BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023L14

Length=746
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    410   7e-140   Elaeis guineensis
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    410   2e-139   Oryza brachyantha
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     409   2e-139   Sesamum indicum [beniseed]
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                407   6e-139   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     408   9e-139   Solanum lycopersicum
gb|KJB83533.1|  hypothetical protein B456_013G252200                    405   2e-138   Gossypium raimondii
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    407   2e-138   
gb|AAL47679.1|  aminotransferase 1                                      407   3e-138   Cucumis melo [Oriental melon]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             407   3e-138   Prunus persica
gb|KJB54393.1|  hypothetical protein B456_009G074800                    403   3e-138   Gossypium raimondii
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     406   4e-138   Prunus mume [ume]
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             400   4e-138   
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    406   5e-138   Cucumis sativus [cucumbers]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    405   6e-138   Solanum tuberosum [potatoes]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     405   7e-138   Fragaria vesca subsp. vesca
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     405   7e-138   Pyrus x bretschneideri [bai li]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     405   1e-137   Nicotiana tomentosiformis
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             402   1e-137   
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     405   1e-137   Gossypium hirsutum [American cotton]
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     405   1e-137   Nicotiana sylvestris
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       405   2e-137   Gossypium arboreum [tree cotton]
gb|AAQ56192.1|  aminotransferase 1                                      404   3e-137   Cucumis melo [Oriental melon]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     404   3e-137   Malus domestica [apple tree]
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                404   5e-137   Cucumis melo [Oriental melon]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         404   5e-137   Ricinus communis
gb|KJB54389.1|  hypothetical protein B456_009G074800                    403   5e-137   Gossypium raimondii
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     403   6e-137   
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      402   1e-136   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     402   2e-136   Tarenaya hassleriana [spider flower]
ref|NP_001062170.1|  Os08g0502700                                       402   3e-136   
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          402   3e-136   Amborella trichopoda
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     401   3e-136   Nelumbo nucifera [Indian lotus]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     401   3e-136   Eucalyptus grandis [rose gum]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             401   3e-136   Fritillaria agrestis
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     401   4e-136   Elaeis guineensis
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    401   5e-136   Sesamum indicum [beniseed]
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             401   5e-136   Populus trichocarpa [western balsam poplar]
dbj|BAJ90006.1|  predicted protein                                      401   5e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         400   7e-136   Jatropha curcas
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     400   8e-136   Phoenix dactylifera
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  400   9e-136   Citrus sinensis [apfelsine]
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     399   1e-135   Peperomia schizandra
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   1e-135   Citrus sinensis [apfelsine]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     400   1e-135   Triticum urartu
gb|ABQ81922.1|  aminotransferase 2                                      400   2e-135   Cucumis sativus [cucumbers]
gb|ABK24112.1|  unknown                                                 399   2e-135   Picea sitchensis
gb|ACN39798.1|  unknown                                                 399   2e-135   Picea sitchensis
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    399   2e-135   Cucumis melo [Oriental melon]
gb|ABQ81924.1|  aminotransferase 2                                      399   2e-135   Cucumis sativus [cucumbers]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           399   2e-135   Cucumis melo [Oriental melon]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            399   2e-135   Cucumis melo [Oriental melon]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    394   2e-135   
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       399   2e-135   Gossypium arboreum [tree cotton]
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     399   2e-135   Populus euphratica
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     397   4e-135   Peperomia bracteata
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     397   5e-135   Peperomia cerrateae
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     398   5e-135   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     397   6e-135   Peperomia cerrateae
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     397   6e-135   Peperomia cerrateae
gb|AFK37194.1|  unknown                                                 392   6e-135   Medicago truncatula
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             398   6e-135   Citrus clementina [clementine]
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     396   9e-135   Peperomia bracteata
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     395   1e-134   Peperomia cavispicata
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia radiatinervosa
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia bracteata
gb|ABQ81925.1|  aminotransferase 2                                      397   2e-134   Cucumis melo [Oriental melon]
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia bracteata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia bracteata
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia radiatinervosa
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     395   2e-134   Peperomia ayacuchoana
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     395   3e-134   Peperomia parvisagittata
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    396   3e-134   Glycine max [soybeans]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    396   3e-134   Cucumis sativus [cucumbers]
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     395   3e-134   Peperomia radiatinervosa
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    396   3e-134   Setaria italica
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      396   5e-134   Genlisea aurea
gb|AAQ56193.1|  aminotransferase 2                                      396   5e-134   Cucumis melo [Oriental melon]
emb|CBI24214.3|  unnamed protein product                                395   5e-134   Vitis vinifera
ref|NP_001237048.1|  enzymatic resistance protein                       395   6e-134   
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     394   6e-134   Peperomia bracteata
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    395   6e-134   Glycine max [soybeans]
emb|CDP08481.1|  unnamed protein product                                395   6e-134   Coffea canephora [robusta coffee]
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     394   7e-134   Peperomia parvisagittata
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     395   7e-134   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                395   9e-134   Medicago truncatula
ref|XP_002313371.1|  aminotransferase 2 family protein                  395   9e-134   
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     394   1e-133   Peperomia andina
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    396   1e-133   
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     393   1e-133   Peperomia pseudoverruculosa
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     394   2e-133   Vitis vinifera
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    394   2e-133   
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     392   2e-133   Peperomia questionis
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           394   3e-133   Glycine max [soybeans]
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     392   3e-133   Peperomia verruculosa
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    394   3e-133   Populus euphratica
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     394   3e-133   Glycine soja [wild soybean]
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     392   3e-133   Peperomia verruculosa
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      394   3e-133   Spirodela polyrhiza
gb|ACN36238.1|  unknown                                                 391   3e-133   Zea mays [maize]
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    394   4e-133   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN84001.1|  hypothetical protein VITISV_007680                     394   4e-133   Vitis vinifera
gb|AFK40703.1|  unknown                                                 394   4e-133   Medicago truncatula
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     395   5e-133   Brachypodium distachyon [annual false brome]
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    393   6e-133   Glycine max [soybeans]
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     391   7e-133   Peperomia bracteata
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             392   9e-133   Phaseolus vulgaris [French bean]
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     391   9e-133   Peperomia peruviana
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     391   1e-132   Peperomia parvifolia
gb|KJB54391.1|  hypothetical protein B456_009G074800                    385   1e-132   Gossypium raimondii
gb|ABK96624.1|  unknown                                                 392   1e-132   Populus trichocarpa x Populus deltoides
ref|NP_001148339.1|  LOC100281949                                       392   1e-132   Zea mays [maize]
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     390   2e-132   Peperomia rupiseda
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    392   2e-132   Phaseolus vulgaris [French bean]
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     389   4e-132   Peperomia sp. JN-2011
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          391   5e-132   Sorghum bicolor [broomcorn]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             390   5e-132   
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     389   6e-132   Peperomia chutanka
emb|CDX81443.1|  BnaC09g08540D                                          390   8e-132   
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     390   9e-132   Brassica rapa
emb|CDY37208.1|  BnaA09g08290D                                          390   1e-131   Brassica napus [oilseed rape]
dbj|BAJ33858.1|  unnamed protein product                                391   1e-131   Eutrema halophilum
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     388   1e-131   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     388   2e-131   Peperomia aff. gracillima JN-2011
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     387   4e-131   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    388   7e-131   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     385   2e-130   Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     385   3e-130   Peperomia pugnicaudex
emb|CDX89604.1|  BnaC03g45180D                                          386   4e-130   
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    385   7e-130   Camelina sativa [gold-of-pleasure]
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     384   8e-130   Peperomia polycephala
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    385   1e-129   Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     383   1e-129   Peperomia peruviana
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  384   3e-129   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      382   9e-129   Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             382   1e-128   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             379   3e-127   Capsella rubella
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     371   4e-125   Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     371   7e-125   Peperomia putlaensis
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    373   2e-124   Camelina sativa [gold-of-pleasure]
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     369   2e-124   Peperomia cyclaminoides
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     368   4e-124   Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     369   5e-124   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     368   7e-124   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     367   1e-123   Peperomia aff. ovatopeltata JN-2011
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     366   2e-123   Peperomia cyclaminoides
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     366   2e-123   Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     366   3e-123   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     366   4e-123   Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     365   1e-122   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     363   3e-122   Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     361   3e-121   Peperomia sp. JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     360   9e-121   Peperomia exclamationis
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     360   1e-120   Peperomia aff. ovatopeltata JN-2011
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    353   2e-117   Cicer arietinum [garbanzo]
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     349   5e-117   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     349   1e-116   Peperomia aff. pinoi JN-2011
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                349   8e-116   Medicago truncatula
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     345   3e-115   Peperomia jalcaensis
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     345   4e-115   Peperomia parvisagittata
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     345   4e-115   Peperomia elatior
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     343   2e-114   Peperomia wernerrauhii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     342   7e-114   Peperomia schizandra
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             344   1e-113   Selaginella moellendorffii
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     341   1e-113   Peperomia cerrateae
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     340   3e-113   Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     339   3e-113   Peperomia dolabella
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             343   4e-113   
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     339   8e-113   Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     338   2e-112   Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     338   3e-112   Peperomia wernerrauhii
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     323   7e-107   Peperomia sp. JN-2011
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             325   2e-106   Selaginella moellendorffii
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                323   3e-106   Morus notabilis
ref|XP_001755667.1|  predicted protein                                  325   4e-106   
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             324   7e-106   Selaginella moellendorffii
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     320   2e-105   Peperomia aff. ovatopeltata JN-2011
ref|XP_001783551.1|  predicted protein                                  323   2e-105   
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             322   3e-105   
gb|ABR16109.1|  unknown                                                 319   1e-104   Picea sitchensis
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              312   1e-103   
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                318   2e-103   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  316   4e-103   Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              310   6e-101   
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                303   2e-98    
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     295   7e-96    
gb|AEA48973.1|  glyoxylate aminotransferase                             286   1e-94    Rosa roxburghii [chestnut rose]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                288   1e-92    
ref|XP_001763095.1|  predicted protein                                  290   2e-92    
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              266   9e-87    
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      255   2e-82    Oryza sativa Indica Group [Indian rice]
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     253   1e-81    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     251   1e-80    Phaseolus vulgaris [French bean]
gb|AGN53916.1|  glyoxylate aminotransferase                             241   7e-77    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             240   1e-76    Silene latifolia
gb|AGN53915.1|  glyoxylate aminotransferase                             240   1e-76    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             239   2e-76    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             239   2e-76    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             238   5e-76    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             238   9e-76    Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             238   1e-75    Silene latifolia
gb|AGN53897.1|  glyoxylate aminotransferase                             237   2e-75    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             237   2e-75    Silene vulgaris [maiden's-tears]
gb|AGN53921.1|  glyoxylate aminotransferase                             236   3e-75    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             236   4e-75    Silene vulgaris [maiden's-tears]
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     242   3e-74    Methyloceanibacter caenitepidi
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                243   4e-74    
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    240   2e-73    Methylobacterium aquaticum
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                240   6e-73    Methylocapsa aurea
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 236   4e-72    Auxenochlorella protothecoides
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    236   7e-72    Methylocystaceae
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                236   2e-71    Methylosinus sp. LW4
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                235   2e-71    Methylosinus
gb|AEW08188.1|  hypothetical protein 2_2585_01                          227   2e-71    Pinus lambertiana
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                234   5e-71    Methylocaldum szegediense
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                234   5e-71    Methylocella silvestris
ref|XP_005709273.1|  serine--glyoxylate transaminase                    234   1e-70    Galdieria sulphuraria
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                233   2e-70    Methylocapsa acidiphila
gb|AFG57258.1|  hypothetical protein 2_2585_01                          224   2e-70    Pinus taeda
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      232   3e-70    Hyphomicrobium nitrativorans NL23
gb|AEW08187.1|  hypothetical protein 2_2585_01                          223   3e-70    Pinus radiata
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                232   4e-70    Methylosinus
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                232   5e-70    
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                232   8e-70    Paraburkholderia sacchari
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              231   3e-69    Volvox carteri f. nagariensis
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                228   3e-68    Methylobacterium nodulans
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     226   4e-68    Methylorubrum extorquens DM4
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                228   4e-68    Paraburkholderia phymatum
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                226   5e-68    Dongia sp. URHE0060
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                226   7e-68    Methylorubrum extorquens
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                226   8e-68    Methylobacteriaceae
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                226   1e-67    Methylobacterium sp. MB200
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                226   1e-67    Paraburkholderia hospita
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                226   1e-67    Paraburkholderia caribensis
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                226   1e-67    Methylorubrum populi
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                225   2e-67    Methylocystis parvus
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                226   2e-67    Methylobacterium sp. WSM2598
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                225   2e-67    Methylobacteriaceae
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                226   2e-67    Burkholderiaceae
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                226   2e-67    Methylobacterium sp. 4-46
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                226   2e-67    Caballeronia glathei
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                226   2e-67    Paraburkholderia terrae
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                224   3e-67    Methyloversatilis universalis
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                225   4e-67    Burkholderia sp. UYPR1.413
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                224   6e-67    Hyphomicrobium zavarzinii
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                224   7e-67    Methylocystis sp. ATCC 49242
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                224   9e-67    Paraburkholderia mimosarum
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                223   1e-66    Hyphomicrobium denitrificans
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                223   1e-66    Methylohalobius crimeensis
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    213   2e-66    Prunus avium [gean]
gb|KIZ03753.1|  serine--glyoxylate transaminase                         223   2e-66    Monoraphidium neglectum
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    222   3e-66    Methylobacterium
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                222   3e-66    Granulibacter bethesdensis
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                222   3e-66    Granulibacter bethesdensis
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                222   4e-66    Sinorhizobium fredii
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                222   4e-66    Sinorhizobium fredii
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    222   4e-66    Hyphomicrobium methylovorum
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    222   5e-66    Methylibium
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                221   5e-66    Ferrovum
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                221   6e-66    
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      222   6e-66    Methylibium petroleiphilum PM1
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     222   6e-66    Granulibacter bethesdensis
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                222   7e-66    Paraburkholderia oxyphila
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        222   7e-66    Granulibacter bethesdensis CGDNIH4
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                221   8e-66    Methylobacterium
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                221   1e-65    Methyloversatilis universalis
ref|WP_010687105.1|  Aminotransferase class V                           221   1e-65    Methylobacterium mesophilicum
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    211   1e-65    Hedera helix [English ivy]
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                220   2e-65    Granulibacter bethesdensis
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                220   2e-65    Mesorhizobium australicum
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 221   2e-65    Coccomyxa subellipsoidea C-169
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                219   3e-65    Hyphomicrobium denitrificans
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                219   3e-65    Methylobacterium sp. 88A
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        220   3e-65    Granulibacter bethesdensis
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                219   3e-65    Methyloversatilis discipulorum
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                219   4e-65    Sinorhizobium meliloti
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                219   5e-65    Ensifer sp. USDA 6670
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                219   5e-65    Mesorhizobium
gb|AID30749.1|  serine--glyoxylate aminotransferase                     214   6e-65    
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                218   6e-65    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                219   6e-65    
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                218   7e-65    
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    209   8e-65    
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                218   8e-65    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                218   9e-65    
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                214   1e-64    
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                213   1e-64    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                213   2e-64    
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                214   2e-64    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                218   2e-64    
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    208   2e-64    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    217   2e-64    
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                213   2e-64    
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                217   3e-64    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                216   4e-64    
emb|CAM59877.2|  alanine:glyoxylate aminotransferase                    207   4e-64    
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    216   5e-64    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                216   6e-64    
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                216   7e-64    
emb|CAM59872.1|  alanine:glyoxylate aminotransferase                    207   7e-64    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                216   7e-64    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                216   9e-64    
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    215   1e-63    
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_020188076.1|  hypothetical protein                               215   2e-63    
emb|CAM84338.1|  alanine:glyoxylate aminotransferase                    206   2e-63    
emb|CAM59873.1|  alanine:glyoxylate aminotransferase                    205   3e-63    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    214   4e-63    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                214   5e-63    
gb|AIQ91949.1|  Aminotransferase class V                                215   5e-63    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                213   5e-63    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                213   6e-63    
ref|WP_020592928.1|  hypothetical protein                               213   6e-63    
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                213   7e-63    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                213   7e-63    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                213   7e-63    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                213   8e-63    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                213   1e-62    
emb|CAM59868.2|  alanine:glyoxylate aminotransferase                    203   2e-62    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                212   3e-62    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                211   6e-62    
emb|CAM59871.2|  alanine:glyoxylate aminotransferase                    201   1e-61    
emb|CAM59869.2|  alanine:glyoxylate aminotransferase                    201   1e-61    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                209   3e-61    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    209   3e-61    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                209   3e-61    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                209   3e-61    
emb|CAM59870.2|  alanine:glyoxylate aminotransferase                    199   4e-61    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                209   4e-61    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                208   5e-61    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 209   5e-61    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                208   5e-61    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                208   6e-61    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            208   6e-61    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 209   6e-61    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                208   7e-61    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                208   8e-61    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                208   8e-61    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                207   9e-61    
ref|WP_020058450.1|  hypothetical protein                               207   1e-60    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    208   1e-60    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                207   2e-60    
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     203   3e-60    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   3e-60    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                206   3e-60    
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     203   3e-60    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   3e-60    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   3e-60    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   3e-60    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   4e-60    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   5e-60    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   5e-60    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         206   5e-60    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    206   5e-60    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 206   5e-60    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                206   6e-60    
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     202   7e-60    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                205   7e-60    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                205   8e-60    
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     201   8e-60    
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     202   8e-60    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                205   9e-60    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                205   9e-60    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    205   1e-59    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      205   1e-59    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                204   1e-59    
gb|EEE42985.1|  aminotransferase, class V superfamily                   204   1e-59    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    204   2e-59    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                204   3e-59    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                204   3e-59    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                203   4e-59    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                203   6e-59    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                203   6e-59    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                203   6e-59    
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                202   8e-59    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                202   9e-59    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    202   1e-58    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              203   1e-58    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    202   2e-58    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                201   2e-58    
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     198   2e-58    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                201   4e-58    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                201   4e-58    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                201   5e-58    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             202   6e-58    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                200   8e-58    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                200   1e-57    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                199   1e-57    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     199   1e-57    
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    199   1e-57    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                199   1e-57    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                199   2e-57    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                199   2e-57    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    199   2e-57    
ref|WP_039135088.1|  serine--glyoxylate aminotransferase                199   2e-57    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                199   3e-57    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                198   4e-57    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                198   4e-57    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                198   4e-57    
ref|WP_010686651.1|  serine--glyoxylate transaminase                    198   4e-57    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                198   5e-57    
ref|WP_020950386.1|  serine-glyoxylate transaminase                     198   5e-57    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                198   5e-57    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                198   6e-57    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                197   6e-57    
ref|WP_011540013.1|  serine--glyoxylate aminotransferase                197   6e-57    
gb|KIX16576.1|  serine--glyoxylate aminotransferase                     197   8e-57    
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                197   1e-56    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                197   1e-56    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                197   1e-56    
ref|WP_039003054.1|  serine--glyoxylate aminotransferase                197   1e-56    
ref|WP_020094516.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   1e-56    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                196   2e-56    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                196   2e-56    
ref|WP_007427777.1|  serine--glyoxylate aminotransferase                196   2e-56    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   410 bits (1055),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  359  LLGCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   410 bits (1053),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  180  SICAVDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWADYL  239

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RHTRLGTATRLAV+AWGLKNCT
Sbjct  240  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKNCT  299

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  300  QKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  359

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  360  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGIDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDN+IARHTRLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   407 bits (1045),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA SVRVFFDW DYL
Sbjct  137  SICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTATSVRVFFDWNDYL  196

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNVIARHTRL  ATRLAV AWGLKNCT
Sbjct  197  KFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLAKATRLAVDAWGLKNCT  256

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  257  QKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  316

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  317  LLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   408 bits (1048),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   405 bits (1041),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYL
Sbjct  120  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYL  179

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLDN+I RH+RLG ATRLAV+AWGLKNCT
Sbjct  180  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCT  239

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  240  QKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  299

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  300  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   407 bits (1046),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  359  LLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQ
Sbjct  299  QSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  359  LLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   403 bits (1035),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYL
Sbjct  84   SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYL  143

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLDNVIARHTR+G ATRLAV+AWGLKNCT
Sbjct  144  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCT  203

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  204  QKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQ  263

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  264  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   406 bits (1044),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQ
Sbjct  299  QSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  359  LLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   400 bits (1028),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYL
Sbjct  22   SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYL  81

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  82   KFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCT  141

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  142  QKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  201

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  202  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   406 bits (1043),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   405 bits (1042),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   405 bits (1042),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPS+QLLYGLRA LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  359  LLGCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   405 bits (1042),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQ
Sbjct  299  QSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDLLF EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   402 bits (1032),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYL
Sbjct  89   SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYL  148

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  149  KFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCT  208

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  209  QKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  268

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  269  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  311



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLDN+I RH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDLLF EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   405 bits (1040),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCAS KALEA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASQKALEATKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLDNVI RH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   404 bits (1038),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   404 bits (1038),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQ
Sbjct  299  QSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   404 bits (1037),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKAL ASKT+KSV+VFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALVASKTSKSVKVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   404 bits (1037),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGT+WPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGL NCT
Sbjct  239  KFYKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   403 bits (1036),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLDNVIARHTR+G ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   403 bits (1036),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  359  LLGCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPS+QLLYGLRA LDL+F EGLDNVI RH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   402 bits (1033),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAVQAWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   402 bits (1032),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYL
Sbjct  180  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDYL  239

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLR  LDL+F EGL+NVI RH RLGTATRLAV+AWGLKNCT
Sbjct  240  KFYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCT  299

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  300  QKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  359

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            L+G L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  360  LMGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   402 bits (1032),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGIDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  RFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  359  LLGCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGL+NVI RH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS +VFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSYKVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY+MGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RL T TRLAV+AWGLKNCT
Sbjct  239  KFYQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  359  LLGCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALS+PTG+G +CASPKALEASKTA+S RVFFDW DYL
Sbjct  179  SICALDFRMDEWGIDVALTGSQKALSMPTGMGFICASPKALEASKTAQSARVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQ+LYGLRA LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  359  LLGCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   401 bits (1031),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK AKS+RVFFDW DYL
Sbjct  180  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKMAKSLRVFFDWNDYL  239

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  240  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  299

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QK+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  300  QKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  359

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  360  LLGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   401 bits (1030),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS KAL A+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASAKALRATKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAVQAWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   401 bits (1030),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   401 bits (1030),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRAGLDLLF EGLDNVI RHTRLGTATRLAV AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  EKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  LLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   400 bits (1029),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA+SVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTARSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  359  LLGCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   400 bits (1029),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASK AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKMAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  359  LLGCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   400 bits (1028),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+
Sbjct  179  SICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYI  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDL+F EGL+NVI RH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   399 bits (1024),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGXDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+
Sbjct  179  SICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYI  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDL+F EGL+NVI RH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   400 bits (1027),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRAGLDLLF EGLDNVI RHTRLGTATRLAV AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
             KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  AKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  LLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   400 bits (1027),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL
Sbjct  179  SVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  359  LLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL
Sbjct  179  SVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  359  LLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLR  LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   394 bits (1012),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL
Sbjct  40   SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYL  99

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FY MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATRLAV+AWGL NC 
Sbjct  100  RFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCC  159

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  160  QKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  219

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  220  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  262



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLRA LDL+F EGLD+VIARH R+G ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   397 bits (1021),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   397 bits (1020),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   398 bits (1023),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKA+EA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKAMEAAKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  359  LLGCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   397 bits (1019),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   397 bits (1019),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   392 bits (1007),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  742  ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK  563
            ICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLK
Sbjct  17   ICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLK  76

Query  562  FYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  383
            FYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLGTATRLAV+AWGLKNCTQ
Sbjct  77   FYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQ  136

Query  382  KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  203
            +EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL
Sbjct  137  EEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  196

Query  202  LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  197  LGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  238



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   398 bits (1023),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+
Sbjct  179  SICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYI  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDL+F EGL+NVI RH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   396 bits (1018),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   395 bits (1015),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  124  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  183

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  184  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  243

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  244  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  303

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  304  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   395 bits (1015),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  132  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  191

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  192  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  251

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  252  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  311

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  312  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   395 bits (1016),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQK LSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKVLSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   395 bits (1016),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   395 bits (1016),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   395 bits (1015),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  135  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  194

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  195  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  254

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  255  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  314

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  315  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   395 bits (1014),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  133  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  192

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  193  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  252

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  253  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  312

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  313  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   395 bits (1015),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   395 bits (1014),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGRATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  180  SICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYL  239

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCT
Sbjct  240  KSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCT  299

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  300  QKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  359

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  360  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   396 bits (1017),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALSLPTG+GI+CASPKALEA+K+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGIDVALTGSQKALSLPTGLGILCASPKALEATKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  359  LLGCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   396 bits (1017),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMD+WGV VALTGSQKALSLPTG+GIVCASP+ALEASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDDWGVGVALTGSQKALSLPTGVGIVCASPRALEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   395 bits (1014),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYL
Sbjct  152  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYL  211

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYG+RA LD++F EGLDNVI RH+RLG ATRLAV+AWGLKNCT
Sbjct  212  KFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCT  271

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++Q
Sbjct  272  QREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQ  331

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  332  LLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  374



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA L+L+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   394 bits (1013),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K YK+GTYWPYTPSI LLYGLRA LDL+F EGL+NV ARH RL  ATRLA++AWGLKNCT
Sbjct  239  KVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   394 bits (1012),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   395 bits (1016),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFR DEWGVDVALTGSQKALSLPTG+GI+ ASPKALEA+KTAKSVRVFFDW DYL
Sbjct  179  SICALDFRQDEWGVDVALTGSQKALSLPTGMGIISASPKALEATKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLG LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  359  LLGALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   395 bits (1015),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLGTATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   395 bits (1015),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   394 bits (1011),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  215  SICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYL  274

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCT
Sbjct  275  KSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCT  334

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  335  QKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  394

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  395  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   393 bits (1010),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYG+RA LD++F EGLDNVI RH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++Q
Sbjct  299  QREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKA SLPTGIGIV ASPKA+EASK+AKS+RVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKAXSLPTGIGIVVASPKAIEASKSAKSLRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   392 bits (1008),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 210/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  359  LLGCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   392 bits (1007),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  133  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  192

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  193  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  252

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  253  QKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  312

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  313  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD+L
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDHL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   392 bits (1008),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVI RH+RLGTATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  359  LLGCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   391 bits (1004),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL
Sbjct  106  SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYL  165

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FY MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATRLAV+AWGL NC 
Sbjct  166  RFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCC  225

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  226  QKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  285

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  286  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  328



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   394 bits (1011),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEA+K+AKSVRVFFDW DYL
Sbjct  179  SICAIDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKALEAAKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYG RA LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+LQ
Sbjct  299  QKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNDLQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  359  LLGCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   394 bits (1011),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK A+SVR FFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKXAQSVRFFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYG+RA LD++F EGLDNVI RH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++Q
Sbjct  299  QREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  359  LLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   394 bits (1011),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLGTATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  359  LLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   395 bits (1016),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASP+ALEASKTAKSVRVFFDWKDYL
Sbjct  239  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPRALEASKTAKSVRVFFDWKDYL  298

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRAGLDL+F EGLDNVI RHTRLGTATR+AV+AWGLKNCT
Sbjct  299  KFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKNCT  358

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  359  QKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  418

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  419  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   393 bits (1009),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   391 bits (1005),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  133  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  192

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+A GLKNCT
Sbjct  193  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEARGLKNCT  252

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  253  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  312

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  313  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH RLGTATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQ
Sbjct  299  QKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  359  LLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   391 bits (1005),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   391 bits (1004),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 211/219 (96%), Gaps = 0/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D L
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDNL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   385 bits (990),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 207/215 (96%), Gaps = 0/215 (0%)
 Frame = -2

Query  721  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  542
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTF  60

Query  541  WPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  362
            WPYTPSIQLLYGLRA LDL+F EGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SD
Sbjct  61   WPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSD  120

Query  361  TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  182
            TVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV
Sbjct  121  TVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180

Query  181  EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            EM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  181  EMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  215



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  359  LLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL
Sbjct  181  SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYL  240

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FY MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATRLAV+AWGL NC 
Sbjct  241  RFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCC  300

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  301  QKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  360

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  361  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   390 bits (1002),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY++GTYWPYTPSI LLYGLRA LDL+F EGL+NVIARH RLGTATRLAV+AWGLKNCT
Sbjct  239  KFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQ
Sbjct  299  EKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  359  LLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   389 bits (1000),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   391 bits (1004),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 210/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCAS KALEASK A+SVRVFFDWKDYL
Sbjct  180  SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASSKALEASKAARSVRVFFDWKDYL  239

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FY+MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATR AV+AWGLKNC 
Sbjct  240  RFYEMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKNCC  299

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  300  QKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  359

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  360  LLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   390 bits (1003),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   389 bits (999),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 207/215 (96%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   390 bits (1002),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   390 bits (1002),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   390 bits (1002),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  299  QKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  216  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  275

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  276  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  335

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  336  QKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  395

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  396  LLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   388 bits (996),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGEATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   388 bits (996),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   387 bits (993),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   388 bits (996),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/216 (90%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  98
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   385 bits (988),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  107
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   386 bits (991),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQ
Sbjct  299  QKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   384 bits (985),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  107
            LLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   383 bits (983),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   384 bits (985),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   382 bits (981),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 206/214 (96%), Gaps = 0/214 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYL
Sbjct  172  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYL  231

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH+RLG ATR AV+AWGLKNCT
Sbjct  232  KFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKNCT  291

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ
Sbjct  292  QKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  351

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  104
            LLGCLAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  352  LLGCLAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+N+IAR+ RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  359  LLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   379 bits (972),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  359  LLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   371 bits (953),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAA  122
            LLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   371 bits (952),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVA  128
            LLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVA  349



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQ
Sbjct  299  QKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
            LLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  359  LLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   369 bits (947),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  132  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  191

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  192  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  251

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  252  QKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  311

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAA  125
            LLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  312  LLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   368 bits (945),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  123  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  182

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  183  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCT  242

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NELQ
Sbjct  243  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNELQ  302

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAA  122
            LLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  303  LLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   369 bits (946),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAA  125
            LLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   368 bits (944),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  132  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  191

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  192  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  251

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  252  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  311

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAA  125
            LLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  312  LLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   367 bits (941),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  124  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  183

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  184  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  243

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  244  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  303

Query  205  LLGCLAGVEMVLKDIGYPVKLGSG  134
            LLGCL+GVEMVLKD+GYPVK GSG
Sbjct  304  LLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKA SLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  124  SICALDFRMDEWGVDVALTGSQKAPSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  183

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  184  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  243

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  244  QKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  303

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAA  125
            LLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  304  LLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  123  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  182

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  183  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCT  242

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  243  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  302

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVA  128
            LLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  303  LLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   366 bits (939),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  127  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  186

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  187  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  246

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  247  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  306

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVA  128
            LLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  307  LLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   366 bits (940),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVA  128
            LLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   365 bits (936),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVKLG  140
            LLGCL+GVEMVLKD+GYPVK G
Sbjct  324  LLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   363 bits (933),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  133  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  192

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  193  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  252

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  253  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  312

Query  205  LLGCLAGVEMVLKDIGYPVKLG  140
            LLGCL+GVEMVLKD+GYPVK G
Sbjct  313  LLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   361 bits (927),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 181/200 (91%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVI RH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPVK  146
            LLGCL+GVEMVLKD+GYPVK
Sbjct  324  LLGCLSGVEMVLKDVGYPVK  343



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   360 bits (923),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPV  149
            LLGCL+GVEMVLKD+GYPV
Sbjct  324  LLGCLSGVEMVLKDVGYPV  342



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVLKDIGYPV  149
            LLGCL+GVEMVLKD+GYPV
Sbjct  324  LLGCLSGVEMVLKDVGYPV  342



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A+DFRMDEWG+DVA+T SQKALSLPTG+GIVCASPKA+EASK A S+R +FDW  YL
Sbjct  179  SIGALDFRMDEWGIDVAVTSSQKALSLPTGMGIVCASPKAIEASKHATSLRSYFDWNGYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K Y +GTYWPYTPSIQLLYGLRA LDL+F EGL+NVI+RH RL  ATRLAV+AWGLKNC 
Sbjct  239  KCYNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKNCC  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NELQ
Sbjct  299  QNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  359  LLGCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   349 bits (896),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  120  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  179

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  180  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  239

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  240  QKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  299

Query  205  LLGCLAGVEMVLK  167
            LLGCL+GVEMVLK
Sbjct  300  LLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVL  170
            LLGCL+GVEMVL
Sbjct  324  LLGCLSGVEMVL  335



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+EA+K+A SVR FFDW  YL
Sbjct  179  SIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIEATKSATSVRSFFDWNGYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K Y +GTYWPYTPSIQLLYGLRA LDL+F EG +NVI RH RL  ATRLAV+AWGLKNC 
Sbjct  239  KCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKNCC  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNELQ
Sbjct  299  QKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  359  LLGCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   345 bits (885),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  132  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  191

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  192  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  251

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  252  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  311

Query  205  LLGCLAGVEMVL  170
            LLGCL+GVEMVL
Sbjct  312  LLGCLSGVEMVL  323



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   345 bits (886),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVL  170
            LLGCL+GVEMVL
Sbjct  324  LLGCLSGVEMVL  335



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVL  170
            LLGCL+GVEMVL
Sbjct  324  LLGCLSGVEMVL  335



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVEMVL  170
            LLGCL+GVEMVL
Sbjct  324  LLGCLSGVEMVL  335



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   342 bits (877),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGV  182
            LLGCL+GV
Sbjct  324  LLGCLSGV  331



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYL
Sbjct  179  SIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+G+YWPYTPS Q+LY LRA LDL+F EGLDNVI RH RLG ATRLAV AWGLK CT
Sbjct  239  KFYKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQ
Sbjct  299  KRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  359  LLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVE  179
            LLGCL+GVE
Sbjct  324  LLGCLSGVE  332



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   340 bits (873),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGVE  179
            LLGCL+GVE
Sbjct  324  LLGCLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  123  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  182

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  183  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  242

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  243  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  302

Query  205  LLGCLAGVE  179
            LLGCL+GVE
Sbjct  303  LLGCLSGVE  311



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 197/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYL
Sbjct  179  SIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+G+YWPYTPS Q+LY LRA LDL+F EGLDNVI RH RLG ATRLAV AWGLK CT
Sbjct  239  KFYKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQ
Sbjct  299  KRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  359  LLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   339 bits (870),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGV  182
            LLGCL+GV
Sbjct  324  LLGCLSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAG  185
            LLGCL+G
Sbjct  324  LLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   338 bits (866),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLGCLAGV  182
            LLGCL+GV
Sbjct  324  LLGCLSGV  331



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   323 bits (828),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYL
Sbjct  121  SICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYL  180

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  181  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  240

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  241  QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  300

Query  205  L  203
            L
Sbjct  301  L  301



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YL
Sbjct  179  SIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K Y++G+YWPYTPSIQLLYGLRA LDLLF EGL+NVI RH RL  ATRLAV+AWGL+ C 
Sbjct  239  KSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCV  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQ
Sbjct  299  KDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            L+  LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  359  LISALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLRA LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
            QKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  299  QKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKAL A+K +KS RVFFDW DYL
Sbjct  179  SIGAIDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGE-GLDNVIARHTRLGTATRLAVQAWGLKNC  389
            KFY+ GTYWPYTPS Q+LYGLRA LD++  E GLDNVIARH RLG ATR AV+AWGL  C
Sbjct  239  KFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLTLC  298

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
            TQ  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NEL
Sbjct  299  TQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNEL  358

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            Q+LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  359  QMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   324 bits (830),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 196/223 (88%), Gaps = 0/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YL
Sbjct  179  SIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K Y++G+YWPYTPSIQLLYGLRA LDLLF EGL+NVI RH RL  ATRLAV+AWGL+ C 
Sbjct  239  KSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCI  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQ
Sbjct  299  KDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQ  358

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            L+  LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  359  LISALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL
Sbjct  144  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYL  203

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+NVIARH RLG ATRL V+AWGLKNCT
Sbjct  204  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLXVEAWGLKNCT  263

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
             KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  264  PKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNELQ  323

Query  205  LLG  197
            LLG
Sbjct  324  LLG  326



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKALEA+K +KS RVFFDW DYL
Sbjct  179  SIGAIDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGE-GLDNVIARHTRLGTATRLAVQAWGLKNC  389
            KFY+ GTYWPYTPS Q+LYGLRA LD++  E GLDNVIARH RL  ATR AV+AWGL  C
Sbjct  239  KFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLTLC  298

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
            T+  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NEL
Sbjct  299  TKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNEL  358

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            QLLG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  359  QLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYL
Sbjct  179  SICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+ 
Sbjct  299  QKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVT  358

Query  205  LL  200
             +
Sbjct  359  FI  360



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL
Sbjct  179  SVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  212
            Q+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  299  QREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL
Sbjct  40   SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYL  99

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FY MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATRLAV+AWGL NC 
Sbjct  100  RFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCC  159

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
            QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  160  QKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  218



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYL
Sbjct  179  SICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFYKMGTYWPYTPSIQLLYGLRA LDL+F EGL+N+IARH RLGTATRLAV+AWGLKNCT
Sbjct  239  KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            Q+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+ 
Sbjct  299  QEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVT  358

Query  205  LL  200
            L+
Sbjct  359  LI  360



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   316 bits (809),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+
Sbjct  179  SICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYI  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            KFY +GT+WPYTPSIQLLYGLRA LDL+F EGL+NVI RH RLG ATRLAV+AWGLKNCT
Sbjct  239  KFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCT  298

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            QKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE+ 
Sbjct  299  QKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEVM  358

Query  205  L  203
             
Sbjct  359  F  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   310 bits (794),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL
Sbjct  181  SICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYL  240

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +FY MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATRLAV+AWGL NC 
Sbjct  241  RFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCC  300

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
            QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  301  QKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  359



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 182/224 (81%), Gaps = 15/224 (7%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+E                YL
Sbjct  141  SIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIE--------------NGYL  186

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K Y +GTYWPYTPSI LLYGLRA LDL+F EG +NVI RH RL  ATRLAV+AWGLKNC 
Sbjct  187  KCYNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKNCC  246

Query  385  QKEE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
            Q+EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLNEL
Sbjct  247  QQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNEL  306

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            QLLGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  307  QLLGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   295 bits (754),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  625  LEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARH  446
              A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLF EGLDNVI RH
Sbjct  108  FSAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRH  167

Query  445  TRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  266
            TRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGL
Sbjct  168  TRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGL  227

Query  265  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIP  86
            NKVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+IP
Sbjct  228  NKVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIP  287

Query  85   SRI  77
            SRI
Sbjct  288  SRI  290



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   286 bits (733),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -2

Query  577  KDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGL  398
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLF EGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  397  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  218
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  217  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 176/223 (79%), Gaps = 19/223 (9%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A+DFRMDEWGVDV +T SQKALSL TG+GIVCA PKA+EASK+A S+R FFDW  YL
Sbjct  140  SIGALDFRMDEWGVDVVVTSSQKALSLSTGMGIVCAGPKAIEASKSATSLRSFFDWNGYL  199

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K Y +GTYWPYTPSIQLLYGLRA LDL+F EG +NVI RH       +L V         
Sbjct  200  KCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------KLVV---------  243

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
               EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNELQ
Sbjct  244  ---EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNELQ  300

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLGCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  301  LLGCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 183/224 (82%), Gaps = 1/224 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ A+DFRMD+WGVDVALTGSQKALSLPTG+GI+CAS KA+E SK AK  R +FDW +YL
Sbjct  179  SVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYL  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFG-EGLDNVIARHTRLGTATRLAVQAWGLKNC  389
            K YK GTY PYTPS+QLLYGLRA LD++   EGL+NVIARH RL  ATR AV+AWGL  C
Sbjct  239  KSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVC  298

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +NEL
Sbjct  299  ARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNEL  358

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            QLLG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  359  QLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   266 bits (681),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  553  MGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  374
            MGTYWPYTPSIQLLYGLR  LDL+F EGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  373  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  194
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  193  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -2

Query  532  TPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  353
            TPSIQLLYGLR  LDL+F EGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  352  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  173
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  172  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  721  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  542
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  541  WPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  362
            WPYTPSI LLYGLRA LDL+F EGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSD  120

Query  361  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  275
            TVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  721  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  542
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  541  WPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  362
            WPYTPSI LLYGLRA LDL+F EGL+NVIARH RLGTAT LAV+AWGLKNCTQKEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKEEWHSD  120

Query  361  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  275
            TVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (614),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YIDS+EIVKRAWKRYN
Sbjct  121  VVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVI+RH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVISRHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   238 bits (608),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YIDS+EIVK+AWKRYN
Sbjct  121  VVIPPYIDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   238 bits (607),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YIDSS+IVK+AWKRYN
Sbjct  121  VVIPPYIDSSDIVKKAWKRYN  141



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YI+SSEIVK AWKRYN
Sbjct  121  VVIPPYINSSEIVKMAWKRYN  141



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DY+KFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYMKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   236 bits (602),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  709  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  530
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  529  PSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  350
            PSIQLLYGLRA LDL+F EGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  349  VVVPSYIDSSEIVKRAWKRYN  287
            VV+P YI+S+EIVK AWKRYN
Sbjct  121  VVIPPYINSAEIVKMAWKRYN  141



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 163/223 (73%), Gaps = 1/223 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +IDFR DEWGVD+A+TGSQK + LP G+GIVCASPKAL    TA   R +F+  D+ 
Sbjct  148  SIGSIDFRFDEWGVDLAITGSQKGMMLPAGLGIVCASPKALARMDTATCTRAYFNLADHF  207

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  L ++F EGLDN+ ARH  L + TR AV AWGL  C 
Sbjct  208  K-ANAGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSLCA  266

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNEL 
Sbjct  267  KEPKWQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNELM  326

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  77
            LLG ++G EM ++D+G  V+ GSGVAAA  Y +N       R+
Sbjct  327  LLGAISGAEMSMRDVGIQVEPGSGVAAAQEYFRNAHGAADQRL  369



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 160/219 (73%), Gaps = 1/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+ GSQK   LP G+ IV AS KALEA  TAK  RVFF+++D +
Sbjct  182  SIGCIDFRMDEWGVDLAVAGSQKGFMLPAGLAIVGASQKALEARHTAKCARVFFNFEDMI  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTPS+ LLYGLR  + ++F EG +NV  RH  L +  R AV AWGLKNC 
Sbjct  242  KSNATG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKNCA  300

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
             + +WFSDTVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNEL 
Sbjct  301  TEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNELM  360

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            +LG LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  361  VLGALAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 164/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            +I +IDFR +EW VD A+TGSQK L LP G+GIVCAS +ALEASKTA+  RVFFD+ D  
Sbjct  179  AIGSIDFRAEEWRVDCAITGSQKGLMLPAGLGIVCASKRALEASKTAECRRVFFDFGDQA  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ +LYGLR  L  +  EGL+NV ARH RL  +TR AV+AWGL  C 
Sbjct  239  KANATG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTLCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++E+W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNEL 
Sbjct  298  KEEKWYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLG LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  358  LLGALAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 160/213 (75%), Gaps = 1/213 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+ALEASKTA   RVFFD+ D +
Sbjct  174  SIGSLDFRTDEWRVDLAIAGSQKGLMLPAGLGIVCASPRALEASKTAGLKRVFFDFNDMI  233

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ +LYGLR  L +LF E L++V  RH  L    R AV+AWGLK C 
Sbjct  234  KANATG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKPCA  292

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
             + +W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L 
Sbjct  293  TEPKWYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLM  352

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  107
            +LG + G EM + D+G  VKLGSGV AA A+ +
Sbjct  353  VLGAIGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 161/222 (73%), Gaps = 1/222 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ A+ F+ D+W VDVA+TGSQKALSLPTG+GIV AS KAL+A  +AK  RV+F + D L
Sbjct  152  SVGALPFKFDDWRVDVAVTGSQKALSLPTGLGIVAASDKALDARSSAKLKRVYFSFDDML  211

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K  K G   PYTP + LL+GL+A L LL  EGLDNV ARH RL   TR AV AWGLK   
Sbjct  212  KTNKNGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHHRLAEGTRAAVAAWGLKLLC  270

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++  W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL +V GKVFRIGHLGN++EL 
Sbjct  271  REPRWQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAEVQGKVFRIGHLGNMDELM  330

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  80
            L G L GVEM L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  331  LAGALGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ ++DF+ DEWGVDVA++GSQK   LP G+ I+  S KAL+A +TAK  R +FD++D++
Sbjct  179  SVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQDHV  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  L++LF EGLD V ARH  L    R AV AWGLK C 
Sbjct  239  KANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL 
Sbjct  298  KEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASA  116
            LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  358  LLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++
Sbjct  179  SVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHV  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  L++LF EGLD V ARH  L    R AV AWGLK C 
Sbjct  239  KANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL 
Sbjct  298  KEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASA  116
            LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  358  LLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++
Sbjct  179  SVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHV  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  L++LF EGLD V ARH  L    R AV AWGLK C 
Sbjct  239  KANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL 
Sbjct  298  KEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASA  116
            LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  358  LLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>gb|AEW08188.1| hypothetical protein 2_2585_01, partial [Pinus lambertiana]
Length=135

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  721  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  542
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL+FYKMGTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLRFYKMGTY  60

Query  541  WPYTPSIQllyglragldlLF-GEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  365
            WPYTPSIQLLYGLRA LDL+   EGLDNVIARH RLGTATRLAV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWYS  120

Query  364  DTVTAVVVPSYIDSS  320
            DTVTAV+VP YIDS+
Sbjct  121  DTVTAVIVPPYIDSA  135



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 157/222 (71%), Gaps = 1/222 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +IDFRMDEWG+D+ L GSQK   LP G+ ++C S KALEA  TAKS R F D +D++
Sbjct  174  SIASIDFRMDEWGIDIGLAGSQKGFMLPAGLALLCFSQKALEARHTAKSRRCFLDIQDHI  233

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
                 G Y+PYTPSI LLYGLR  +DLL  EGL NV ARH RL    R AV+AWGL+ C 
Sbjct  234  TNNASG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLELCA  292

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +  +W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL 
Sbjct  293  RDPKWYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNELM  352

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  80
            L   +AG EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  353  LCSAIAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 159/218 (73%), Gaps = 1/218 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ ++DFR DEWGVD+A++GSQK L LP G+G++  S KAL ASKTA S R +FD+ D +
Sbjct  174  SLGSLDFRQDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDDMI  233

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP + LLYGLR  L ++  EGL+N+  RH+ L    R AV+AWGL  C 
Sbjct  234  KANATG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPCA  292

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL 
Sbjct  293  KEPKWYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNELM  352

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  92
            +LG LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  353  VLGALAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +I F+MDEW VD+A+TGSQK L LP G+G+VCAS KALE SK     RVFF ++D +
Sbjct  176  SIASIPFKMDEWKVDLAITGSQKGLMLPAGLGMVCASEKALERSKKNNLHRVFFSFEDMI  235

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
                +G Y+PYTPSI LLYGL+  L +L  EGL++V  RH RL    R AV+AWGLK C 
Sbjct  236  VNNDVG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKTCC  294

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +  + +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNEL 
Sbjct  295  KNPKEYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNELM  354

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            +L  LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  355  VLATLAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 162/215 (75%), Gaps = 1/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+AL A+KTA   RV+FD+ D +
Sbjct  174  SIGSLDFRADEWRVDLAIAGSQKGLMLPAGLGIVCASPRALAATKTAGLKRVYFDFADMI  233

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ +LYGLR  + +LF E L++V  RH  L    R AV+AWGL  C 
Sbjct  234  KANATG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHPCA  292

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L 
Sbjct  293  KEAKWDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLM  352

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            +LG +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  353  VLGAIAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>gb|AFG57258.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57259.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57260.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57261.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57262.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57263.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57264.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57265.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57266.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57267.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57268.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57269.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57270.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57271.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57272.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57273.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57274.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57275.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
Length=135

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -2

Query  721  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  542
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  541  WPYTPSIQllyglragldlLF-GEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  365
            WPYTPSIQLLYGLRA LDL+   EGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVITRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  364  DTVTAVVVPSYIDSS  320
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (72%), Gaps = 4/222 (2%)
 Frame = -2

Query  742  ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDY  569
            + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D 
Sbjct  177  VGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDM  236

Query  568  LKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNC  389
            +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C
Sbjct  237  IKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLC  295

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E 
Sbjct  296  AKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEY  355

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  83
             + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  356  MIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>gb|AEW08187.1| hypothetical protein 2_2585_01, partial [Pinus radiata]
Length=135

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -2

Query  721  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  542
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  541  WPYTPSIQllyglragldlLF-GEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  365
            WPYTPSIQLLYGLRA LDL+   EGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIIRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  364  DTVTAVVVPSYIDSS  320
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++
Sbjct  179  SVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHV  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  L++LF EGLD V ARH  L    R AV AWGLK C 
Sbjct  239  KANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNEL 
Sbjct  298  KESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASA  116
            LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  358  LLGAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (72%), Gaps = 4/222 (2%)
 Frame = -2

Query  742  ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDY  569
            + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D 
Sbjct  174  VGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDM  233

Query  568  LKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNC  389
            +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C
Sbjct  234  IKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLC  292

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E 
Sbjct  293  AKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEY  352

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  83
             + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  353  MIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   232 bits (591),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMD+W VD+A+TGSQK L LP G+GI+C SPKAL+A +TAKS R +FD  D +
Sbjct  182  SIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAIETAKSKRCYFDLGDMI  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            K    G Y+PYTP++ LLYGLR  LDL+F EGLDNV ARH  L    R AV + WGL+ C
Sbjct  242  KANATG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLELC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKGPKWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  92
             L   +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  361  MLTSAIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  448  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  269
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  268  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  89
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  88   PSRI  77
            PSRI
Sbjct  121  PSRI  124



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 160/222 (72%), Gaps = 1/222 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI A++FRMD+W VDVA+TGSQKALSLPTG+  V ASPKALEA K+AK  RV++D+ D L
Sbjct  224  SIGALEFRMDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADML  283

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            +    G   PYTPS+ +LYG+R  + +L  EG++NV ARH RLG   R AV+ WGLK   
Sbjct  284  RTNPSGNV-PYTPSLAMLYGMRESIKMLREEGMENVFARHHRLGEGARRAVEGWGLKLLC  342

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +   W SD++T V VP  IDS++IVK A+ +Y+LSLG+GL ++ GKVFRIGHLGN+NEL 
Sbjct  343  KNPRWRSDSLTVVEVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNELM  402

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  80
            L+  LAG EM + D G P++ GSGV  A  Y Q T+ +I +R
Sbjct  403  LVSALAGAEMAMIDAGVPIRPGSGVGKAIEYWQQTSSVIKTR  444



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  
Sbjct  179  SIGSIDFRASEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMS  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  +  LF EGL+ V  RH  L    R AV+AWGL  C 
Sbjct  239  KANATG-YFPYTPALPLLYGLRESMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W+SDTV+A++VP  I+ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L 
Sbjct  298  KEPKWYSDTVSAIMVPEGINGADVIDIAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLG LAG EM + D G  ++ GSGVAAA  + + T
Sbjct  358  LLGALAGAEMSMLDAGIKIEPGSGVAAAQQHFRET  392



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFD  581
            SI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FD
Sbjct  156  SIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFD  215

Query  580  WKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWG  401
            W+D  K    G Y+PYTP + LLYGLR  L  LF EGL+NV  RH  LG ATR AV AWG
Sbjct  216  WEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWG  274

Query  400  LKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGN  221
            LK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+
Sbjct  275  LKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGD  334

Query  220  LNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  335  LNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 158/218 (72%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D +
Sbjct  182  SIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMV  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +    G Y+PYTP++ LLYGLRA LDLLF EGL+NV ARH  L    R AV + WGL+ C
Sbjct  242  RTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLELC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +   W SDTV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPRWHSDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  361  MLMSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028097617.1| serine--glyoxylate aminotransferase [Dongia sp. URHE0060]
Length=397

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 153/214 (71%), Gaps = 1/214 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +IDFRMDEWGVD+A+ GSQK   LP G+ I+C SPKAL+ +K +K  R +FD+ D +
Sbjct  174  SIASIDFRMDEWGVDIAVCGSQKGFMLPGGLAILCVSPKALDTAKNSKLHRCYFDFADMI  233

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K  K G ++PYTP +QL+ GLR  +D+L  EGL+NV ARH RLG   R AV AW +K   
Sbjct  234  KTNKDG-FFPYTPPMQLIRGLRTSVDMLLSEGLENVFARHHRLGEGVRRAVAAWNMKLVA  292

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            +++ W SDTV+A+ +    DS+ +V+ A++RY LSLG+GL ++ GKVFRIGHLG+LNEL 
Sbjct  293  KEKRWQSDTVSAIQITDGFDSNSLVRHAYRRYGLSLGVGLARLNGKVFRIGHLGDLNELM  352

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  104
            +L  L GVE+ ++D+G P+K GSGV AA  Y   
Sbjct  353  VLSALGGVELAMRDVGVPIKAGSGVGAAVDYFHQ  386



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFD  581
            SI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FD
Sbjct  179  SIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFD  238

Query  580  WKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWG  401
            W+D  K    G Y+PYTP + LLYGLR  L  LF EGL+NV  RH  LG ATR AV AWG
Sbjct  239  WEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWG  297

Query  400  LKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGN  221
            LK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+
Sbjct  298  LKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGD  357

Query  220  LNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  358  LNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFD  581
            SI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FD
Sbjct  179  SIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFD  238

Query  580  WKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWG  401
            W+D  K    G Y+PYTP + LLYGLR  L  LF EGL+NV  RH  LG ATR AV AWG
Sbjct  239  WEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWG  297

Query  400  LKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGN  221
            LK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+
Sbjct  298  LKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGD  357

Query  220  LNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  358  LNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFD  581
            SI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FD
Sbjct  179  SIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFD  238

Query  580  WKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWG  401
            W+D+ K    G Y+PYTP + LLYGLR  L  LF EGL+NV  RH  LG ATR AV AWG
Sbjct  239  WEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWG  297

Query  400  LKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGN  221
            LK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+
Sbjct  298  LKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGD  357

Query  220  LNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  358  LNELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 158/218 (72%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D +
Sbjct  182  SIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMV  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +    G Y+PYTP++ LLYGLRA LDLLF EGLDNV ARH  L +  R A+ + WGL+ C
Sbjct  242  RTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  361  MLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 158/218 (72%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D +
Sbjct  182  SIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMV  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +    G Y+PYTP++ LLYGLRA LDLLF EGLDNV ARH  L +  R A+ + WGL+ C
Sbjct  242  RTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  361  MLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFD  581
            SI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FD
Sbjct  179  SIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFD  238

Query  580  WKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWG  401
            W+D+ K    G Y+PYTP + LLYGLR  L  LF EGL+NV  RH  LG ATR AV AWG
Sbjct  239  WEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWG  297

Query  400  LKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGN  221
            LK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+
Sbjct  298  LKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGD  357

Query  220  LNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  358  LNELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 156/213 (73%), Gaps = 1/213 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA++A KT K  R +F+++D +
Sbjct  179  SVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIDAGKTNKGRRAYFEFQDMI  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
                 G Y+PYTPS+ LLYGL+  L +LF EGLD V  RH  L   TR AV AWGLK C 
Sbjct  239  AQNANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKTCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL 
Sbjct  298  KEPKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  107
            LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  358  LLGAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  
Sbjct  179  SIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMS  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  +  LF EGL+ V  RH  L    R AV+AWGL  C 
Sbjct  239  KANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L 
Sbjct  298  KEPKWYSDTVSAIMVPEGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  358  LLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 156/220 (71%), Gaps = 6/220 (3%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFD  581
            SI ++ F+ DEW VD A+ GSQK L LP G+G++C S +AL+A+     +  +  RV+FD
Sbjct  179  SIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQRALKAAEGQSGRNDRLARVYFD  238

Query  580  WKDYLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWG  401
            W+D  K    G Y+PYTP + LLYGLR  L  LF EGL+NV  RH  LG ATR AV AWG
Sbjct  239  WEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWG  297

Query  400  LKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGN  221
            LK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+
Sbjct  298  LKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGD  357

Query  220  LNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  358  LNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 158/218 (72%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D +
Sbjct  182  SIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMV  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +    G Y+PYTP++ LLYGLRA LDLLF EGLDNV ARH  L +  R A+ + WGL+ C
Sbjct  242  RTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  361  MLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  
Sbjct  179  SIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMS  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
            K    G Y+PYTP++ LLYGLR  +  LF EGL+ V  RH  L    R AV+AWGL  C 
Sbjct  239  KANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L 
Sbjct  298  KEPKWYSDTVSAIMVPDGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
            LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  358  LLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 155/212 (73%), Gaps = 2/212 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMD+W VD+A+TGSQK L LP G+GI+C S KAL+AS+TA S R +FD  D +
Sbjct  182  SIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSQKALKASETATSRRCYFDLADMI  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            K    G Y+PYTP++ LLYGLR  LDLLF EGLDNV ARH  L    R A+ + W L  C
Sbjct  242  KANATG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHHYLAQGVRAAITEGWDLGVC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPKWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  113
             L+G +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  361  MLMGAIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 158/218 (72%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D +
Sbjct  182  SIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMV  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +    G Y+PYTP++ LLYGLRA LDLLF EGLDNV ARH  L +  R A+ + WGL+ C
Sbjct  242  RTNATG-YFPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRAAITEGWGLEVC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  361  MLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 154/218 (71%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ +IDFRMDEWGVD A++GSQK   LP G+GI+  SPKAL+A +TA S R +FD  D L
Sbjct  177  SLVSIDFRMDEWGVDCAVSGSQKGFMLPAGMGILGVSPKALKAMETATSRRCYFDLGDML  236

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQ-AWGLKNC  389
            K    G Y+PYTPSI +LYG+R  L+ +F EGL+N+ ARH  L +  R AVQ  W L  C
Sbjct  237  KNNATG-YFPYTPSIPMLYGMRESLNTIFEEGLENIFARHNYLASGVRAAVQEGWKLNLC  295

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  EW+SDTV+A++VP   D+++++  A+ +YNLSLG GL+KVAGKVFRIGHLG+LN L
Sbjct  296  AKAPEWYSDTVSAILVPEGFDATKVISNAYAKYNLSLGAGLSKVAGKVFRIGHLGDLNAL  355

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V  GSGVAAAS Y +   P
Sbjct  356  SLMSAIAGAEMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 156/218 (72%), Gaps = 2/218 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D +
Sbjct  182  SIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMV  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +    G Y+PYTP++ LLYGLRA LDLLF EGL+NV ARH  L +  R AV + WGL  C
Sbjct  242  RTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLASGVRAAVTEGWGLSLC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +   W SDTV+A+VVP  ++ ++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPRWHSDTVSAIVVPEGVNGAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  95
             L+  +AG EM + D G  V  GSGV AA  Y +  TP
Sbjct  361  MLMSAIAGAEMAMLDAGIDVCPGSGVGAAGQYWRTHTP  398



>ref|WP_020085137.1| serine--glyoxylate aminotransferase [Hyphomicrobium zavarzinii]
Length=400

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKD  572
            S+ ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D
Sbjct  175  SVGSLDMRMGEWGVDACVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWED  234

Query  571  YLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKN  392
             +K   +G ++PYTP+ QL+ GLRA L+L+F EG+DN++ARHTRL +  R AV AWGLK 
Sbjct  235  MIKTNDLG-FFPYTPATQLIRGLRASLNLIFAEGIDNIVARHTRLASGVRAAVDAWGLKL  293

Query  391  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  212
            C ++ +W SDTV+A+VVP  ID++ ++K A+ RYN SLG GLNK+ G+VFRIGHLG L+E
Sbjct  294  CAKEPKWHSDTVSAIVVPEGIDANNVLKTAYYRYNTSLGTGLNKLNGRVFRIGHLGALDE  353

Query  211  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
              +   L  VEM LKD G P+K GSG  AA+ Y   T
Sbjct  354  GMIGSALFNVEMTLKDCGVPIKFGSGTGAAAEYFSKT  390



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 155/213 (73%), Gaps = 1/213 (0%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            S+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA+E  KT K  R +F+++D +
Sbjct  179  SVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIEKGKTNKGRRAYFEFQDMI  238

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCT  386
                 G Y+PYTPS+ LLYGL+  L +LF EGLD V  RH  L    R AV AWGLK C 
Sbjct  239  AQNANG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLAEGCRAAVAAWGLKTCA  297

Query  385  QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  206
            ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL 
Sbjct  298  KEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELM  357

Query  205  LLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  107
            LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  358  LLGAIAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 156/212 (74%), Gaps = 2/212 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI  IDFRMD+W VD+A+TGSQK L LP G+GI+CASPKAL+A + A+S R +FD  D +
Sbjct  182  SIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCASPKALKAMEHAQSRRCYFDLGDMI  241

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            K    G Y+PYTP++ LLYGLRA LDLLF EGLDNV ARH  L    R AV + WGL+ C
Sbjct  242  KANATG-YFPYTPALSLLYGLRASLDLLFEEGLDNVFARHHYLAAGVRAAVTEGWGLELC  300

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W SDTVTA+VVP   +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL
Sbjct  301  AKAPKWHSDTVTAIVVPQGFNAAHVIDTAFRRYNLALGAGLSKVAGKVFRIGHLGDLNEL  360

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  113
             L   ++G EM + D+G  V+ GSG  AA+ Y
Sbjct  361  MLTSAISGAEMAMLDVGIDVRPGSGTGAATQY  392



>ref|WP_015599474.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|AGK59459.1| class V aminotransferase [Hyphomicrobium denitrificans 1NES1]
Length=406

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 151/217 (70%), Gaps = 3/217 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA--SKTAKSVRVFFDWKD  572
            S+ ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+   SK  +  R FF ++D
Sbjct  175  SVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDVNKSKNGRMNRCFFSFED  234

Query  571  YLKFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKN  392
             +K    G ++PYTP+  L+ GLR  +DLL GEG+DNV+ARH RL +  R  V AWGLK 
Sbjct  235  MIKTNDQG-FFPYTPATTLIRGLRTSIDLLLGEGIDNVVARHHRLASGVRAGVHAWGLKL  293

Query  391  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  212
            C ++ +W SDTV+AV+VP   DS+ + K A+ RYN SLGLGLNKVAGKVFRIGHLG+L+E
Sbjct  294  CAKEPKWHSDTVSAVLVPEGFDSNVVTKTAYYRYNTSLGLGLNKVAGKVFRIGHLGSLDE  353

Query  211  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  101
              + G L  VEM LKD G PVKLGSG  AA+ Y  N 
Sbjct  354  FMVGGVLFAVEMALKDCGIPVKLGSGTGAAAEYFTNN  390



>ref|WP_022947294.1| serine--glyoxylate aminotransferase [Methylohalobius crimeensis]
Length=395

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 155/223 (70%), Gaps = 2/223 (1%)
 Frame = -2

Query  745  SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  566
            SI +I+FRMD+WGVDVALTGSQK   LP G   VC SPKALE   TAK  R F + +D +
Sbjct  174  SIGSIEFRMDDWGVDVALTGSQKGFMLPAGNAYVCFSPKALEKRHTAKCPRSFLNIEDQI  233

Query  565  KFYKMGTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAV-QAWGLKNC  389
            +  + G Y+PYTP+  +L+GLR  L+LL  EG+DNV ARH RL    R AV   WGL  C
Sbjct  234  QANQTG-YFPYTPNTSMLHGLRQVLNLLLAEGMDNVYARHHRLAEGARRAVLDGWGLTLC  292

Query  388  TQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  209
             +  +W+SD+V+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGH+G+LNEL
Sbjct  293  ARDPKWYSDSVSAIVVPEGFDARDVMHVAYNRYNLSLGGGLSEVAGKVFRIGHMGDLNEL  352

Query  208  QLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  80
             L G + G EM ++D G  +K GSG+ AA  Y ++T P +P +
Sbjct  353  MLAGAIVGAEMAMRDAGIDLKPGSGITAAMEYWRDTAPPVPGK  395



>emb|CAM59875.2| alanine:glyoxylate aminotransferase [Prunus avium]
Length=120

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -2

Query  730  DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKM  551
            DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK+
Sbjct  1    DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKL  60

Query  550  GTYWPYTPSIQllyglragldlLFGEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEW  371
            GTYWPYTPSIQLLYGLR  LDLLF EGLDNVIARH+RLG ATRLAV+AWGLKNC QKEEW
Sbjct  61   GTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCXQKEEW  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420