVY
Sbjct  583  LDDEVEVVPPMKRVY  597



>ref|WP_031435994.1| fumarate reductase [Methylobacter tundripaludum]
Length=594

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 197/253 (78%), Gaps = 0/253 (0%)
 Frame = -1

Query  781  VDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGANR  602
            VD+TKEPIPVLPTV Y MGGIPTN+  EVVT+K  DPDAVVPGLMA GEAAC SVHGANR
Sbjct  342  VDITKEPIPVLPTVHYNMGGIPTNYKAEVVTLKDGDPDAVVPGLMAIGEAACVSVHGANR  401

Query  601  LGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSNI  422
            LG+NSLLD+VVFGR+ A R AE+ +P  + KPL  +A +K IA  DK+RN+NGS  TS+I
Sbjct  402  LGSNSLLDLVVFGRSAAIRCAELIKPRSRLKPLASNACDKAIARFDKIRNANGSRSTSDI  461

Query  421  RLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELENL  242
            RL+MQ+VMQ  AAVFRT  TL EG   +    ++F DVKV D+SLIWN+DL+ET+EL+NL
Sbjct  462  RLDMQKVMQAKAAVFRTGSTLTEGISAMAKVRKTFADVKVADKSLIWNTDLVETLELDNL  521

Query  241  LINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTLD  62
            L  A + + +A  R ESRG HARED+  RDDE W+KHTL + ++++V++DYRPVHM TL 
Sbjct  522  LSQATVAINAAGNRTESRGGHAREDYPNRDDENWLKHTLTWLDDDQVKIDYRPVHMYTLT  581

Query  61   DEIETFPPKARVY  23
            DEI+  PPK RVY
Sbjct  582  DEIDVIPPKERVY  594



>ref|WP_023493887.1| succinate dehydrogenase flavoprotein subunit [Methyloglobulus 
morosus]
 gb|ESS73143.1| succinate dehydrogenase flavoprotein subunit [Methyloglobulus 
morosus KoM1]
Length=594

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 197/254 (78%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV KEPIPVLPTV Y MGGIPTN+  EVVT+  ++PD VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVAKEPIPVLPTVHYNMGGIPTNYKAEVVTLADDNPDKVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD++VFGR+ A R AEI +P    KPL KDA ++ +   DK R++NGSLPT+ 
Sbjct  401  RLGSNSLLDLIVFGRSAAIRAAEIIKPKSPHKPLAKDACDQALTRFDKFRHANGSLPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQ+ MQ+ AAVFRTQ+T++EG  ++ +  +S +DVKV DRSL WN+DL+ET+EL+N
Sbjct  461  IRLNMQKTMQSKAAVFRTQKTMDEGITMMKDVMQSMNDVKVMDRSLTWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL  A +++ +A  R+ESRG HARED+ KRDD  WMKHTL + + +KV + YRPVH+ TL
Sbjct  521  LLAQAMVSISAASNRQESRGGHAREDYPKRDDAHWMKHTLTWLDKDKVTIGYRPVHLYTL  580

Query  64   DDEIETFPPKARVY  23
             DE+E   PK RVY
Sbjct  581  TDEVEVVMPKERVY  594



>ref|WP_024712195.1| fumarate reductase [Xanthomonas oryzae]
 gb|AJQ87810.1| fumarate reductase [Xanthomonas oryzae pv. oryzicola]
Length=596

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAQIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL    +N K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDNGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_019300225.1| succinate dehydrogenase [Xanthomonas oryzae]
Length=596

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQSHKTLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_019904706.1| succinate dehydrogenase [Methylobacterium sp. 77]
Length=606

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  351  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  PG +Q  L KD+ EK +  LD+ R +NG  PT+ 
Sbjct  411  RLGSNSLIDLVVFGRAAGLRCAEIVEPGARQMELPKDSAEKALTRLDRFRYANGGTPTAE  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQ+ MQNN AVFRT E LEEG  LI   W+   D+K+ DRSLIWN+DL+ET+E +N
Sbjct  471  LRAEMQKTMQNNCAVFRTGEVLEEGKALIHKVWQGEADIKITDRSLIWNTDLLETLEFDN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            L+  A +TM SA  RKESRGAHAREDF  RDD++WMKHTL + +++  +V +DYRPVH  
Sbjct  531  LIGQAVVTMESAANRKESRGAHAREDFPDRDDKEWMKHTLSWLDDKSHEVNIDYRPVHTY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ +EI+   PKARVY
Sbjct  591  TMSNEIQYIEPKARVY  606



>ref|WP_013534975.1| succinate dehydrogenase [Pseudoxanthomonas suwonensis]
 gb|ADV27146.1| succinate dehydrogenase, flavoprotein subunit [Pseudoxanthomonas 
suwonensis 11-1]
Length=597

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 192/256 (75%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKVGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +     KPL  DA +K ++ LDKLRN+NG  PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKKNAPHKPLASDACDKALSQLDKLRNANGDTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ +AAVFRT +TL+EGC+ +   ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDRMQRTMQADAAVFRTSKTLQEGCEKMSQIFDSFQDVKVSDRSLVWNSDLIETYELHN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL+NA  T+ SAE RKESRGAHA ED+  RDD  W KHTL   + E  K   DYRPVHM 
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDYPDRDDANWQKHTLVTVDAETGKTSFDYRPVHMY  581

Query  70   TLDDEIETFPPKARVY  23
            TL  +++  PPK RVY
Sbjct  582  TLSKDVDVVPPKPRVY  597



>ref|WP_037021074.1| fumarate reductase [Rhizobiales bacterium YIM 77505]
Length=598

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPT+ HGEVVT+KG +PD VVPGLMA GEAAC SVHGAN
Sbjct  343  GVDVTKEPIPVLPTVHYNMGGIPTHFHGEVVTLKGGNPDHVVPGLMAVGEAACVSVHGAN  402

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA A R AEI  PGEK   L KD+ EK +A LD+LR++NG  PT+ 
Sbjct  403  RLGSNSLIDLVVFGRAAALRCAEIVTPGEKHADLPKDSAEKALARLDRLRHANGGTPTAV  462

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQR MQNN AVFRT E LEEG +LI   W    D++V DRSLIWN+DLIET+E +N
Sbjct  463  LRERMQRTMQNNCAVFRTGEVLEEGKQLIHEVWRGAADIRVTDRSLIWNTDLIETLEFDN  522

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGY--WENEKVRLDYRPVHMN  71
            L+  A +TM SA  R ESRGA ARED+ +RDD+ WMKHTL +  +   +V LDYRPVH  
Sbjct  523  LIGQAVVTMESALNRTESRGAQAREDYPERDDKNWMKHTLAWLDYAEHRVILDYRPVHTY  582

Query  70   TLDDEIETFPPKARVY  23
            T+ +E++   PKARVY
Sbjct  583  TMTNEVQYIEPKARVY  598



>ref|WP_018974716.1| succinate dehydrogenase [Rudaea cellulosilytica]
Length=596

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN+HGEVV   G+DPD VV GL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNYHGEVVQKFGDDPDKVVEGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  + G     L  DA +  +A LDKLRN+ GS  T++
Sbjct  402  RLGSNSLLDLVVFGRAVANRAAETIKSGASHVELPADACDAALANLDKLRNAKGSRATAD  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL+MQR MQ++AAVFRT  +L+EGC  +   + SF DV+V DRSL+WNSDLIET EL+N
Sbjct  462  VRLDMQRTMQSDAAVFRTASSLQEGCAKMAKIFTSFEDVRVSDRSLVWNSDLIETYELQN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL NA  T+ SAE R ESRGAHAREDF +RDD  WMKHTL   + +     DYRPVHMNT
Sbjct  522  LLYNAVATINSAEQRHESRGAHAREDFPERDDVNWMKHTLVKVDAKGACSFDYRPVHMNT  581

Query  67   LDDEIETFPPKARVY  23
            L DE+   PPKARVY
Sbjct  582  LTDEVAPVPPKARVY  596



>ref|WP_026634481.1| fumarate reductase [Dyella japonica]
Length=595

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEVV  +G++ DAVVPGL A GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVIPTVHYNMGGIPTNYHGEVVQKRGDNVDAVVPGLFAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AEI +PG   K L   A ++ +   D LR + GSLPT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVAHRCAEIVKPGAPHKDLPASALDQALGRFDSLRYAKGSLPTAK  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQR MQ++AAVFRT E+L+EGC  I   ++SF DV V DRSL+WNSDLIET+EL N
Sbjct  461  IRAEMQRTMQSDAAVFRTGESLKEGCDKISKVYDSFKDVGVSDRSLVWNSDLIETLELSN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL  A  TMYSAE R ESRGAHAREDF +RDD  W KHTL   ++  K   D+RPVHM T
Sbjct  521  LLGQAVATMYSAEQRPESRGAHAREDFPERDDANWQKHTLVSVDDHGKANFDFRPVHMYT  580

Query  67   LDDEIETFPPKARVY  23
            +  ++E  PPK RVY
Sbjct  581  MTSDVEVVPPKKRVY  595



>ref|WP_014503502.1| succinate dehydrogenase [Xanthomonas oryzae]
 gb|AEQ96716.1| succinate dehydrogenase, flavoprotein subunit [Xanthomonas oryzae 
pv. oryzicola BLS256]
Length=596

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAQIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_029219954.1| fumarate reductase [Xanthomonas cassavae]
Length=596

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPVLPTV Y MGGIPTN+HGEVV  +G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVAKQPIPVLPTVHYNMGGIPTNYHGEVVRKQGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +  +  KPL  DA +K +  LDKLR++NGS PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKTNQPHKPLPSDACDKALGLLDKLRHANGSTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELSN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVTVDDKGKCDFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  E++  PPK RVY
Sbjct  582  LSKEVDVVPPKPRVY  596



>ref|WP_008945582.1| succinate dehydrogenase [Oceanibaculum indicum]
 gb|EKE71541.1| succinate dehydrogenase flavoprotein subunit [Oceanibaculum indicum 
P24]
Length=598

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 193/257 (75%), Gaps = 3/257 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEV     +DPDA +PGLMAAGEAAC SVHGAN
Sbjct  342  GVDVTKEPIPVVPTVHYNMGGIPTNYHGEVFRPTKDDPDATIPGLMAAGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG NSLLD+VVFGRACANR  E  +PG   KPL + AGE  IA LD +R + G   T  
Sbjct  402  RLGTNSLLDLVVFGRACANRCGETLKPGTPHKPLPESAGENAIARLDAVRFNKGGTKTGE  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ VMQ +AAVFR Q  LE G K I +  +   DV V D+SLIWN+DL+ET+EL N
Sbjct  462  VRLKMQHVMQRHAAVFRDQNILETGVKNIHDVAKGLVDVAVTDKSLIWNTDLVETLELHN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE---KVRLDYRPVHM  74
            L+  A +T+ S EARKESRGAHAR+DFT+RDDE WMKHT+ + + +   KV L YRPVH+
Sbjct  522  LMGQAIVTLESGEARKESRGAHARDDFTERDDENWMKHTVSWCDVDNGFKVELGYRPVHL  581

Query  73   NTLDDEIETFPPKARVY  23
            NT+ +EI+T PPKARVY
Sbjct  582  NTMSNEIKTIPPKARVY  598



>ref|WP_009493498.1| succinate dehydrogenase [Microvirga lotononidis]
 gb|EIM25207.1| succinate dehydrogenase, flavoprotein subunit [Microvirga lotononidis]
Length=607

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  352  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGAN  411

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  P  +   L K A E  ++ LDK R +NGS PT+ 
Sbjct  412  RLGSNSLIDLVVFGRAAGLRCAEILEPNARHADLPKSADELALSRLDKFRYANGSTPTAE  471

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ+ MQNN AVFRT E LEEG KLI + W +  D+KV DRSLIWN+DL+ET+E +N
Sbjct  472  LRLQMQKTMQNNCAVFRTGEVLEEGRKLIHDVWSASADIKVTDRSLIWNTDLLETLEFDN  531

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            L+  A +TM  A  R+ESRGAHAREDFT+RDD+ WMKHTL + ++   KV L+YRPVH  
Sbjct  532  LIGQAVVTMEGAANRQESRGAHAREDFTERDDKNWMKHTLAWLDDTSHKVTLNYRPVHTY  591

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I+   PKARVY
Sbjct  592  TMSNDIQYIEPKARVY  607



>ref|WP_010373310.1| succinate dehydrogenase [Xanthomonas vasicola]
 gb|KEZ99014.1| fumarate reductase [Xanthomonas vasicola pv. vasculorum NCPPB 
895]
 gb|KFA28929.1| fumarate reductase [Xanthomonas vasicola pv. vasculorum NCPPB 
1381]
 gb|KFA29920.1| fumarate reductase [Xanthomonas vasicola pv. vasculorum NCPPB 
1326]
 gb|KFA34496.1| fumarate reductase [Xanthomonas vasicola pv. vasculorum NCPPB 
206]
 gb|KGP56315.1| fumarate reductase [Xanthomonas campestris pv. arecae]
 gb|KGR52594.1| fumarate reductase [Xanthomonas vasicola]
 gb|KGR57503.1| fumarate reductase [Xanthomonas vasicola]
 gb|KGT83987.1| fumarate reductase [Xanthomonas vasicola]
Length=596

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVNKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_039434923.1| fumarate reductase [Xanthomonas vasicola]
 gb|KGR42775.1| fumarate reductase [Xanthomonas vasicola]
 gb|KGR42911.1| fumarate reductase [Xanthomonas vasicola]
 gb|KGR48042.1| fumarate reductase [Xanthomonas vasicola]
 gb|KGR59782.1| fumarate reductase [Xanthomonas vasicola]
Length=596

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_021133416.1| succinate dehydrogenase flavoprotein subunit [Phaeospirillum 
fulvum]
 gb|EPY00529.1| succinate dehydrogenase flavoprotein subunit [Phaeospirillum 
fulvum MGU-K5]
Length=594

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 191/254 (75%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT+EPIPVLPTV Y MGGIPTN HGEV+     DPDA VPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTREPIPVLPTVHYNMGGIPTNIHGEVLRPTEADPDATVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG NSLLDIVVFGRA A R AE  +P    K L K AGE+ +A  D+LRN+NGSL TS 
Sbjct  401  RLGTNSLLDIVVFGRAAAVRTAETLKPASAHKSLPKGAGEQAVARFDRLRNANGSLSTSE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQ+ MQN+AAVFRT +TL EG + ++    S   +K+ DRS++WNSDL+E +ELEN
Sbjct  461  IRLSMQKTMQNDAAVFRTSKTLAEGVEKMNEVAASLSQIKINDRSMVWNSDLVEALELEN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            L+  A  T+ SAEAR ESRGAHA ED+ +RDD  W+KHTL + EN KVRLDYRPVH  TL
Sbjct  521  LMDCAQTTIVSAEARHESRGAHAHEDYPERDDTTWLKHTLAWVENGKVRLDYRPVHTYTL  580

Query  64   DDEIETFPPKARVY  23
             DE+E   P+ RVY
Sbjct  581  TDEVEYIKPQKRVY  594



>ref|WP_026986788.1| fumarate reductase [Fodinicurvata fenggangensis]
Length=595

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPT  Y MGGIPTN+HGEV+TVK  DPD+VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTCHYNMGGIPTNYHGEVLTVKDGDPDSVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGR+   R AE   PGE  +PL  DA E +++ LD  RN+ G  PT+ 
Sbjct  401  RLGSNSLLDLVVFGRSAGKRCAETLAPGESHRPLPADADEMSLSRLDHFRNAKGDTPTAA  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
             RL+MQ+VMQ++AAVFRT ETL +G   + + W    D+ V DRS+IWNSDL+ET+E +N
Sbjct  461  HRLDMQKVMQSHAAVFRTGETLGDGSSKLKDVWARRQDISVSDRSMIWNSDLMETLEYDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            L+  A  TM SA AR+ESRGAHAREDF  RDDEKWMKH++ + +++ K  LD RPVHM  
Sbjct  521  LIYQAVATMESAAAREESRGAHAREDFPDRDDEKWMKHSVVWVDDKGKATLDSRPVHMQP  580

Query  67   LDDEIETFPPKARVY  23
            + ++++TFPPKARVY
Sbjct  581  MTNDVQTFPPKARVY  595



>ref|WP_029030003.1| fumarate reductase [Salinarimonas rosea]
Length=613

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 194/257 (75%), Gaps = 4/257 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN +GEV+T K  DPD+VVPGLMA GEAAC SVHGAN
Sbjct  358  GVDVTKEPIPVLPTVHYNMGGIPTNFYGEVLTKKNGDPDSVVPGLMAIGEAACVSVHGAN  417

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI +PGE Q PL   + +K +A LD+ RN+NG+ PT++
Sbjct  418  RLGSNSLIDLVVFGRAAGLRCAEIVKPGESQAPLPAGSADKALARLDRFRNANGTTPTAD  477

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ+ MQNN AVFRT + L EG  LI   W    DV  +DRSLI+N+DLIET+E +N
Sbjct  478  LRLQMQKTMQNNCAVFRTGDVLNEGKTLIHEVWGGIADVSTKDRSLIFNTDLIETLEFDN  537

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE---KVRLDYRPVHM  74
            L+  A +TM SA  R ESRGAHAREDF  RDD++WMKHTL  W +E   +V +DYRPVH 
Sbjct  538  LITQAVVTMESAANRTESRGAHAREDFPDRDDKEWMKHTLA-WCDEGAGQVSIDYRPVHT  596

Query  73   NTLDDEIETFPPKARVY  23
             TL +EIE   PKARVY
Sbjct  597  YTLSNEIEYIAPKARVY  613



>ref|WP_027316818.1| fumarate reductase [Microvirga flocculans]
Length=607

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  352  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGAN  411

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  P  +   L K+A E  ++ LDK R +NGS PT+ 
Sbjct  412  RLGSNSLIDLVVFGRAAGLRCAEILEPNARHADLPKNADELALSRLDKFRYANGSTPTAE  471

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ+ MQNN AVFRT E LEEG KLI + W +  D+KV DRSLIWN+DL+ET+E +N
Sbjct  472  LRLQMQKTMQNNCAVFRTGEVLEEGKKLIHDVWNAAADIKVTDRSLIWNTDLLETLEFDN  531

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            L+  A +TM  A  R+ESRGAHAREDF +RDD+ WMKHTL + ++   KV LDYRPVH  
Sbjct  532  LIGQAVVTMEGAANRQESRGAHAREDFAERDDKNWMKHTLAWLDDTSHKVTLDYRPVHTY  591

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I+   PKARVY
Sbjct  592  TMSNDIQYIEPKARVY  607



>ref|WP_007808048.1| succinate dehydrogenase [Rhodanobacter spathiphylli]
 gb|EIL92825.1| succinate dehydrogenase flavoprotein subunit [Rhodanobacter spathiphylli 
B39]
Length=595

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 192/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEVV  +G+D DAVVPGL A GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVIPTVHYNMGGIPTNYHGEVVQKRGDDVDAVVPGLFAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+ +P    K L  +  +K +   D LRN+NGS PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAVAHRCAELIKPETAHKDLPANVLDKALERFDGLRNANGSKPTAQ  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL MQR MQ++AAVFRT +TL+EGC+ I    ESF DV+V DRSL+WNSDLIET+EL N
Sbjct  461  IRLEMQRTMQSDAAVFRTGKTLKEGCEKISAVRESFKDVRVSDRSLVWNSDLIETLELAN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYW-ENEKVRLDYRPVHMNT  68
            LL  A  TMY A  R+ESRG HAREDF +RDD  WMKHTL +  E  K R D RPVHMN 
Sbjct  521  LLDQAVATMYGAAQREESRGGHAREDFPERDDVNWMKHTLAWVDETGKPRFDSRPVHMNP  580

Query  67   LDDEIETFPPKARVY  23
            + DE++  PP  RVY
Sbjct  581  MTDEVKAVPPAKRVY  595



>ref|WP_010378805.1| succinate dehydrogenase [Xanthomonas campestris]
 gb|KFA05680.1| fumarate reductase [Xanthomonas campestris pv. musacearum NCPPB 
4380]
 gb|KFA06673.1| fumarate reductase [Xanthomonas campestris pv. musacearum NCPPB 
2005]
 gb|KFA11318.1| fumarate reductase [Xanthomonas campestris pv. musacearum NCPPB 
4379]
 gb|KFA16721.1| fumarate reductase [Xanthomonas campestris pv. musacearum NCPPB 
4392]
 gb|KFA18834.1| fumarate reductase [Xanthomonas campestris pv. musacearum NCPPB 
4394]
Length=596

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVNKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH  EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHLHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>gb|KFA17636.1| fumarate reductase, partial [Xanthomonas campestris pv. musacearum 
NCPPB 4384]
Length=576

 Score =   333 bits (853),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  322  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  381

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PTS 
Sbjct  382  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTSV  441

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  442  IRDNMQRTMQSDAAVFRTSKTLKEGVNKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  501

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH  EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  502  LLLNAVATINSAEQRKESRGAHLHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  561

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  562  LSKDVDVVPPKPRVY  576



>ref|WP_040485178.1| fumarate reductase [Lutibaculum baratangense]
Length=610

 Score =   334 bits (856),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 194/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN HGEV+T+KG DPD VVPGLMA GEAAC SVHGAN
Sbjct  355  GVDVTKEPIPVLPTVHYNMGGIPTNFHGEVLTLKGGDPDYVVPGLMAIGEAACVSVHGAN  414

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R  E+ +PGE Q  L  DAG+ ++  LD+ R ++G  PT+ 
Sbjct  415  RLGSNSLIDLVVFGRAAGLRCGELLKPGESQPDLPSDAGQNSLDRLDRFRYADGDTPTAK  474

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL+MQ+VMQ N AVFRT E LEEG  LI++ W++  DV+  DRSLIWN+DLIET+E +N
Sbjct  475  LRLDMQKVMQTNCAVFRTGEILEEGHTLINDVWQAARDVRTTDRSLIWNTDLIETLEFDN  534

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE--NEKVRLDYRPVHMN  71
            L+  A +TM SA  R+ESRGAHAREDF  RDD  WMKHTL + +    +V +DYRPVH  
Sbjct  535  LICQAVVTMDSAVNRQESRGAHAREDFPDRDDATWMKHTLAWADTNTREVTIDYRPVHTY  594

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I    PKARVY
Sbjct  595  TMSNDIAYIEPKARVY  610



>ref|WP_013743551.1| succinate dehydrogenase [Pusillimonas sp. T7-7]
 gb|AEC21023.1| succinate dehydrogenase flavoprotein subunit [Pusillimonas sp. 
T7-7]
Length=598

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT++PIPVLPTV Y MGGIPTN+HGEVV   GNDPD VVPGL A GE+AC SVHGAN
Sbjct  344  GVDVTRDPIPVLPTVHYNMGGIPTNYHGEVVQKVGNDPDVVVPGLFAIGESACVSVHGAN  403

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG NSLLDIVVFGRA ANR AEI +P    + L  D  E  +A LD+LR +NG+ PT+ 
Sbjct  404  RLGTNSLLDIVVFGRAAANRCAEIVKPDALHRDLPSDVLEPALARLDQLRYANGATPTAQ  463

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ+ MQ +AAVFRT ETLE+GC+ ID     F D++V DRSL+WN+DLIET+EL N
Sbjct  464  LRLQMQKTMQADAAVFRTAETLEQGCRKIDQINAQFADIRVTDRSLVWNTDLIETLELAN  523

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTL-GYWENEKVRLDYRPVHMNT  68
            LL  A  TM+SA  R E+RG HAREDF +RDD  WMKHTL    EN     D+RPVH NT
Sbjct  524  LLEQAVGTMHSAAQRTETRGGHAREDFPERDDVNWMKHTLVSVDENGACSFDHRPVHSNT  583

Query  67   LDDEIETFPPKARVY  23
            L DE+ET PP  RVY
Sbjct  584  LTDEVETVPPAKRVY  598



>ref|WP_014160740.1| succinate dehydrogenase [Pseudoxanthomonas spadix]
 gb|AER56564.1| succinate dehydrogenase flavoprotein subunit [Pseudoxanthomonas 
spadix BD-a59]
Length=597

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV KEPIPVLPTV Y MGGIPTN+HGEVV   G+DPD+VVPGL A GEAAC SVHGAN
Sbjct  343  GVDVAKEPIPVLPTVHYNMGGIPTNYHGEVVRKLGDDPDSVVPGLYAIGEAACVSVHGAN  402

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE    G   K L  D+ +K +  LD+LRN+NG  PTS 
Sbjct  403  RLGSNSLLDLVVFGRAVANRCAETITSGAPHKTLAPDSCDKALGLLDRLRNANGDTPTSV  462

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EGC+ +   + SF DVKV DRSL+WNSDLIET EL N
Sbjct  463  IRDNMQRTMQSDAAVFRTSKTLKEGCEKMAQVFASFQDVKVSDRSLVWNSDLIETYELSN  522

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE R ESRGAHA EDF  RDD  W KHTL   +++ +   DYRPVHM T
Sbjct  523  LLLNAVATINSAEQRHESRGAHAHEDFPDRDDVNWHKHTLVSVDDKGQCSFDYRPVHMYT  582

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  583  LSKDVDVVPPKPRVY  597



>ref|XP_002505866.1| succinate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO67124.1| succinate dehydrogenase [Micromonas sp. RCC299]
Length=640

 Score =   334 bits (857),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 197/255 (77%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+ GEV+T+  +  D VVPGL+AAGE A +SVHGAN
Sbjct  386  GVDVTKEPIPVIPTVHYNMGGIPTNYKGEVLTLGSDGKDTVVPGLLAAGECASSSVHGAN  445

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN +AE  +PG   K +  DAGE  +A LDK+R SNG   T++
Sbjct  446  RLGANSLLDIVVFGRACANTIAETLKPGTPHKKIPSDAGENAVAHLDKVRWSNGQHSTAD  505

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQRVMQ++AAVFRTQETL EG K ID       D+KV D+S++WN+DLIE +EL N
Sbjct  506  VRKTMQRVMQDDAAVFRTQETLAEGVKKIDEVAARLDDLKVTDKSMVWNTDLIEALELHN  565

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            L+ NA ITM+SAE RKESRGAHAREDF  RDD  WMKHTLG+ +++ KV +DYR V    
Sbjct  566  LMPNAQITMHSAEQRKESRGAHAREDFPDRDDANWMKHTLGWVDDKRKVNIDYRAVIQTP  625

Query  67   LDDEIETFPPKARVY  23
            LDDE+E  PPKARVY
Sbjct  626  LDDEMEHVPPKARVY  640



>gb|ESR26478.1| Succinate dehydrogenase flavoprotein subunit [Lutibaculum baratangense 
AMV1]
Length=612

 Score =   333 bits (855),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 194/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN HGEV+T+KG DPD VVPGLMA GEAAC SVHGAN
Sbjct  357  GVDVTKEPIPVLPTVHYNMGGIPTNFHGEVLTLKGGDPDYVVPGLMAIGEAACVSVHGAN  416

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R  E+ +PGE Q  L  DAG+ ++  LD+ R ++G  PT+ 
Sbjct  417  RLGSNSLIDLVVFGRAAGLRCGELLKPGESQPDLPSDAGQNSLDRLDRFRYADGDTPTAK  476

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL+MQ+VMQ N AVFRT E LEEG  LI++ W++  DV+  DRSLIWN+DLIET+E +N
Sbjct  477  LRLDMQKVMQTNCAVFRTGEILEEGHTLINDVWQAARDVRTTDRSLIWNTDLIETLEFDN  536

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE--NEKVRLDYRPVHMN  71
            L+  A +TM SA  R+ESRGAHAREDF  RDD  WMKHTL + +    +V +DYRPVH  
Sbjct  537  LICQAVVTMDSAVNRQESRGAHAREDFPDRDDATWMKHTLAWADTNTREVTIDYRPVHTY  596

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I    PKARVY
Sbjct  597  TMSNDIAYIEPKARVY  612



>ref|WP_006449603.1| succinate dehydrogenase [Xanthomonas gardneri]
 gb|EGD20056.1| succinate dehydrogenase subunit A [Xanthomonas gardneri ATCC 
19865]
Length=596

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR +NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRYANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFASFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   +YRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFEYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSQDVDVVPPKPRVY  596



>emb|CBK21813.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis 
hominis]
 emb|CBK22434.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis 
hominis]
 emb|CBK20865.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis 
hominis]
Length=634

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 200/260 (77%), Gaps = 6/260 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEP+PVLPTV Y MGG+PTN+HG+V+     D + VVPGL  AGEAAC SVHGAN
Sbjct  375  GVDVTKEPVPVLPTVHYNMGGLPTNYHGQVLKPTEQDTEKVVPGLWCAGEAACTSVHGAN  434

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN + EI +PGE + PL  DAG+  +  LD+LR + G++PT+ 
Sbjct  435  RLGANSLLDIVVFGRACANYINEISKPGEAKTPLPADAGKACLENLDRLRYAKGAIPTAQ  494

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQR MQ+ AAVFRT+ETL+EGCK ++   +   DV + DRS+IWN+DLIET+EL+N
Sbjct  495  LRLRMQRTMQDYAAVFRTEETLQEGCKRMNEVVKEIRDVGITDRSMIWNTDLIETLELQN  554

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-----KVRLDYRPV  80
            LL  A  TM +AEARKESRGAHARED+ +RDD  W+KHT+ Y ++        +L YRPV
Sbjct  555  LLEQAHCTMIAAEARKESRGAHAREDYKERDDVNWLKHTVAYHDDALFGTGTTKLMYRPV  614

Query  79   HMNTLDD-EIETFPPKARVY  23
            HMNTLD+ E++  PPKARVY
Sbjct  615  HMNTLDENEVKPIPPKARVY  634



>ref|WP_036113622.1| MULTISPECIES: fumarate reductase [Luteibacter]
Length=594

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT + +DPD++VPGL A GEAAC SVHGAN
Sbjct  340  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKRDDDPDSIVPGLFAIGEAACVSVHGAN  399

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A+R AE+ + G   K L  +A +K +   D LRN++G+LPT+ 
Sbjct  400  RLGSNSLLDLVVFGRAVAHRCAELIKTGTPHKDLPANALDKILGRFDALRNADGTLPTAA  459

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQ+ MQ++AAVFRT ETL+EG   I   + SF  VKV DRSL+WNSDLIET+EL N
Sbjct  460  IRAEMQKTMQSDAAVFRTGETLKEGKAKISEVFTSFEKVKVSDRSLVWNSDLIETLELSN  519

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM+SAE R ESRGAHAREDF  RDD  W KHTL  W +E  K   D+RPVHM 
Sbjct  520  LLAQAVATMHSAEQRPESRGAHAREDFPDRDDHDWQKHTL-VWIDEAGKSSFDFRPVHMY  578

Query  70   TLDDEIETFPPKARVY  23
            TL D++E  PPK RVY
Sbjct  579  TLTDDVEVVPPKKRVY  594



>emb|CBK22804.2| Succinate dehydrogenase flavoprotein subunit (SDHA) [Blastocystis 
hominis]
Length=641

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 200/260 (77%), Gaps = 6/260 (2%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEP+PVLPTV Y MGG+PTN+HG+V+     D + VVPGL  AGEAAC SVHGAN
Sbjct  382  GVDVTKEPVPVLPTVHYNMGGLPTNYHGQVLKPTEQDTEKVVPGLWCAGEAACTSVHGAN  441

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRACAN + EI +PGE + PL  DAG+  +  LD+LR + G++PT+ 
Sbjct  442  RLGANSLLDIVVFGRACANYINEISKPGEAKTPLPADAGKACLENLDRLRYAKGAIPTAQ  501

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQR MQ+ AAVFRT+ETL+EGCK ++   +   DV + DRS+IWN+DLIET+EL+N
Sbjct  502  LRLRMQRTMQDYAAVFRTEETLQEGCKRMNEVVKEIRDVGITDRSMIWNTDLIETLELQN  561

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-----KVRLDYRPV  80
            LL  A  TM +AEARKESRGAHARED+ +RDD  W+KHT+ Y ++        +L YRPV
Sbjct  562  LLEQAHCTMIAAEARKESRGAHAREDYKERDDVNWLKHTVAYHDDALFGTGTTKLMYRPV  621

Query  79   HMNTLDD-EIETFPPKARVY  23
            HMNTLD+ E++  PPKARVY
Sbjct  622  HMNTLDENEVKPIPPKARVY  641



>ref|WP_012438231.1| succinate dehydrogenase [Xanthomonas campestris]
 emb|CAP51401.1| succinate dehydrogenase (ubiquinone) flavoprotein subunit [Xanthomonas 
campestris pv. campestris]
 gb|AEL07277.1| succinate dehydrogenase, flavoprotein subunit [Xanthomonas campestris 
pv. raphani 756C]
 gb|KIQ21523.1| fumarate reductase [Xanthomonas campestris]
Length=596

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPVLPTV Y MGGIPTN+HGEVV  +G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVAKQPIPVLPTVHYNMGGIPTNYHGEVVRKQGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +  +  KPL  DA +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKTNQPHKPLPSDACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL   +++ +   +YRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVTVDDKGQCDFEYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  E++  PPK RVY
Sbjct  582  LSKEVDVVPPKPRVY  596



>ref|WP_038308686.1| fumarate reductase [bacterium YEK0313]
Length=606

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 196/256 (77%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPV+PTV Y MGGIPTN+HGEV T KG DPDA+VPGLMA GEAAC SVHGAN
Sbjct  351  GVDVTKEPIPVIPTVHYNMGGIPTNYHGEVYTKKGGDPDAIVPGLMAIGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AE    GEK + L KDA E  ++ LDKLR+++G  PT+ 
Sbjct  411  RLGSNSLIDLVVFGRAAGLRAAETVVAGEKHQDLPKDASELALSRLDKLRHASGGTPTAQ  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +R  MQ +MQ+N AVFRT E LEEG KLI   W+   D++  DRSL+WNSDLIET+E +N
Sbjct  471  LRARMQGIMQSNCAVFRTGEVLEEGQKLIHEVWQGSSDIRTTDRSLVWNSDLIETLEFDN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            L+  A +TM SA  RKESRGAHARED+ +R+D++WMKHTL + ++  + V +DYRPVH  
Sbjct  531  LISQAVVTMDSAANRKESRGAHAREDYAERNDKEWMKHTLAFADDAAKTVTIDYRPVHTY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I+   PKARVY
Sbjct  591  TMTNDIQYIEPKARVY  606



>ref|WP_036140987.1| fumarate reductase [Luteibacter sp. 9135]
Length=594

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 192/256 (75%), Gaps = 3/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEVVT + +DPD++VPGL A GEAAC SVHGAN
Sbjct  340  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKRDDDPDSIVPGLFAIGEAACVSVHGAN  399

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ++R AE+ +PG   K L  +A +  +   D LRN+NG+ PT+ 
Sbjct  400  RLGSNSLLDLVVFGRAVSHRCAELIKPGTPHKDLPANALDSILGRFDALRNANGAKPTAQ  459

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR  MQ+ MQ++AAVFRT ETL +G   I   + SF  VKV DRSL+WNSDLIET+EL N
Sbjct  460  IRAEMQKTMQSDAAVFRTGETLRDGKAKISEVYTSFQQVKVSDRSLVWNSDLIETLELAN  519

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM+SAE R ESRGAHAREDF  RDD  W KHTL  W +E  + R D+RPVHM 
Sbjct  520  LLAQAVATMHSAEQRPESRGAHAREDFPDRDDHDWQKHTL-VWIDEAGQSRFDFRPVHMY  578

Query  70   TLDDEIETFPPKARVY  23
            TL D++E  PPK RVY
Sbjct  579  TLTDDVEVVPPKKRVY  594



>emb|CCW17627.1| Succinate dehydrogenase flavoprotein subunit [Sphingobium japonicum 
BiD32]
Length=320

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 186/255 (73%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT++PIPVLPT  Y MGG+P N+HG  ++  G DPDA+VPGLMAAGEAAC SVHGAN
Sbjct  66   GVDVTRQPIPVLPTAHYCMGGVPANYHGHAISAAGGDPDAIVPGLMAAGEAACVSVHGAN  125

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG NSLLDIVVFGRA A R AE+  PG  Q  L  DAG  +IA  DKLR++ G  PT  
Sbjct  126  RLGCNSLLDIVVFGRAAALRCAEMLIPGAAQPELPADAGAASIARFDKLRHAKGQTPTPQ  185

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQR MQ+ A VFRT + L+EG + +   W+   D+ V DRS+IWNSDL+ET+E EN
Sbjct  186  LRLKMQRTMQSFATVFRTGDILKEGEQGLREVWDGLSDIGVSDRSMIWNSDLLETLEFEN  245

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE-NEKVRLDYRPVHMNT  68
            LL+ A   + SA AR ESRGAHAREDF  RDDEKWMKH+L + +    VRLDYRPVH  T
Sbjct  246  LLLQATALVGSAIARTESRGAHAREDFPDRDDEKWMKHSLAWVDPTGAVRLDYRPVHTFT  305

Query  67   LDDEIETFPPKARVY  23
            L ++I+   PKARVY
Sbjct  306  LTEDIQYIEPKARVY  320



>emb|CDS14117.1| Putative Similar to succinate dehydrogenaseFT flavoprotein subunit 
[Absidia idahoensis var. thermophila]
Length=615

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/257 (66%), Positives = 194/257 (75%), Gaps = 3/257 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPT + GEV+       D VVPGL AAGEAAC SVHGAN
Sbjct  359  GVDVTKEPIPVLPTVHYNMGGIPTRYTGEVIRQNEKGEDVVVPGLYAAGEAACVSVHGAN  418

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRA A+ +AE   PG   KP   DAG  TIA LDKLRN++GS  TS 
Sbjct  419  RLGANSLLDIVVFGRAVAHHIAETLEPGTPLKPFAADAGANTIANLDKLRNADGSKRTSE  478

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL MQ+VMQ++AAVFRTQETL+EG K ID  ++SF DVKV DR +IWN+DL ET+EL+N
Sbjct  479  IRLAMQKVMQSDAAVFRTQETLDEGVKKIDQVFKSFSDVKVSDRGMIWNTDLTETLELQN  538

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM+SA  R ESRGAHAR+DF +RDDE WMKHTL Y + E  +V+L YR V  N
Sbjct  539  LLTCAAQTMHSAAVRTESRGAHARDDFKERDDENWMKHTLSYQDQETGEVKLAYRSVEAN  598

Query  70   TLDD-EIETFPPKARVY  23
            TLD+ E +  PP ARVY
Sbjct  599  TLDENECKPVPPFARVY  615



>ref|WP_037490026.1| fumarate reductase, partial [Sphingobium japonicum]
Length=341

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 186/255 (73%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVT++PIPVLPT  Y MGG+P N+HG  ++  G DPDA+VPGLMAAGEAAC SVHGAN
Sbjct  87   GVDVTRQPIPVLPTAHYCMGGVPANYHGHAISAAGGDPDAIVPGLMAAGEAACVSVHGAN  146

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG NSLLDIVVFGRA A R AE+  PG  Q  L  DAG  +IA  DKLR++ G  PT  
Sbjct  147  RLGCNSLLDIVVFGRAAALRCAEMLIPGAAQPELPADAGAASIARFDKLRHAKGQTPTPQ  206

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQR MQ+ A VFRT + L+EG + +   W+   D+ V DRS+IWNSDL+ET+E EN
Sbjct  207  LRLKMQRTMQSFATVFRTGDILKEGEQGLREVWDGLSDIGVSDRSMIWNSDLLETLEFEN  266

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE-NEKVRLDYRPVHMNT  68
            LL+ A   + SA AR ESRGAHAREDF  RDDEKWMKH+L + +    VRLDYRPVH  T
Sbjct  267  LLLQATALVGSAIARTESRGAHAREDFPDRDDEKWMKHSLAWVDPTGAVRLDYRPVHTFT  326

Query  67   LDDEIETFPPKARVY  23
            L ++I+   PKARVY
Sbjct  327  LTEDIQYIEPKARVY  341



>ref|WP_039409054.1| fumarate reductase [Xanthomonas campestris]
 gb|KGK58261.1| fumarate reductase [Xanthomonas sp. Nyagatare]
 gb|KHL54088.1| fumarate reductase [Xanthomonas campestris pv. cannabis]
 gb|KHL56101.1| fumarate reductase [Xanthomonas campestris pv. cannabis]
Length=596

 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN++GEVV  +G++PDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNYYGEVVRKQGDNPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +  +  KPL  DA +K +  LDKLR +NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKTNQPHKPLPSDACDKALGLLDKLRYANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFASFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   +YRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFEYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_023904093.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas hortorum]
 gb|ETC88043.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas hortorum 
pv. carotae str. M081]
Length=596

 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR +NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRYANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   +YRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFEYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSQDVDVVPPKPRVY  596



>ref|WP_038689043.1| fumarate reductase [Stenotrophomonas rhizophila]
 gb|AHY59442.1| fumarate reductase [Stenotrophomonas rhizophila]
Length=596

 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDV K+PIPV+PTV Y MGGIPTN+HGEVV   G++ DAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVHKQPIPVIPTVHYNMGGIPTNYHGEVVRKLGDNNDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  + G   K L  DA +K +  LDKLR +NG  PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETIKSGAPHKTLPSDACDKALGLLDKLRYANGDTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQN+AAVFRT +TLEEGC  +   ++SF DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQNDAAVFRTSKTLEEGCSKMAEIYDSFQDVKVTDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAHA EDF  RDD  W KHTL   +++ K   +YRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHAHEDFPDRDDVNWQKHTLVNVDDKGKCSFEYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_005995652.1| succinate dehydrogenase [Xanthomonas vesicatoria]
 gb|EGD08003.1| succinate dehydrogenase subunit A [Xanthomonas vesicatoria ATCC 
35937]
 gb|KHM93431.1| fumarate reductase [Xanthomonas vesicatoria]
 gb|KHM97328.1| fumarate reductase [Xanthomonas vesicatoria]
Length=596

 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR +NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRYANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   +YRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFEYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>emb|CDS14431.1| Putative Genomic scaffold, msy_sf_7 [Absidia idahoensis var. 
thermophila]
Length=627

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/257 (66%), Positives = 194/257 (75%), Gaps = 3/257 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPT + GEV+       D VVPGL AAGEAAC SVHGAN
Sbjct  371  GVDVTKEPIPVLPTVHYNMGGIPTRYTGEVIRQNEKGEDVVVPGLYAAGEAACVSVHGAN  430

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDIVVFGRA A+ +AE   PG   KP   DAG  TIA LDKLRN++GS  TS 
Sbjct  431  RLGANSLLDIVVFGRAVAHHIAETLEPGTPLKPFAADAGANTIANLDKLRNADGSKRTSE  490

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL MQ+VMQ++AAVFRTQETL+EG K ID  ++SF DVKV DR +IWN+DL ET+EL+N
Sbjct  491  IRLAMQKVMQSDAAVFRTQETLDEGVKKIDEVFKSFSDVKVSDRGMIWNTDLTETLELQN  550

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE--KVRLDYRPVHMN  71
            LL  A  TM+SA  R ESRGAHAR+DF +RDDE WMKHTL Y + E  +V+L YR V  N
Sbjct  551  LLTCAAQTMHSAAVRTESRGAHARDDFKERDDENWMKHTLSYQDQETGEVKLAYRSVEAN  610

Query  70   TLDD-EIETFPPKARVY  23
            TLD+ E +  PP ARVY
Sbjct  611  TLDENECKPVPPFARVY  627



>ref|XP_007871954.1| hypothetical protein PNEG_00097 [Pneumocystis murina B123]
 gb|EMR11659.1| hypothetical protein PNEG_00097 [Pneumocystis murina B123]
Length=646

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 197/257 (77%), Gaps = 3/257 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            G+DVTK+PIPVLPTV Y MGGIPT   GEV+T+     D VVPGL AAGEAAC SVHGAN
Sbjct  390  GIDVTKDPIPVLPTVHYNMGGIPTKFTGEVITLDNEGNDKVVPGLYAAGEAACVSVHGAN  449

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLGANSLLDI+VFGRACAN + E  +P    KPL  DAG  +I  LDKLRN+NGS+PT+ 
Sbjct  450  RLGANSLLDIIVFGRACANHIKETLKPKTSCKPLSSDAGLASIQNLDKLRNANGSIPTAK  509

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRLNMQRVMQ + +VFRT+E+L++G + I    ESF+DVK  DR LIWN+DLIET+EL+N
Sbjct  510  IRLNMQRVMQTDVSVFRTEESLQKGVENIMKVDESFNDVKTTDRGLIWNTDLIETLELQN  569

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE--NEKVRLDYRPVHMN  71
            LL NAC T +SA ARKESRGAHARED+ +RDD+ WMKHTL + +    KV L YRPV  +
Sbjct  570  LLTNACQTAHSALARKESRGAHAREDYKERDDKNWMKHTLSWQDPITRKVTLRYRPVKSH  629

Query  70   TLDD-EIETFPPKARVY  23
            TLD+ E ++ PP  RVY
Sbjct  630  TLDENECKSVPPSKRVY  646



>ref|WP_040405724.1| fumarate reductase [Chelatococcus sp. GW1]
Length=606

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN HGEVVT  G++PD VVPGLMA GEAAC SVHGAN
Sbjct  351  GVDVTKEPIPVLPTVHYNMGGIPTNFHGEVVTKAGDNPDHVVPGLMAIGEAACVSVHGAN  410

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI +PGE    L K++ + +++ LD+ RN++G  PT+ 
Sbjct  411  RLGSNSLIDLVVFGRAAGLRAAEIVKPGESHADLPKNSADLSLSRLDRFRNASGGTPTAE  470

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQR MQ+N AVFRT E LEEG KLI   W    DV+V DRSL+WNSDLIET+E +N
Sbjct  471  LRLQMQRTMQSNCAVFRTGEVLEEGQKLIREVWHGAEDVRVTDRSLVWNSDLIETLEFDN  530

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            L+  A +TM  A  RKESRGAHARED+++RDD  WMKHTL + ++  + V +DYRPVH  
Sbjct  531  LITQAVVTMDGAANRKESRGAHAREDYSERDDVNWMKHTLAWVDDTAKTVTIDYRPVHNY  590

Query  70   TLDDEIETFPPKARVY  23
            T+ ++IE   PKARVY
Sbjct  591  TMSNDIEYIEPKARVY  606



>ref|WP_026601242.1| fumarate reductase [Methylomonas sp. 11b]
Length=594

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 194/254 (76%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVD TK+PIPVLPTV Y MGGIPTN+  EVVT+K  +PD VVPGLMA GE AC SVHGAN
Sbjct  341  GVDATKQPIPVLPTVHYNMGGIPTNYKAEVVTLKDGNPDYVVPGLMAIGETACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA A R  E+ +PG   KPL KDA +  ++  DK+RN+NGS  T+ 
Sbjct  401  RLGSNSLLDLVVFGRAAAIRCTELIKPGMPHKPLAKDATDHALSRFDKIRNANGSRTTAE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR++MQ  MQ+ AAVFRT+ TL EG K I     SF DVKV D+SLIWN+DL+ET+EL+N
Sbjct  461  IRMDMQTTMQSKAAVFRTESTLNEGIKAIGEIAASFDDVKVGDKSLIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL  A +T+ +A  R+ESRG HARED+ KRDD+ WMKHTL + E+ KV++DYRPVH+ TL
Sbjct  521  LLGQAQVTITAAGNRQESRGGHAREDYPKRDDKNWMKHTLTWREDNKVKIDYRPVHLYTL  580

Query  64   DDEIETFPPKARVY  23
             DE+E   PK RVY
Sbjct  581  TDEVEVVAPKERVY  594



>ref|WP_022727865.1| succinate dehydrogenase [Fodinicurvata sediminis]
Length=595

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPT  Y MGGIPTN+HGEV+TVK  DP+ VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTCHYNMGGIPTNYHGEVLTVKDGDPNTVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA   R AE   PGE  + L  DA E +++ LD  RN+ G  PT+ 
Sbjct  401  RLGSNSLLDLVVFGRAAGKRCAETMTPGEGHRALPADADEMSLSRLDHFRNAKGETPTAA  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
             RL+MQ+VMQ +AAVFRT ETL EG   + + W    D+ V DRSLIWNSDL+ET+E +N
Sbjct  461  HRLDMQKVMQTHAAVFRTGETLGEGSSKLKDVWTRRQDISVSDRSLIWNSDLMETLEYDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            L+  A  TM SA AR+ESRGAHAREDF  RDDEKWMKH++ + +++ K  LD RPVHM  
Sbjct  521  LIYQAVATMESAGAREESRGAHAREDFPDRDDEKWMKHSVVWVDDKGKATLDSRPVHMQP  580

Query  67   LDDEIETFPPKARVY  23
            + ++++TFPPKARVY
Sbjct  581  MTNDVQTFPPKARVY  595



>ref|WP_024080439.1| Succinate dehydrogenase flavoprotein subunit [Magnetospirillum 
gryphiswaldense]
 emb|CAM75703.1| succinate dehydrogenase flavoprotein subunit [Magnetospirillum 
gryphiswaldense MSR-1]
 emb|CDK99431.1| Succinate dehydrogenase flavoprotein subunit [Magnetospirillum 
gryphiswaldense MSR-1 v2]
Length=593

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 189/254 (74%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN HGEV+    ++PDA V GLMA GEAAC SVHGAN
Sbjct  340  GVDVTKQPIPVLPTVHYNMGGIPTNVHGEVLRPTADNPDATVEGLMAIGEAACVSVHGAN  399

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG NSLLDIVVFGRA A R AE  +PG   KPL KDAG+  +A  D+LRN+NGSL TS 
Sbjct  400  RLGTNSLLDIVVFGRAAALRAAETLKPGTTHKPLAKDAGDNAVARFDRLRNANGSLHTSE  459

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL MQ+ MQN+AAVFRT +TL EGC  ++    +   +K+ DRS +WNSDL+E +ELEN
Sbjct  460  IRLAMQKTMQNDAAVFRTSKTLAEGCAKMEQVASTLPQIKINDRSTVWNSDLVEALELEN  519

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            L+  A  T+ SAEAR ESRGAHA ED+  RDD  W KH+L + EN KV+LDYRPVH  TL
Sbjct  520  LMDCAQATIVSAEARHESRGAHAHEDYPDRDDVNWQKHSLAWVENGKVKLDYRPVHTYTL  579

Query  64   DDEIETFPPKARVY  23
             DE+E   P+ RVY
Sbjct  580  TDEVEYIKPQKRVY  593



>ref|WP_019867976.1| succinate dehydrogenase [Methylovulum miyakonense]
Length=594

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 192/254 (76%), Gaps = 0/254 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+  EVVT++  +PD VVPGLMA GEAAC SVHGAN
Sbjct  341  GVDVTKEPIPVLPTVHYNMGGIPTNYKAEVVTLENGNPDKVVPGLMAIGEAACVSVHGAN  400

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD++VFGR+ A R AE+ +PG   KPL KDA    +A  DK+RN+NGS  T+ 
Sbjct  401  RLGSNSLLDLIVFGRSAAIRCAELIKPGTAHKPLNKDACGAALARFDKIRNANGSRSTAE  460

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IRL+MQR MQ  AAVFRTQ TL+EG   +     SF DV V+D+SLIWN+DL+ET+EL+N
Sbjct  461  IRLDMQRTMQTKAAVFRTQTTLDEGIAAMAKISASFADVTVKDKSLIWNTDLVETLELDN  520

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENEKVRLDYRPVHMNTL  65
            LL  A + + +A  RKESRG HARED+  RDD  WMKHTL +  + +V +DYRPVH+ TL
Sbjct  521  LLAQANVAINAAGNRKESRGGHAREDYPNRDDANWMKHTLTWLTDGQVGIDYRPVHLYTL  580

Query  64   DDEIETFPPKARVY  23
             D++E  PPK RVY
Sbjct  581  SDDVEAIPPKERVY  594



>ref|WP_011258983.1| succinate dehydrogenase [Xanthomonas oryzae]
 gb|AAT74621.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae 
pv. oryzae]
 gb|AAW75562.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae 
pv. oryzae KACC 10331]
 dbj|BAE68941.1| succinate dehydrogenase flavoprotein subunit [Xanthomonas oryzae 
pv. oryzae MAFF 311018]
Length=596

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+DPDAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L   A +K +  LDKLR++NGS PTS 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSYACDKALGLLDKLRHANGSTPTSV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_036360904.1| fumarate reductase [Microvirga lupini]
Length=607

 Score =   331 bits (849),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTKEPIPVLPTV Y MGGIPTN+HGEV+T+K  +PD VVPGLMA GEAAC SVHGAN
Sbjct  352  GVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGAN  411

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSL+D+VVFGRA   R AEI  P  +   L K+A E  ++ LDK R +NGS  T+ 
Sbjct  412  RLGSNSLIDLVVFGRAAGLRCAEILEPNARHADLLKNADELALSRLDKFRYANGSTSTAE  471

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            +RL MQ+ MQNN AVFRT E LEEG KLI + W +  D+KV DRSLIWN+DL+ET+E +N
Sbjct  472  LRLQMQKTMQNNCAVFRTGEVLEEGKKLIHDVWNAAADIKVTDRSLIWNTDLLETLEFDN  531

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN--EKVRLDYRPVHMN  71
            L+  A +TM  A  R+ESRGAHAREDF++RDD+ WMKHTL + ++   KV LDYRPVH  
Sbjct  532  LIGQAVVTMEGALNRQESRGAHAREDFSERDDKNWMKHTLAWIDDTSHKVTLDYRPVHTY  591

Query  70   TLDDEIETFPPKARVY  23
            T+ ++I+   PKARVY
Sbjct  592  TMSNDIQYIEPKARVY  607



>ref|WP_017167451.1| succinate dehydrogenase [Xanthomonas axonopodis]
Length=596

 Score =   330 bits (847),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+D DAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDADAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K +  LDKLR++NGS PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMSEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



>ref|WP_022559172.1| MULTISPECIES: Probable succinate dehydrogenase flavoprotein subunit 
[Xanthomonas]
 ref|YP_008638922.1| Probable succinate dehydrogenase flavoprotein subunit [Xanthomonas 
fuscans subsp. fuscans]
 emb|CDF61717.1| Probable succinate dehydrogenase flavoprotein subunit [Xanthomonas 
fuscans subsp. fuscans]
 gb|KGK64771.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP27285.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP28947.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP29049.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP35599.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGT56095.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU38918.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU43034.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU50959.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF73487.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KIF11748.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
 gb|KII96601.1| fumarate reductase [Xanthomonas axonopodis pv. phaseoli]
Length=596

 Score =   330 bits (847),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 194/255 (76%), Gaps = 1/255 (0%)
 Frame = -1

Query  784  GVDVTKEPIPVLPTVXYXMGGIPTNHHGEVVTVKGNDPDAVVPGLMAAGEAACASVHGAN  605
            GVDVTK+PIPVLPTV Y MGGIPTN +GEVV  +G+D DAVVPGL A GEAAC SVHGAN
Sbjct  342  GVDVTKQPIPVLPTVHYNMGGIPTNFYGEVVRKQGDDADAVVPGLYAIGEAACVSVHGAN  401

Query  604  RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGEKTIAWLDKLRNSNGSLPTSN  425
            RLG+NSLLD+VVFGRA ANR AE  +P +  K L  DA +K++  LDKLR++NGS PT+ 
Sbjct  402  RLGSNSLLDLVVFGRAVANRCAETVKPNQPHKTLPSDACDKSLGLLDKLRHANGSTPTAV  461

Query  424  IRLNMQRVMQNNAAVFRTQETLEEGCKLIDNAWESFHDVKVEDRSLIWNSDLIETVELEN  245
            IR NMQR MQ++AAVFRT +TL+EG   +   + +F DVKV DRSL+WNSDLIET EL N
Sbjct  462  IRDNMQRTMQSDAAVFRTSKTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNN  521

Query  244  LLINACITMYSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE-KVRLDYRPVHMNT  68
            LL+NA  T+ SAE RKESRGAH+ EDF  RDD  W KHTL   +++ K   DYRPVHM T
Sbjct  522  LLLNAVATINSAEQRKESRGAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYT  581

Query  67   LDDEIETFPPKARVY  23
            L  +++  PPK RVY
Sbjct  582  LSKDVDVVPPKPRVY  596



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150