BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023K20

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592675.1|  PREDICTED: uncharacterized protein LOC104089...    269   5e-80   Nicotiana tomentosiformis
ref|XP_009592673.1|  PREDICTED: uncharacterized protein LOC104089...    269   1e-79   Nicotiana tomentosiformis
ref|XP_009592672.1|  PREDICTED: uncharacterized protein LOC104089...    269   2e-79   Nicotiana tomentosiformis
ref|XP_009770291.1|  PREDICTED: uncharacterized protein LOC104221...    264   4e-78   Nicotiana sylvestris
ref|XP_009770284.1|  PREDICTED: uncharacterized protein LOC104221...    264   1e-77   Nicotiana sylvestris
ref|XP_009770277.1|  PREDICTED: uncharacterized protein LOC104221...    264   1e-77   Nicotiana sylvestris
ref|XP_009780629.1|  PREDICTED: uncharacterized protein LOC104229...    257   1e-75   Nicotiana sylvestris
ref|XP_009780628.1|  PREDICTED: uncharacterized protein LOC104229...    257   2e-75   Nicotiana sylvestris
ref|XP_009780627.1|  PREDICTED: uncharacterized protein LOC104229...    256   4e-75   Nicotiana sylvestris
ref|XP_009780624.1|  PREDICTED: uncharacterized protein LOC104229...    256   4e-75   Nicotiana sylvestris
ref|XP_009589098.1|  PREDICTED: uncharacterized protein LOC104086...    256   6e-75   Nicotiana tomentosiformis
ref|XP_009589093.1|  PREDICTED: uncharacterized protein LOC104086...    256   8e-75   Nicotiana tomentosiformis
ref|XP_009589097.1|  PREDICTED: uncharacterized protein LOC104086...    256   8e-75   Nicotiana tomentosiformis
ref|XP_006350289.1|  PREDICTED: uncharacterized protein LOC102583747    244   1e-70   Solanum tuberosum [potatoes]
ref|XP_008235543.1|  PREDICTED: uncharacterized protein LOC103334363    241   8e-70   Prunus mume [ume]
ref|XP_006352720.1|  PREDICTED: uncharacterized protein LOC102578...    239   4e-69   
ref|XP_006352716.1|  PREDICTED: uncharacterized protein LOC102578...    240   5e-69   Solanum tuberosum [potatoes]
ref|XP_006352719.1|  PREDICTED: uncharacterized protein LOC102578...    239   6e-69   Solanum tuberosum [potatoes]
ref|XP_006352718.1|  PREDICTED: uncharacterized protein LOC102578...    239   6e-69   
ref|XP_006352717.1|  PREDICTED: uncharacterized protein LOC102578...    239   6e-69   Solanum tuberosum [potatoes]
ref|XP_010323077.1|  PREDICTED: uncharacterized protein LOC101266...    235   2e-67   Solanum lycopersicum
ref|XP_010323075.1|  PREDICTED: uncharacterized protein LOC101266...    234   2e-67   
ref|XP_010323076.1|  PREDICTED: uncharacterized protein LOC101266...    234   3e-67   
ref|XP_010323074.1|  PREDICTED: uncharacterized protein LOC101266...    234   3e-67   
ref|XP_010323073.1|  PREDICTED: uncharacterized protein LOC101266...    234   3e-67   
ref|XP_007199004.1|  hypothetical protein PRUPE_ppa000852mg             234   3e-67   Prunus persica
ref|XP_009371010.1|  PREDICTED: uncharacterized protein LOC103960...    231   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_009371001.1|  PREDICTED: uncharacterized protein LOC103960...    231   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_002521158.1|  conserved hypothetical protein                     226   3e-64   
ref|XP_010326332.1|  PREDICTED: uncharacterized protein LOC101266...    225   3e-64   
ref|XP_004247114.1|  PREDICTED: uncharacterized protein LOC101266...    225   7e-64   Solanum lycopersicum
ref|XP_011080145.1|  PREDICTED: uncharacterized protein LOC105163485    221   1e-62   Sesamum indicum [beniseed]
gb|KJB10993.1|  hypothetical protein B456_001G235600                    221   2e-62   Gossypium raimondii
gb|KJB10997.1|  hypothetical protein B456_001G235600                    221   2e-62   Gossypium raimondii
gb|KJB10995.1|  hypothetical protein B456_001G235600                    221   2e-62   Gossypium raimondii
ref|XP_004292261.1|  PREDICTED: uncharacterized protein LOC101294433    220   4e-62   Fragaria vesca subsp. vesca
gb|KHG22481.1|  Viral inhibitor of RIP activation                       219   6e-62   Gossypium arboreum [tree cotton]
ref|XP_002303096.2|  hypothetical protein POPTR_0002s25490g             219   8e-62   
ref|XP_006386899.1|  hypothetical protein POPTR_0002s25490g             219   9e-62   
emb|CDP03827.1|  unnamed protein product                                218   2e-61   Coffea canephora [robusta coffee]
ref|XP_010652446.1|  PREDICTED: uncharacterized protein LOC100241...    217   6e-61   Vitis vinifera
ref|XP_002267519.1|  PREDICTED: uncharacterized protein LOC100241...    216   7e-61   Vitis vinifera
ref|XP_008382666.1|  PREDICTED: uncharacterized protein LOC103445438    214   6e-60   
emb|CAN81514.1|  hypothetical protein VITISV_012030                     214   2e-59   Vitis vinifera
ref|XP_008372424.1|  PREDICTED: uncharacterized protein LOC103435...    212   3e-59   
ref|XP_008372423.1|  PREDICTED: uncharacterized protein LOC103435...    212   4e-59   
ref|XP_011024529.1|  PREDICTED: uncharacterized protein LOC105125...    209   3e-58   Populus euphratica
ref|XP_011024531.1|  PREDICTED: uncharacterized protein LOC105125...    209   3e-58   Populus euphratica
ref|XP_011024525.1|  PREDICTED: uncharacterized protein LOC105125...    209   4e-58   Populus euphratica
ref|XP_011024528.1|  PREDICTED: uncharacterized protein LOC105125...    209   4e-58   Populus euphratica
ref|XP_007050071.1|  Uncharacterized protein isoform 3                  206   3e-57   
ref|XP_007050069.1|  Uncharacterized protein isoform 1                  206   5e-57   
ref|XP_007050070.1|  Uncharacterized protein isoform 2                  206   6e-57   
gb|KDO65806.1|  hypothetical protein CISIN_1g001807mg                   204   2e-56   Citrus sinensis [apfelsine]
ref|XP_011083092.1|  PREDICTED: uncharacterized protein LOC105165697    203   3e-56   Sesamum indicum [beniseed]
gb|KDO65805.1|  hypothetical protein CISIN_1g001807mg                   203   4e-56   Citrus sinensis [apfelsine]
gb|KDO65804.1|  hypothetical protein CISIN_1g001807mg                   203   4e-56   Citrus sinensis [apfelsine]
ref|XP_006375643.1|  hypothetical protein POPTR_0014s18540g             203   4e-56   
gb|KDO65803.1|  hypothetical protein CISIN_1g001807mg                   203   4e-56   Citrus sinensis [apfelsine]
gb|KDP26434.1|  hypothetical protein JCGZ_17592                         202   1e-55   Jatropha curcas
ref|XP_006443684.1|  hypothetical protein CICLE_v10018694mg             201   2e-55   Citrus clementina [clementine]
ref|XP_010091854.1|  hypothetical protein L484_015923                   198   4e-54   Morus notabilis
ref|XP_010684824.1|  PREDICTED: uncharacterized protein LOC104899...    197   7e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010684822.1|  PREDICTED: uncharacterized protein LOC104899...    197   7e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI37234.3|  unnamed protein product                                194   3e-53   Vitis vinifera
ref|XP_004493852.1|  PREDICTED: uro-adherence factor A-like isofo...    194   6e-53   Cicer arietinum [garbanzo]
ref|XP_007162644.1|  hypothetical protein PHAVU_001G168100g             194   7e-53   Phaseolus vulgaris [French bean]
ref|XP_010243641.1|  PREDICTED: uncharacterized protein LOC104587...    193   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010243643.1|  PREDICTED: uncharacterized protein LOC104587...    192   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010243642.1|  PREDICTED: uncharacterized protein LOC104587...    192   3e-52   Nelumbo nucifera [Indian lotus]
gb|KEH23986.1|  DUF3741 family protein                                  188   7e-51   Medicago truncatula
ref|XP_003625464.1|  hypothetical protein MTR_7g099410                  188   1e-50   Medicago truncatula
ref|XP_006576977.1|  PREDICTED: uncharacterized protein LOC100793360    187   3e-50   Glycine max [soybeans]
gb|KHN09408.1|  hypothetical protein glysoja_016507                     185   1e-49   Glycine soja [wild soybean]
ref|XP_006604525.1|  PREDICTED: uncharacterized protein LOC100816...    184   3e-49   Glycine max [soybeans]
gb|EYU17962.1|  hypothetical protein MIMGU_mgv1a0013541mg               172   2e-48   Erythranthe guttata [common monkey flower]
gb|KJB26069.1|  hypothetical protein B456_004G223300                    178   3e-47   Gossypium raimondii
gb|KJB10996.1|  hypothetical protein B456_001G235600                    178   4e-47   Gossypium raimondii
gb|KJB26068.1|  hypothetical protein B456_004G223300                    178   6e-47   Gossypium raimondii
gb|KJB26065.1|  hypothetical protein B456_004G223300                    177   6e-47   Gossypium raimondii
gb|KJB26067.1|  hypothetical protein B456_004G223300                    177   7e-47   Gossypium raimondii
gb|KHG04276.1|  Methyl-coenzyme M reductase II subunit gamma            177   1e-46   Gossypium arboreum [tree cotton]
gb|EYU46370.1|  hypothetical protein MIMGU_mgv1a000965mg                176   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_010263991.1|  PREDICTED: uncharacterized protein LOC104602...    173   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010263990.1|  PREDICTED: uncharacterized protein LOC104602...    173   3e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010263989.1|  PREDICTED: uncharacterized protein LOC104602...    173   3e-45   
ref|XP_011011589.1|  PREDICTED: uncharacterized protein LOC105116094    159   1e-43   Populus euphratica
ref|XP_010038329.1|  PREDICTED: uncharacterized protein LOC104426860    163   9e-42   Eucalyptus grandis [rose gum]
ref|XP_003541385.2|  PREDICTED: uncharacterized protein LOC100787955    154   1e-38   Glycine max [soybeans]
gb|KHN48970.1|  hypothetical protein glysoja_025347                     153   2e-38   Glycine soja [wild soybean]
ref|XP_010436357.1|  PREDICTED: uncharacterized protein LOC104720083    142   1e-37   
ref|XP_008461986.1|  PREDICTED: uncharacterized protein LOC103500466    151   2e-37   Cucumis melo [Oriental melon]
ref|XP_008809665.1|  PREDICTED: uncharacterized protein LOC103721...    150   2e-37   Phoenix dactylifera
gb|KEH42420.1|  DUF3741 family protein                                  150   2e-37   Medicago truncatula
ref|XP_008809662.1|  PREDICTED: uncharacterized protein LOC103721...    150   2e-37   Phoenix dactylifera
ref|XP_008809661.1|  PREDICTED: uncharacterized protein LOC103721...    150   2e-37   Phoenix dactylifera
ref|XP_008809663.1|  PREDICTED: uncharacterized protein LOC103721...    150   3e-37   Phoenix dactylifera
ref|XP_008809664.1|  PREDICTED: uncharacterized protein LOC103721...    150   3e-37   
ref|XP_010438386.1|  PREDICTED: uncharacterized protein LOC104721...    147   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010438384.1|  PREDICTED: uncharacterized protein LOC104721...    146   4e-36   Camelina sativa [gold-of-pleasure]
gb|KHN05903.1|  hypothetical protein glysoja_026491                     143   9e-36   Glycine soja [wild soybean]
ref|XP_007144434.1|  hypothetical protein PHAVU_007G155800g             145   1e-35   Phaseolus vulgaris [French bean]
ref|XP_002869475.1|  hypothetical protein ARALYDRAFT_491881             145   2e-35   
ref|XP_010433166.1|  PREDICTED: uncharacterized protein LOC104717...    144   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010433164.1|  PREDICTED: uncharacterized protein LOC104717...    144   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004139729.1|  PREDICTED: uncharacterized protein LOC101207165    144   4e-35   Cucumis sativus [cucumbers]
ref|XP_003537148.1|  PREDICTED: uncharacterized protein LOC100814...    144   4e-35   Glycine max [soybeans]
ref|XP_010069683.1|  PREDICTED: uncharacterized protein LOC104456566    142   1e-34   Eucalyptus grandis [rose gum]
ref|XP_006284953.1|  hypothetical protein CARUB_v10006255mg             142   2e-34   Capsella rubella
dbj|BAD94795.1|  hypothetical protein                                   135   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412913.1|  hypothetical protein EUTSA_v10024350mg             140   5e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010540954.1|  PREDICTED: uncharacterized protein LOC104814...    139   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010447918.1|  PREDICTED: uncharacterized protein LOC104730...    139   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010540953.1|  PREDICTED: uncharacterized protein LOC104814...    139   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010447916.1|  PREDICTED: uncharacterized protein LOC104730...    139   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010540945.1|  PREDICTED: uncharacterized protein LOC104814...    139   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010918845.1|  PREDICTED: uncharacterized protein LOC105043126    139   3e-33   Elaeis guineensis
dbj|BAF01823.1|  hypothetical protein                                   137   3e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAA22976.1|  putative protein                                       137   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933202.1|  PREDICTED: uncharacterized protein LOC105053...    137   6e-33   
ref|XP_010933204.1|  PREDICTED: uncharacterized protein LOC105053...    137   6e-33   Elaeis guineensis
ref|NP_567819.1|  uncharacterized protein                               137   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933203.1|  PREDICTED: uncharacterized protein LOC105053...    137   7e-33   Elaeis guineensis
dbj|BAH19995.1|  AT4G28760                                              137   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495031.1|  PREDICTED: uro-adherence factor A-like isofo...    137   9e-33   Cicer arietinum [garbanzo]
ref|XP_010526475.1|  PREDICTED: uncharacterized protein LOC104804...    133   2e-31   
ref|XP_010526471.1|  PREDICTED: uncharacterized protein LOC104804...    133   2e-31   Tarenaya hassleriana [spider flower]
emb|CDY31985.1|  BnaA07g00100D                                          129   3e-30   Brassica napus [oilseed rape]
emb|CDY65848.1|  BnaCnng48860D                                          128   7e-30   Brassica napus [oilseed rape]
emb|CDY06873.1|  BnaC01g09720D                                          127   2e-29   
ref|XP_008789491.1|  PREDICTED: uncharacterized protein LOC103706...    126   5e-29   Phoenix dactylifera
ref|XP_008789489.1|  PREDICTED: uncharacterized protein LOC103706...    126   5e-29   Phoenix dactylifera
ref|XP_008789490.1|  PREDICTED: uncharacterized protein LOC103706...    126   6e-29   Phoenix dactylifera
ref|XP_004165945.1|  PREDICTED: uncharacterized LOC101204012            126   6e-29   
ref|XP_004152072.1|  PREDICTED: uncharacterized protein LOC101204012    125   7e-29   
gb|KGN58324.1|  hypothetical protein Csa_3G622430                       125   8e-29   Cucumis sativus [cucumbers]
ref|XP_008447347.1|  PREDICTED: uncharacterized protein LOC103489819    124   2e-28   Cucumis melo [Oriental melon]
ref|XP_010940678.1|  PREDICTED: uncharacterized protein LOC105059...    124   3e-28   Elaeis guineensis
ref|XP_010940679.1|  PREDICTED: uncharacterized protein LOC105059...    124   3e-28   Elaeis guineensis
dbj|BAK01535.1|  predicted protein                                      123   4e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008812928.1|  PREDICTED: uncharacterized protein LOC103723702    123   4e-28   
dbj|BAJ95378.1|  predicted protein                                      123   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009129280.1|  PREDICTED: uncharacterized protein LOC103854122    119   2e-26   Brassica rapa
gb|EMT32262.1|  hypothetical protein F775_21072                         119   2e-26   
emb|CDY35217.1|  BnaA01g08140D                                          119   2e-26   Brassica napus [oilseed rape]
ref|XP_006408939.1|  hypothetical protein EUTSA_v10001917mg             117   3e-26   Eutrema salsugineum [saltwater cress]
ref|NP_179614.1|  uncharacterized protein                               116   7e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43822.1|  unknown protein                                        116   8e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883937.1|  hypothetical protein ARALYDRAFT_319541             116   1e-25   Arabidopsis lyrata subsp. lyrata
gb|EMS51091.1|  hypothetical protein TRIUR3_23853                       115   2e-25   Triticum urartu
ref|XP_009411376.1|  PREDICTED: uncharacterized protein LOC103993144    115   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ23822.1|  hypothetical protein OsJ_07535                          112   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296647.1|  hypothetical protein CARUB_v10015415mg             110   7e-24   Capsella rubella
ref|XP_010495916.1|  PREDICTED: probable GPI-anchored adhesin-lik...    110   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010489077.1|  PREDICTED: uncharacterized protein LOC104766813    110   1e-23   Camelina sativa [gold-of-pleasure]
gb|EAY86700.1|  hypothetical protein OsI_08082                          110   2e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001047438.1|  Os02g0617100                                       102   4e-23   
gb|EMT13565.1|  hypothetical protein F775_11179                         108   5e-23   
ref|XP_002448137.1|  hypothetical protein SORBIDRAFT_06g021940          107   1e-22   Sorghum bicolor [broomcorn]
ref|XP_009382189.1|  PREDICTED: uncharacterized protein LOC103970...    106   3e-22   
ref|XP_010416091.1|  PREDICTED: uncharacterized protein LOC104701996    106   3e-22   
ref|XP_009382176.1|  PREDICTED: uncharacterized protein LOC103970...    106   3e-22   
ref|XP_006647519.1|  PREDICTED: uncharacterized serine-rich prote...    103   3e-22   
ref|XP_009382188.1|  PREDICTED: uncharacterized protein LOC103970...    106   3e-22   
dbj|BAK04299.1|  predicted protein                                      105   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953111.1|  PREDICTED: uncharacterized protein LOC101762...    105   6e-22   Setaria italica
ref|XP_004953110.1|  PREDICTED: uncharacterized protein LOC101762...    105   6e-22   Setaria italica
ref|XP_008796409.1|  PREDICTED: uncharacterized protein LOC103711875    105   8e-22   Phoenix dactylifera
ref|XP_004985732.1|  PREDICTED: uncharacterized protein LOC101771...    104   2e-21   
ref|XP_004985731.1|  PREDICTED: uncharacterized protein LOC101771...    104   2e-21   Setaria italica
ref|XP_006649387.1|  PREDICTED: uncharacterized protein LOC102700033    104   2e-21   Oryza brachyantha
ref|XP_002454174.1|  hypothetical protein SORBIDRAFT_04g026030          103   2e-21   Sorghum bicolor [broomcorn]
gb|EMS67579.1|  hypothetical protein TRIUR3_06787                       103   4e-21   Triticum urartu
tpg|DAA37015.1|  TPA: hypothetical protein ZEAMMB73_770868            98.6    4e-21   
ref|NP_001053260.1|  Os04g0506900                                       102   6e-21   
gb|EEC77598.1|  hypothetical protein OsI_16564                          102   7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010556872.1|  PREDICTED: uncharacterized protein LOC104826058    102   8e-21   Tarenaya hassleriana [spider flower]
emb|CAE04715.1|  OSJNBa0043L24.3                                        102   8e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61300.1|  hypothetical protein OsJ_15391                          102   8e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67333.1|  OSIGBa0157A06.2                                        102   8e-21   Oryza sativa [red rice]
ref|XP_010911761.1|  PREDICTED: uncharacterized protein LOC105037843  94.4    4e-20   
gb|EMT10669.1|  hypothetical protein F775_15662                         100   4e-20   
ref|XP_006651030.1|  PREDICTED: uncharacterized protein LOC102706550    100   4e-20   
ref|XP_010240106.1|  PREDICTED: uncharacterized protein LOC100830...    100   5e-20   
gb|AFW72333.1|  hypothetical protein ZEAMMB73_984204                    100   5e-20   
ref|XP_010240105.1|  PREDICTED: uncharacterized protein LOC100830...    100   5e-20   
ref|XP_008643431.1|  PREDICTED: uncharacterized protein LOC100278...  99.8    5e-20   
ref|XP_010240102.1|  PREDICTED: uncharacterized protein LOC100830...  99.8    6e-20   Brachypodium distachyon [annual false brome]
ref|NP_001140716.1|  uncharacterized protein LOC100272791             99.0    6e-20   
ref|XP_008666987.1|  PREDICTED: uncharacterized protein LOC100272...  99.8    6e-20   Zea mays [maize]
gb|ACN35840.1|  unknown                                               99.8    6e-20   Zea mays [maize]
ref|XP_008666979.1|  PREDICTED: uncharacterized protein LOC100272...  99.8    6e-20   Zea mays [maize]
ref|XP_008666975.1|  PREDICTED: uncharacterized protein LOC100272...  99.8    7e-20   Zea mays [maize]
ref|NP_001048940.1|  Os03g0143700                                     97.8    2e-19   
ref|XP_009410914.1|  PREDICTED: uncharacterized protein LOC103992...  97.4    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410963.1|  PREDICTED: uncharacterized protein LOC103992...  97.1    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY88501.1|  hypothetical protein OsI_09972                        96.3    8e-19   Oryza sativa Indica Group [Indian rice]
gb|AAO37163.1|  hypothetical protein                                  94.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001145529.1|  uncharacterized protein LOC100278954             88.6    7e-18   
ref|XP_006652490.1|  PREDICTED: uncharacterized protein LOC102722...  93.6    8e-18   Oryza brachyantha
ref|XP_006652489.1|  PREDICTED: uncharacterized protein LOC102722...  93.6    8e-18   Oryza brachyantha
ref|XP_009418989.1|  PREDICTED: uncharacterized protein LOC103998...  92.8    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418765.1|  PREDICTED: uncharacterized protein LOC103998...  92.8    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976162.1|  PREDICTED: uncharacterized protein LOC101760...  91.3    4e-17   Setaria italica
ref|XP_010235705.1|  PREDICTED: uncharacterized protein LOC100838495  90.1    1e-16   Brachypodium distachyon [annual false brome]
ref|XP_003558830.1|  PREDICTED: uncharacterized protein LOC100833211  88.2    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_009407163.1|  PREDICTED: uncharacterized protein LOC103989929  88.2    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405681.1|  PREDICTED: uncharacterized protein LOC103988772  84.7    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279983.1|  hypothetical protein CARUB_v10025855mg           82.0    4e-14   Capsella rubella
ref|XP_006279984.1|  hypothetical protein CARUB_v10025855mg           81.6    5e-14   
ref|XP_010494373.1|  PREDICTED: uncharacterized protein LOC104771...  80.5    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010494375.1|  PREDICTED: uncharacterized protein LOC104771...  80.5    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010481813.1|  PREDICTED: uncharacterized protein LOC104760...  80.1    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010481809.1|  PREDICTED: uncharacterized protein LOC104760...  80.1    2e-13   Camelina sativa [gold-of-pleasure]
ref|NP_199201.1|  uncharacterized protein                             80.1    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863627.1|  hypothetical protein ARALYDRAFT_494617           79.3    2e-13   
ref|XP_010441972.1|  PREDICTED: uncharacterized protein LOC104725...  74.3    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010441970.1|  PREDICTED: uncharacterized protein LOC104725...  74.3    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009113974.1|  PREDICTED: uncharacterized protein LOC103839223  71.6    8e-11   Brassica rapa
ref|XP_006854321.1|  hypothetical protein AMTR_s00039p00119340        71.2    1e-10   Amborella trichopoda
emb|CDY22327.1|  BnaA06g36490D                                        66.2    6e-10   Brassica napus [oilseed rape]
gb|EEC74239.1|  hypothetical protein OsI_09439                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
emb|CDY32928.1|  BnaA09g16650D                                        67.4    2e-09   Brassica napus [oilseed rape]
gb|EPS72229.1|  hypothetical protein M569_02537                       62.8    6e-09   Genlisea aurea
ref|XP_006648110.1|  PREDICTED: uncharacterized protein LOC102717592  65.9    6e-09   Oryza brachyantha
ref|XP_003570390.1|  PREDICTED: uncharacterized protein LOC100830114  65.1    1e-08   Brachypodium distachyon [annual false brome]
ref|NP_001048512.1|  Os02g0816400                                     63.9    2e-08   
emb|CDY50812.1|  BnaCnng19760D                                        63.5    4e-08   Brassica napus [oilseed rape]
ref|XP_004954364.1|  PREDICTED: uncharacterized protein LOC101771...  61.6    2e-07   Setaria italica
gb|EMS54382.1|  hypothetical protein TRIUR3_15055                     60.8    3e-07   Triticum urartu
gb|EMS57338.1|  hypothetical protein TRIUR3_10172                     58.5    2e-06   Triticum urartu
ref|XP_006403169.1|  hypothetical protein EUTSA_v10003146mg           57.4    4e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008646430.1|  PREDICTED: uncharacterized protein LOC103627...  57.4    5e-06   Zea mays [maize]
ref|XP_008646424.1|  PREDICTED: uncharacterized protein LOC103627...  57.4    5e-06   Zea mays [maize]
ref|XP_011101154.1|  PREDICTED: uncharacterized protein LOC105179...  57.0    5e-06   Sesamum indicum [beniseed]
ref|XP_008646431.1|  PREDICTED: uncharacterized protein LOC103627...  57.0    5e-06   Zea mays [maize]
ref|XP_011101155.1|  PREDICTED: uncharacterized protein LOC105179...  57.0    6e-06   Sesamum indicum [beniseed]
ref|XP_010317454.1|  PREDICTED: uncharacterized protein LOC101266997  56.2    9e-06   Solanum lycopersicum
emb|CDX94731.1|  BnaC07g17400D                                        56.2    1e-05   
emb|CDY57257.1|  BnaC08g47610D                                        55.8    1e-05   Brassica napus [oilseed rape]
ref|XP_006362707.1|  PREDICTED: protein LONGIFOLIA 1-like             54.3    4e-05   
ref|XP_006307114.1|  hypothetical protein CARUB_v10008702mg           53.9    6e-05   
emb|CDX95141.1|  BnaC05g05300D                                        53.9    6e-05   
ref|XP_006307115.1|  hypothetical protein CARUB_v10008702mg           53.5    8e-05   Capsella rubella
ref|NP_172241.2|  GTPase OBGM                                         53.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD42902.1|  putative GTP-binding protein                         53.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAF75096.1|AC007583_32  It is a member of GTP1/OBG family PF|0...  53.1    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMT03099.1|  hypothetical protein F775_52439                       52.8    2e-04   
ref|XP_011094798.1|  PREDICTED: uncharacterized protein LOC105174...  52.4    2e-04   
ref|XP_009118948.1|  PREDICTED: protein TRM32-like                    52.0    2e-04   Brassica rapa
ref|XP_011094799.1|  PREDICTED: uncharacterized protein LOC105174...  52.4    2e-04   Sesamum indicum [beniseed]
emb|CDY06717.1|  BnaA10g04960D                                        51.2    4e-04   
ref|XP_006850705.1|  hypothetical protein AMTR_s00034p00242520        50.8    6e-04   Amborella trichopoda
ref|XP_010255349.1|  PREDICTED: uncharacterized protein LOC104596048  50.8    7e-04   Nelumbo nucifera [Indian lotus]
ref|XP_011077431.1|  PREDICTED: uncharacterized protein LOC105161...  50.4    9e-04   Sesamum indicum [beniseed]
ref|XP_011077421.1|  PREDICTED: uncharacterized protein LOC105161...  50.4    9e-04   



>ref|XP_009592675.1| PREDICTED: uncharacterized protein LOC104089467 isoform X3 [Nicotiana 
tomentosiformis]
Length=885

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 165/219 (75%), Gaps = 7/219 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW  F+QTLL+MAGLDEVQS + 
Sbjct  666  GSIARTLSWDDSCADTA-SSACVRPSSSTQRTEEVEREWFSFVQTLLTMAGLDEVQSVAF  724

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+KLVFDCVNAAL+DI     D
Sbjct  725  STMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQKLVFDCVNAALLDIAGYGPD  784

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQ  228
             C + I + G HN  P+G+ +I  D+VW R+KEWF S    LS D  D N+L  E MV +
Sbjct  785  NCQRAIPYIGVHNNQPEGTRLILVDQVWDRMKEWFSSEVKYLSCDAEDINSLVMEGMVTK  844

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +GK W +  RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  845  EVMGKRWLKSFRLELDNVGMEIEGKLLEELVHESVIELA  883



>ref|XP_009592673.1| PREDICTED: uncharacterized protein LOC104089467 isoform X2 [Nicotiana 
tomentosiformis]
Length=974

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 165/219 (75%), Gaps = 7/219 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW  F+QTLL+MAGLDEVQS + 
Sbjct  755  GSIARTLSWDDSCADTA-SSACVRPSSSTQRTEEVEREWFSFVQTLLTMAGLDEVQSVAF  813

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+KLVFDCVNAAL+DI     D
Sbjct  814  STMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQKLVFDCVNAALLDIAGYGPD  873

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQ  228
             C + I + G HN  P+G+ +I  D+VW R+KEWF S    LS D  D N+L  E MV +
Sbjct  874  NCQRAIPYIGVHNNQPEGTRLILVDQVWDRMKEWFSSEVKYLSCDAEDINSLVMEGMVTK  933

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +GK W +  RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  934  EVMGKRWLKSFRLELDNVGMEIEGKLLEELVHESVIELA  972



>ref|XP_009592672.1| PREDICTED: uncharacterized protein LOC104089467 isoform X1 [Nicotiana 
tomentosiformis]
Length=975

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 165/219 (75%), Gaps = 7/219 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW  F+QTLL+MAGLDEVQS + 
Sbjct  756  GSIARTLSWDDSCADTA-SSACVRPSSSTQRTEEVEREWFSFVQTLLTMAGLDEVQSVAF  814

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+KLVFDCVNAAL+DI     D
Sbjct  815  STMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQKLVFDCVNAALLDIAGYGPD  874

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQ  228
             C + I + G HN  P+G+ +I  D+VW R+KEWF S    LS D  D N+L  E MV +
Sbjct  875  NCQRAIPYIGVHNNQPEGTRLILVDQVWDRMKEWFSSEVKYLSCDAEDINSLVMEGMVTK  934

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +GK W +  RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  935  EVMGKRWLKSFRLELDNVGMEIEGKLLEELVHESVIELA  973



>ref|XP_009770291.1| PREDICTED: uncharacterized protein LOC104221001 isoform X3 [Nicotiana 
sylvestris]
Length=907

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 162/219 (74%), Gaps = 7/219 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S Q TEE EREW  F+QTLL+MAGLDEVQSD+ 
Sbjct  687  GSIARTLSWDDSCADTA-SSACVRPSSSTQWTEEVEREWFSFVQTLLTMAGLDEVQSDAF  745

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+KLVFDCVNA L+DI     D
Sbjct  746  STMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQKLVFDCVNAVLLDIAGYGPD  805

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQ  228
             C +   + G HN  P G+S+I  D+VW R+KEWF S    LS D  D N+L  E MV +
Sbjct  806  NCQRARPYVGVHNNQPQGTSLILVDQVWDRMKEWFSSEVKYLSCDAEDINSLVMEGMVTK  865

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +GK W    RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  866  EVMGKRWLASFRLELDNLGMEIEGKLLEELVHESVIELA  904



>ref|XP_009770284.1| PREDICTED: uncharacterized protein LOC104221001 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 162/219 (74%), Gaps = 7/219 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S Q TEE EREW  F+QTLL+MAGLDEVQSD+ 
Sbjct  755  GSIARTLSWDDSCADTA-SSACVRPSSSTQWTEEVEREWFSFVQTLLTMAGLDEVQSDAF  813

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+KLVFDCVNA L+DI     D
Sbjct  814  STMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQKLVFDCVNAVLLDIAGYGPD  873

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQ  228
             C +   + G HN  P G+S+I  D+VW R+KEWF S    LS D  D N+L  E MV +
Sbjct  874  NCQRARPYVGVHNNQPQGTSLILVDQVWDRMKEWFSSEVKYLSCDAEDINSLVMEGMVTK  933

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +GK W    RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  934  EVMGKRWLASFRLELDNLGMEIEGKLLEELVHESVIELA  972



>ref|XP_009770277.1| PREDICTED: uncharacterized protein LOC104221001 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 162/219 (74%), Gaps = 7/219 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S Q TEE EREW  F+QTLL+MAGLDEVQSD+ 
Sbjct  756  GSIARTLSWDDSCADTA-SSACVRPSSSTQWTEEVEREWFSFVQTLLTMAGLDEVQSDAF  814

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+KLVFDCVNA L+DI     D
Sbjct  815  STMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQKLVFDCVNAVLLDIAGYGPD  874

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQ  228
             C +   + G HN  P G+S+I  D+VW R+KEWF S    LS D  D N+L  E MV +
Sbjct  875  NCQRARPYVGVHNNQPQGTSLILVDQVWDRMKEWFSSEVKYLSCDAEDINSLVMEGMVTK  934

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +GK W    RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  935  EVMGKRWLASFRLELDNLGMEIEGKLLEELVHESVIELA  973



>ref|XP_009780629.1| PREDICTED: uncharacterized protein LOC104229654 isoform X4 [Nicotiana 
sylvestris]
Length=904

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL+EVQSD+ 
Sbjct  684  GSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGLNEVQSDAF  742

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  743  LLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  802

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQ  228
            TC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L  + MVR+
Sbjct  803  TCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSLVVDGMVRK  862

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  863  EVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  900



>ref|XP_009780628.1| PREDICTED: uncharacterized protein LOC104229654 isoform X3 [Nicotiana 
sylvestris]
Length=909

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL+EVQSD+ 
Sbjct  689  GSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGLNEVQSDAF  747

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  748  LLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  807

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQ  228
            TC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L  + MVR+
Sbjct  808  TCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSLVVDGMVRK  867

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  868  EVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  905



>ref|XP_009780627.1| PREDICTED: uncharacterized protein LOC104229654 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL+EVQSD+ 
Sbjct  755  GSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGLNEVQSDAF  813

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  814  LLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  873

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQ  228
            TC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L  + MVR+
Sbjct  874  TCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSLVVDGMVRK  933

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  934  EVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  971



>ref|XP_009780624.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780625.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780626.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL+EVQSD+ 
Sbjct  756  GSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGLNEVQSDAF  814

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  815  LLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  874

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQ  228
            TC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L  + MVR+
Sbjct  875  TCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSLVVDGMVRK  934

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  935  EVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  972



>ref|XP_009589098.1| PREDICTED: uncharacterized protein LOC104086523 isoform X3 [Nicotiana 
tomentosiformis]
Length=972

 Score =   256 bits (653),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 170/219 (78%), Gaps = 8/219 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L P  S+QRTEEEE+EW  F+QTLL+ AGL+EVQSD+ 
Sbjct  751  GSIARTLSWNDSCVDTA-SSVCLRPSASIQRTEEEEKEWFSFVQTLLTAAGLNEVQSDAF  809

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+KY++LNE++ +HEA+RR+RRS RKLVFDCVNAAL++I     D
Sbjct  810  LLMWHSPESPLDPSLREKYVDLNEQDVLHEARRRRRRSIRKLVFDCVNAALMEIAGYGPD  869

Query  404  TCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVR  231
            TC + I +SG  N +P+G + +I  D+VW R+KEWF S    LSDDG D N+L  + MVR
Sbjct  870  TCQRAIPYSGVSNNLPEGGAKLILVDQVWTRMKEWFSSEVKYLSDDGGDGNSLVVDGMVR  929

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  930  KEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  968



>ref|XP_009589093.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589095.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589096.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
Length=977

 Score =   256 bits (653),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 170/219 (78%), Gaps = 8/219 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L P  S+QRTEEEE+EW  F+QTLL+ AGL+EVQSD+ 
Sbjct  756  GSIARTLSWNDSCVDTA-SSVCLRPSASIQRTEEEEKEWFSFVQTLLTAAGLNEVQSDAF  814

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+KY++LNE++ +HEA+RR+RRS RKLVFDCVNAAL++I     D
Sbjct  815  LLMWHSPESPLDPSLREKYVDLNEQDVLHEARRRRRRSIRKLVFDCVNAALMEIAGYGPD  874

Query  404  TCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVR  231
            TC + I +SG  N +P+G + +I  D+VW R+KEWF S    LSDDG D N+L  + MVR
Sbjct  875  TCQRAIPYSGVSNNLPEGGAKLILVDQVWTRMKEWFSSEVKYLSDDGGDGNSLVVDGMVR  934

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  935  KEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  973



>ref|XP_009589097.1| PREDICTED: uncharacterized protein LOC104086523 isoform X2 [Nicotiana 
tomentosiformis]
Length=976

 Score =   256 bits (653),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 170/219 (78%), Gaps = 8/219 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L P  S+QRTEEEE+EW  F+QTLL+ AGL+EVQSD+ 
Sbjct  755  GSIARTLSWNDSCVDTA-SSVCLRPSASIQRTEEEEKEWFSFVQTLLTAAGLNEVQSDAF  813

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHSP+SPLDP LR+KY++LNE++ +HEA+RR+RRS RKLVFDCVNAAL++I     D
Sbjct  814  LLMWHSPESPLDPSLREKYVDLNEQDVLHEARRRRRRSIRKLVFDCVNAALMEIAGYGPD  873

Query  404  TCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVR  231
            TC + I +SG  N +P+G + +I  D+VW R+KEWF S    LSDDG D N+L  + MVR
Sbjct  874  TCQRAIPYSGVSNNLPEGGAKLILVDQVWTRMKEWFSSEVKYLSDDGGDGNSLVVDGMVR  933

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E VGKGW +YLRLE +++G EIE KLLEE+V +++V L
Sbjct  934  KEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVEL  972



>ref|XP_006350289.1| PREDICTED: uncharacterized protein LOC102583747 [Solanum tuberosum]
Length=975

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 166/222 (75%), Gaps = 7/222 (3%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW  F+QTLL++AGLDEVQ D+ 
Sbjct  755  GSIARTLSWDDSCADTA-SSVCVRPSSSTQRTEEVEREWFSFVQTLLTVAGLDEVQPDAF  813

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
            S+ WHSP+SPLDP LR+KYI+LNEKET+HE+KRRQRRST+KLVFDCVNAAL++I     D
Sbjct  814  STMWHSPESPLDPSLREKYIDLNEKETLHESKRRQRRSTQKLVFDCVNAALLEIAEYGAD  873

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQ  228
               K I + G HN +P G+ ++  ++VW R+KEWF S    LS DG D N+L  E MV +
Sbjct  874  NFQKAIPYMGVHNNLPQGTRLVLLEQVWDRMKEWFSSEVKYLSTDGGDLNSLVVEEMVGK  933

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            E +GK W E LRLE +++G EIE KLLEE+V ++VV LA  M
Sbjct  934  EVMGKMWLENLRLELDNVGVEIEEKLLEELVNESVVELAGKM  975



>ref|XP_008235543.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
 ref|XP_008235544.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
Length=981

 Score =   241 bits (616),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 168/221 (76%), Gaps = 10/221 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC +TAT     +P VS   TEEEE++W   +QTLLS AGLD EVQ DS
Sbjct  762  GSIARTLSWDDSCAETATPYLLKSPSVS---TEEEEQDWHAIVQTLLSAAGLDGEVQCDS  818

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHS ++PLDP LRDKY N+N+KE +HEAKRRQ RS+RKLVFDCVNAAL+DI     
Sbjct  819  FFTRWHSLETPLDPSLRDKYANINDKEPLHEAKRRQWRSSRKLVFDCVNAALVDITGYGS  878

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVR  231
            D+  +T++ SGAH+   +G S + ADRVWGR++EWF S   C S +G D N+L  ER+VR
Sbjct  879  DSSTRTMSCSGAHDRFSEGDSSLLADRVWGRVREWFASEVRCASGEGGDSNSLVVERVVR  938

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
            +E VGKGW E++RLE +++G EIEGKLLEE+V++AVV L +
Sbjct  939  KEVVGKGWSEHMRLEIDNLGMEIEGKLLEELVEEAVVDLTE  979



>ref|XP_006352720.1| PREDICTED: uncharacterized protein LOC102578662 isoform X5 [Solanum 
tuberosum]
Length=963

 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGLDEVQSD+ 
Sbjct  742  GSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGLDEVQSDAF  800

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  801  LLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALMEISGYGPD  860

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
            TC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + MVR
Sbjct  861  TCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGMVR  920

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  921  KEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  960



>ref|XP_006352716.1| PREDICTED: uncharacterized protein LOC102578662 isoform X1 [Solanum 
tuberosum]
Length=1089

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
             GS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGLDEVQSD+ 
Sbjct  868   GSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGLDEVQSDAF  926

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
                WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  927   LLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALMEISGYGPD  986

Query  404   TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             TC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + MVR
Sbjct  987   TCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGMVR  1046

Query  230   QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1047  KEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1086



>ref|XP_006352719.1| PREDICTED: uncharacterized protein LOC102578662 isoform X4 [Solanum 
tuberosum]
Length=1087

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
             GS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGLDEVQSD+ 
Sbjct  866   GSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGLDEVQSDAF  924

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
                WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  925   LLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALMEISGYGPD  984

Query  404   TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             TC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + MVR
Sbjct  985   TCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGMVR  1044

Query  230   QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1045  KEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1084



>ref|XP_006352718.1| PREDICTED: uncharacterized protein LOC102578662 isoform X3 [Solanum 
tuberosum]
Length=1088

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
             GS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGLDEVQSD+ 
Sbjct  867   GSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGLDEVQSDAF  925

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
                WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  926   LLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALMEISGYGPD  985

Query  404   TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             TC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + MVR
Sbjct  986   TCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGMVR  1045

Query  230   QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1046  KEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1085



>ref|XP_006352717.1| PREDICTED: uncharacterized protein LOC102578662 isoform X2 [Solanum 
tuberosum]
Length=1088

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
             GS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGLDEVQSD+ 
Sbjct  867   GSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGLDEVQSDAF  925

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
                WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  926   LLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALMEISGYGPD  985

Query  404   TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             TC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + MVR
Sbjct  986   TCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGMVR  1045

Query  230   QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1046  KEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1085



>ref|XP_010323077.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323078.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323079.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
Length=963

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 166/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSC+DTA SS  L P +S  RTEEEE+EW  F+QTLL++AGLDEVQSD+ 
Sbjct  742  GSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEEEEKEWFSFVQTLLTVAGLDEVQSDAF  800

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHS +SPLDP LR+KY++L+EK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  801  LLMWHSTESPLDPSLREKYVDLHEKNTLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  860

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
            TC + I  +G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + +V 
Sbjct  861  TCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGLVM  920

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E VGKGW ++LRLE +++G EIE +LL E+V ++V+ L 
Sbjct  921  KEVVGKGWLQHLRLEIDNVGTEIERELLAELVHESVIELT  960



>ref|XP_010323075.1| PREDICTED: uncharacterized protein LOC101266733 isoform X3 [Solanum 
lycopersicum]
Length=985

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 166/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSC+DTA SS  L P +S  RTEEEE+EW  F+QTLL++AGLDEVQSD+ 
Sbjct  764  GSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEEEEKEWFSFVQTLLTVAGLDEVQSDAF  822

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHS +SPLDP LR+KY++L+EK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  823  LLMWHSTESPLDPSLREKYVDLHEKNTLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  882

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
            TC + I  +G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + +V 
Sbjct  883  TCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGLVM  942

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E VGKGW ++LRLE +++G EIE +LL E+V ++V+ L 
Sbjct  943  KEVVGKGWLQHLRLEIDNVGTEIERELLAELVHESVIELT  982



>ref|XP_010323076.1| PREDICTED: uncharacterized protein LOC101266733 isoform X4 [Solanum 
lycopersicum]
Length=984

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 166/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSC+DTA SS  L P +S  RTEEEE+EW  F+QTLL++AGLDEVQSD+ 
Sbjct  763  GSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEEEEKEWFSFVQTLLTVAGLDEVQSDAF  821

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHS +SPLDP LR+KY++L+EK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  822  LLMWHSTESPLDPSLREKYVDLHEKNTLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  881

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
            TC + I  +G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + +V 
Sbjct  882  TCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGLVM  941

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E VGKGW ++LRLE +++G EIE +LL E+V ++V+ L 
Sbjct  942  KEVVGKGWLQHLRLEIDNVGTEIERELLAELVHESVIELT  981



>ref|XP_010323074.1| PREDICTED: uncharacterized protein LOC101266733 isoform X2 [Solanum 
lycopersicum]
Length=987

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 166/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSC+DTA SS  L P +S  RTEEEE+EW  F+QTLL++AGLDEVQSD+ 
Sbjct  766  GSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEEEEKEWFSFVQTLLTVAGLDEVQSDAF  824

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHS +SPLDP LR+KY++L+EK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  825  LLMWHSTESPLDPSLREKYVDLHEKNTLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  884

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
            TC + I  +G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + +V 
Sbjct  885  TCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGLVM  944

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E VGKGW ++LRLE +++G EIE +LL E+V ++V+ L 
Sbjct  945  KEVVGKGWLQHLRLEIDNVGTEIERELLAELVHESVIELT  984



>ref|XP_010323073.1| PREDICTED: uncharacterized protein LOC101266733 isoform X1 [Solanum 
lycopersicum]
Length=988

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 166/220 (75%), Gaps = 8/220 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSW+DSC+DTA SS  L P +S  RTEEEE+EW  F+QTLL++AGLDEVQSD+ 
Sbjct  767  GSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEEEEKEWFSFVQTLLTVAGLDEVQSDAF  825

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
               WHS +SPLDP LR+KY++L+EK T+HEA+RRQRRSTRKLVFDCVNAAL++I     D
Sbjct  826  LLMWHSTESPLDPSLREKYVDLHEKNTLHEARRRQRRSTRKLVFDCVNAALMEIAGYGPD  885

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
            TC + I  +G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N  + + +V 
Sbjct  886  TCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNSLVVDGLVM  945

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E VGKGW ++LRLE +++G EIE +LL E+V ++V+ L 
Sbjct  946  KEVVGKGWLQHLRLEIDNVGTEIERELLAELVHESVIELT  985



>ref|XP_007199004.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
 gb|EMJ00203.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
Length=981

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 165/219 (75%), Gaps = 10/219 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC +TAT     +P VS    EEEE++W   +QTLLS AGL+ EVQ DS
Sbjct  762  GSIARTLSWDDSCAETATPYLLKSPSVS---AEEEEQDWHAIVQTLLSAAGLNGEVQCDS  818

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHS +SPLDP LRDKY NLN+KE +HEAKRRQ RS+RKLVFDCVNAAL+DI     
Sbjct  819  FFTRWHSLESPLDPSLRDKYANLNDKEPLHEAKRRQWRSSRKLVFDCVNAALVDITGYGS  878

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVR  231
            D+  +T++ SGA +   +G S + ADRVWG+++EWF S   C S +  D N+L  ER+VR
Sbjct  879  DSGTRTMSCSGARDRFSEGDSSLLADRVWGQVREWFASEVRCASGEAGDSNSLVVERVVR  938

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E VGKGW E++RLE +++GKEIEGKLLEE+V++AVV L
Sbjct  939  KEVVGKGWSEHMRLEIDNLGKEIEGKLLEELVEEAVVDL  977



>ref|XP_009371010.1| PREDICTED: uncharacterized protein LOC103960277 isoform X2 [Pyrus 
x bretschneideri]
Length=985

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 164/223 (74%), Gaps = 14/223 (6%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGLD EVQ DS
Sbjct  762  GSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGLDGEVQCDS  818

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              + WHS DSPLDP LRDKY NL++KE +HEAKRR+ RS++KLVFDCVNAAL+DI     
Sbjct  819  FFAIWHSLDSPLDPSLRDKYSNLSDKEPLHEAKRRRLRSSQKLVFDCVNAALMDITGHGS  878

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-----TE  243
            D+C +T + SGAH+   +G S + AD VW R+KEWF     C+SD G D N L      E
Sbjct  879  DSCSRTTSCSGAHDRFVEGDSPLLADHVWARMKEWFSDEVRCVSDGGGDINGLVVERVVE  938

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            R+V++E VGKGW E++RLE +++G+ IEGKLLEE+V++AVVGL
Sbjct  939  RVVKKEVVGKGWSEHMRLEIDNLGRGIEGKLLEELVEEAVVGL  981



>ref|XP_009371001.1| PREDICTED: uncharacterized protein LOC103960277 isoform X1 [Pyrus 
x bretschneideri]
Length=988

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 164/223 (74%), Gaps = 14/223 (6%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGLD EVQ DS
Sbjct  765  GSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGLDGEVQCDS  821

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              + WHS DSPLDP LRDKY NL++KE +HEAKRR+ RS++KLVFDCVNAAL+DI     
Sbjct  822  FFAIWHSLDSPLDPSLRDKYSNLSDKEPLHEAKRRRLRSSQKLVFDCVNAALMDITGHGS  881

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-----TE  243
            D+C +T + SGAH+   +G S + AD VW R+KEWF     C+SD G D N L      E
Sbjct  882  DSCSRTTSCSGAHDRFVEGDSPLLADHVWARMKEWFSDEVRCVSDGGGDINGLVVERVVE  941

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            R+V++E VGKGW E++RLE +++G+ IEGKLLEE+V++AVVGL
Sbjct  942  RVVKKEVVGKGWSEHMRLEIDNLGRGIEGKLLEELVEEAVVGL  984



>ref|XP_002521158.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41309.1| conserved hypothetical protein [Ricinus communis]
Length=990

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 158/219 (72%), Gaps = 8/219 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSCV+TAT  YSL P       ++EE++W FFI+TLLS AGLD  +  DS 
Sbjct  770  SIARTLSWDDSCVETATP-YSLKPSSISTCPQDEEQDWPFFIRTLLSAAGLDVNMHLDSF  828

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK-  393
            SSRWHSP+SPLDP LR+KY+NLN+KE +HEAKRRQRRSTRKLVFD VNAAL++I  C   
Sbjct  829  SSRWHSPESPLDPALRNKYVNLNDKELLHEAKRRQRRSTRKLVFDSVNAALVEITGCGHD  888

Query  392  ----TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQ  228
                 +   GAHN    G+S +  D VW ++KEWF S   C  +D  D ++L  ER+VR+
Sbjct  889  RSTTVVPCKGAHNWFIQGTSPMLVDHVWAQMKEWFCSEVKCTFEDSEDRSSLVVERVVRK  948

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E VGKGW + +R+E +++GKEIE KLL EIV+D VV LA
Sbjct  949  EVVGKGWADNMRVELDNLGKEIEDKLLSEIVEDVVVDLA  987



>ref|XP_010326332.1| PREDICTED: uncharacterized protein LOC101266067 isoform X2 [Solanum 
lycopersicum]
Length=894

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 165/225 (73%), Gaps = 10/225 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+C DTA SS  + P  S QRTEE EREW  F+QTLL++AGLDEVQ D+ 
Sbjct  671  GSIARTLSWDDTCADTA-SSVCVRPSSSTQRTEEVEREWFSFVQTLLTVAGLDEVQPDAF  729

Query  569  SS--RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI----  408
            S+  +WHSP+SPLDP LR+KYI+LNEKET+HE+KRRQRRST+KLVFDCVNAAL++I    
Sbjct  730  STMWQWHSPESPLDPSLREKYIDLNEKETLHESKRRQRRSTQKLVFDCVNAALLEIAEYG  789

Query  407  -DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERM  237
             D   K I + G HN +P G++ ++  ++VW  +KEWF S    LS DG D N+L  E M
Sbjct  790  ADNFQKAIPYMGVHNNLPQGTTRLVLLEQVWDWMKEWFSSEMKYLSTDGGDLNSLVVEEM  849

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            V +E +GK W   LR+E +++G EIE KLLEE+V ++VV L   M
Sbjct  850  VGKEVMGKMWLGNLRIELDNVGVEIEEKLLEELVNESVVELTGKM  894



>ref|XP_004247114.1| PREDICTED: uncharacterized protein LOC101266067 isoform X1 [Solanum 
lycopersicum]
Length=981

 Score =   225 bits (573),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 165/225 (73%), Gaps = 10/225 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+C DTA SS  + P  S QRTEE EREW  F+QTLL++AGLDEVQ D+ 
Sbjct  758  GSIARTLSWDDTCADTA-SSVCVRPSSSTQRTEEVEREWFSFVQTLLTVAGLDEVQPDAF  816

Query  569  SS--RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI----  408
            S+  +WHSP+SPLDP LR+KYI+LNEKET+HE+KRRQRRST+KLVFDCVNAAL++I    
Sbjct  817  STMWQWHSPESPLDPSLREKYIDLNEKETLHESKRRQRRSTQKLVFDCVNAALLEIAEYG  876

Query  407  -DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERM  237
             D   K I + G HN +P G++ ++  ++VW  +KEWF S    LS DG D N+L  E M
Sbjct  877  ADNFQKAIPYMGVHNNLPQGTTRLVLLEQVWDWMKEWFSSEMKYLSTDGGDLNSLVVEEM  936

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            V +E +GK W   LR+E +++G EIE KLLEE+V ++VV L   M
Sbjct  937  VGKEVMGKMWLGNLRIELDNVGVEIEEKLLEELVNESVVELTGKM  981



>ref|XP_011080145.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
 ref|XP_011080146.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
Length=957

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 144/200 (72%), Gaps = 8/200 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC+DTA SS+     +  + T+E+E+    +++TLLS+AGL  EVQSDS
Sbjct  732  GSIARTLSWDDSCIDTA-SSHPAKECLITEETDEDEQNLYTYVKTLLSVAGLQGEVQSDS  790

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHSP+SPLDP LRDKYI+L +KET+HEAKRRQRRS RKLVFDCVN AL+DI     
Sbjct  791  FLARWHSPESPLDPSLRDKYIDLKDKETLHEAKRRQRRSMRKLVFDCVNTALVDIAGYGS  850

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVR  231
            D   + +   GA+N   D +S+   D+VWGRI  WF     C+SDD  D+NNL  ER+VR
Sbjct  851  DLGQRALPCIGANNHTSDSASLTMVDKVWGRINVWFSIKVKCVSDDSGDENNLVVERLVR  910

Query  230  QEAVGKGWHEYLRLEAESIG  171
             E  GKGW ++LRLE +++G
Sbjct  911  NEVAGKGWMDHLRLEIDNLG  930



>gb|KJB10993.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=930

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 154/222 (69%), Gaps = 7/222 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL+ EVQ DS 
Sbjct  708  SIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGLNGEVQLDSF  767

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL++I     D
Sbjct  768  FARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAALLEISGYGSD  827

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDNNLTERMVRQ  228
             C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+ + ER+V++
Sbjct  828  RCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDSLVVERVVQK  887

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            E VGKGW + ++ EA+++G+EIE +LLEE+V++AV  +   +
Sbjct  888  EVVGKGWIDQMKWEADNLGREIEWRLLEELVEEAVTDITGKL  929



>gb|KJB10997.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=999

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 154/222 (69%), Gaps = 7/222 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL+ EVQ DS 
Sbjct  777  SIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGLNGEVQLDSF  836

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL++I     D
Sbjct  837  FARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAALLEISGYGSD  896

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDNNLTERMVRQ  228
             C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+ + ER+V++
Sbjct  897  RCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDSLVVERVVQK  956

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            E VGKGW + ++ EA+++G+EIE +LLEE+V++AV  +   +
Sbjct  957  EVVGKGWIDQMKWEADNLGREIEWRLLEELVEEAVTDITGKL  998



>gb|KJB10995.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
 gb|KJB10998.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=988

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 154/222 (69%), Gaps = 7/222 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL+ EVQ DS 
Sbjct  766  SIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGLNGEVQLDSF  825

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL++I     D
Sbjct  826  FARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAALLEISGYGSD  885

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDNNLTERMVRQ  228
             C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+ + ER+V++
Sbjct  886  RCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDSLVVERVVQK  945

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            E VGKGW + ++ EA+++G+EIE +LLEE+V++AV  +   +
Sbjct  946  EVVGKGWIDQMKWEADNLGREIEWRLLEELVEEAVTDITGKL  987



>ref|XP_004292261.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458059.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
Length=987

 Score =   220 bits (560),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 160/223 (72%), Gaps = 11/223 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTAT--SSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            GS+ARTLSW +SC + AT    Y +  P     TEEEE++W   +QTLLS AGLD E+Q 
Sbjct  761  GSIARTLSWGESCAEPATPYGPYLVKSPSVSTSTEEEEQDWHAVVQTLLSAAGLDGELQC  820

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI---  408
            DS   +WHS +SPLDP LRDKY N N+KE +HEAKRR+ RS+RKLVFDCVNAAL+DI   
Sbjct  821  DSFFGKWHSLESPLDPSLRDKYANPNDKEPLHEAKRRKWRSSRKLVFDCVNAALVDITGY  880

Query  407  ----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TE  243
                 +  + ++ SGAH+   +G S++ ADRVW R+KEWF S   C+S+DG D N+L  E
Sbjct  881  GSSDSSSVRIVSCSGAHDRFLEGDSLLLADRVWSRVKEWFLSDVRCVSEDGGDINSLVVE  940

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            R+V++E VG+GW E +R E + +GKEIEGKLL+E+V++AVV L
Sbjct  941  RVVKKEVVGRGWPEQMRCEIDIVGKEIEGKLLQELVEEAVVDL  983



>gb|KHG22481.1| Viral inhibitor of RIP activation [Gossypium arboreum]
Length=1004

 Score =   219 bits (559),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 153/222 (69%), Gaps = 7/222 (3%)
 Frame = -1

Query  746   SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
             S+ARTLSWDDSC +TAT  Y           +EEE++W  F+Q LLS AGL+ EVQ DS 
Sbjct  782   SIARTLSWDDSCSETATLLYPSKLSSVSPGAKEEEQDWFLFVQLLLSAAGLNGEVQLDSF  841

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
              +RWHS +SPLDP LRDKY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL++I     D
Sbjct  842   FARWHSAESPLDPCLRDKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAALLEISGYGSD  901

Query  404   TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDNNLTERMVRQ  228
              C K ++F  A   + +G+S +  D VW ++KEWF     CL  DDG  D+ + ER++++
Sbjct  902   RCMKAMSFGRAQMIVKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDSLVVERVLQK  961

Query  227   EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
             E VGKGW + ++ EA+++ +EIE +LLEE+V++AV  L   +
Sbjct  962   EVVGKGWIDQMQWEADNLEREIEWRLLEELVEEAVTDLTGKL  1003



>ref|XP_002303096.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|EEE82369.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=940

 Score =   219 bits (557),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 152/221 (69%), Gaps = 18/221 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            SVARTL+WD+SC +TA SSY L P   PVS+   EE+E+ W  F+Q LL+ AGLD EVQ 
Sbjct  732  SVARTLTWDNSCAETA-SSYPLKPTPSPVSLG-AEEDEKYWFSFVQALLTAAGLDCEVQL  789

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            DS  SRWHSP+SPLDP LRDKY N N+KE +HEAKRRQRRS +KLVFDCVNAAL++I   
Sbjct  790  DSFFSRWHSPESPLDPSLRDKYANPNDKELLHEAKRRQRRSNQKLVFDCVNAALVEIT--  847

Query  398  HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVRQE  225
                     H +     ++ S + VW ++KEWF S   C S DG  D+N  + E +VR+E
Sbjct  848  --------GHGSDRSTRAMTSTEYVWAQMKEWFCSDVRCASGDGGGDSNSLVVEMVVRKE  899

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
             VGKGW + +R+E +++  EIEGKLL+E+V++ VV  A  M
Sbjct  900  VVGKGWIDKMRVELDTLQNEIEGKLLDELVEETVVDFAGRM  940



>ref|XP_006386899.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|ERP64696.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=968

 Score =   219 bits (557),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 152/221 (69%), Gaps = 18/221 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            SVARTL+WD+SC +TA SSY L P   PVS+   EE+E+ W  F+Q LL+ AGLD EVQ 
Sbjct  760  SVARTLTWDNSCAETA-SSYPLKPTPSPVSLG-AEEDEKYWFSFVQALLTAAGLDCEVQL  817

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            DS  SRWHSP+SPLDP LRDKY N N+KE +HEAKRRQRRS +KLVFDCVNAAL++I   
Sbjct  818  DSFFSRWHSPESPLDPSLRDKYANPNDKELLHEAKRRQRRSNQKLVFDCVNAALVEIT--  875

Query  398  HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVRQE  225
                     H +     ++ S + VW ++KEWF S   C S DG  D+N  + E +VR+E
Sbjct  876  --------GHGSDRSTRAMTSTEYVWAQMKEWFCSDVRCASGDGGGDSNSLVVEMVVRKE  927

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
             VGKGW + +R+E +++  EIEGKLL+E+V++ VV  A  M
Sbjct  928  VVGKGWIDKMRVELDTLQNEIEGKLLDELVEETVVDFAGRM  968



>emb|CDP03827.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 154/218 (71%), Gaps = 28/218 (13%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSW +SCVDTATS Y L P  S Q  EE E EW FF+Q LLS+AGLD EV+SD+
Sbjct  759  GSIARTLSWGESCVDTATS-YPLKPSSSPQGAEEGEGEWFFFVQALLSVAGLDGEVRSDA  817

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
            L +RWHS +SPLDP LRDKYINLN+K+T+ EA+RRQ  STRKLVFDCVNAAL++I     
Sbjct  818  LLARWHSSESPLDPSLRDKYINLNDKDTLREARRRQWWSTRKLVFDCVNAALVEIAGYGS  877

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMV  234
             TC + I F                   W R+KEWF     C++ D V DNN  + ER+V
Sbjct  878  GTCQRAIPF-------------------WARMKEWFSGEERCVTGDCVVDNNSVVVERVV  918

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            R+E VGKGW ++LRLE +++GKEIE KLL+EIVQ+AVV
Sbjct  919  RKEVVGKGWLDHLRLEMDNLGKEIEQKLLDEIVQEAVV  956



>ref|XP_010652446.1| PREDICTED: uncharacterized protein LOC100241277 isoform X2 [Vitis 
vinifera]
Length=986

 Score =   217 bits (552),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 9/201 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDSL  570
            S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WLFF+QTLLS AG D+ VQ+D+ 
Sbjct  765  SIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWLFFVQTLLSAAGFDDNVQTDTF  823

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS RKLV+DCVNAAL+DI     D
Sbjct  824  FSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSNRKLVYDCVNAALVDITDYGPD  883

Query  404  TCHKTIAFSGAHNTIPDG--SSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
               +    SGA+NT  +G  SS I  +RVWGR+KEWF     C+  +G D++ + ER+VR
Sbjct  884  CTQRARRCSGAYNTGVEGGSSSPILVERVWGRMKEWFSGEVRCVWGEGGDNDLVVERVVR  943

Query  230  QEAVGKGWHEYLRLEAESIGK  168
            +E VGKGW E++RL+ ++IGK
Sbjct  944  KEVVGKGWVEHMRLQVDNIGK  964



>ref|XP_002267519.1| PREDICTED: uncharacterized protein LOC100241277 isoform X1 [Vitis 
vinifera]
Length=991

 Score =   216 bits (551),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 9/201 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDSL  570
            S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WLFF+QTLLS AG D+ VQ+D+ 
Sbjct  770  SIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWLFFVQTLLSAAGFDDNVQTDTF  828

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS RKLV+DCVNAAL+DI     D
Sbjct  829  FSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSNRKLVYDCVNAALVDITDYGPD  888

Query  404  TCHKTIAFSGAHNTIPDG--SSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
               +    SGA+NT  +G  SS I  +RVWGR+KEWF     C+  +G D++ + ER+VR
Sbjct  889  CTQRARRCSGAYNTGVEGGSSSPILVERVWGRMKEWFSGEVRCVWGEGGDNDLVVERVVR  948

Query  230  QEAVGKGWHEYLRLEAESIGK  168
            +E VGKGW E++RL+ ++IGK
Sbjct  949  KEVVGKGWVEHMRLQVDNIGK  969



>ref|XP_008382666.1| PREDICTED: uncharacterized protein LOC103445438 [Malus domestica]
Length=983

 Score =   214 bits (544),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 159/219 (73%), Gaps = 10/219 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS++RTLSWD+SC +TA+     +P VS   TE EE++W   +QTLLS AGLD  V+ DS
Sbjct  764  GSISRTLSWDESCAETASPYLLKSPSVS---TEGEEQDWHAIVQTLLSTAGLDGXVKCDS  820

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHS +SPLDP LR+K  NL++KE +HEAKRR+ RS+RKLVFDCVNAAL+DI     
Sbjct  821  FFARWHSLESPLDPSLREKXANLSDKEPLHEAKRRRFRSSRKLVFDCVNAALVDITGYGS  880

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-LTERMVR  231
            D+C +T   SGAH+   +G S + AD VW R+ EWF     C+ +DG D N+ + ER+++
Sbjct  881  DSCTRTTPCSGAHDRFLEGDSPLLADHVWARMPEWFSDEVRCVLEDGXDINDVVVERVLK  940

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E VGKGW E +RLE ++ GKEIEGKLLEE+V++AVV L
Sbjct  941  KEVVGKGWSENMRLEIDNFGKEIEGKLLEELVEEAVVDL  979



>emb|CAN81514.1| hypothetical protein VITISV_012030 [Vitis vinifera]
Length=1081

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 149/201 (74%), Gaps = 9/201 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDSL  570
            S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WLFF+QTLLS AG D+ VQ+D+ 
Sbjct  773  SIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWLFFVQTLLSAAGFDDNVQTDTF  831

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS RKLV+DCVNAAL+DI     D
Sbjct  832  FSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSNRKLVYDCVNAALVDITDYGPD  891

Query  404  TCHKTIAFSGAHNTIPDG--SSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
               +    SGA+NT  +G  SS I  +RVW R+KEWF     C+  +G D++ + ER+VR
Sbjct  892  CTQRARRCSGAYNTGVEGGSSSPILVERVWXRMKEWFSGEVRCVWGEGGDNDLVVERVVR  951

Query  230  QEAVGKGWHEYLRLEAESIGK  168
            +E VGKGW E++RL+ ++IGK
Sbjct  952  KEVVGKGWVEHMRLQVDNIGK  972



>ref|XP_008372424.1| PREDICTED: uncharacterized protein LOC103435787 isoform X2 [Malus 
domestica]
Length=985

 Score =   212 bits (539),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 164/223 (74%), Gaps = 14/223 (6%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGLD EVQ DS
Sbjct  762  GSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGLDGEVQCDS  818

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID-----I  408
              + WHS +SPLDP LRDKY N ++KE +HEAKRR+ RS+RKLVFDCVNAAL+D      
Sbjct  819  FFTIWHSLESPLDPSLRDKYANQSDKEPLHEAKRRRLRSSRKLVFDCVNAALVDNTGYGS  878

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-----TE  243
            D+C +T + SGAH+   +G S + ADR+W R+K+WF     C+S+DG D N L      E
Sbjct  879  DSCTRTTSCSGAHDRFVEGDSPLLADRLWARMKDWFSDEVRCVSEDGGDINGLVVERVVE  938

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            RMV++E VGKGW E++RLE +++G++IEGKLLEE+V+++VV L
Sbjct  939  RMVKKEVVGKGWSEHMRLEIDNLGRDIEGKLLEELVEESVVDL  981



>ref|XP_008372423.1| PREDICTED: uncharacterized protein LOC103435787 isoform X1 [Malus 
domestica]
Length=988

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 164/223 (74%), Gaps = 14/223 (6%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGLD EVQ DS
Sbjct  765  GSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGLDGEVQCDS  821

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID-----I  408
              + WHS +SPLDP LRDKY N ++KE +HEAKRR+ RS+RKLVFDCVNAAL+D      
Sbjct  822  FFTIWHSLESPLDPSLRDKYANQSDKEPLHEAKRRRLRSSRKLVFDCVNAALVDNTGYGS  881

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-----TE  243
            D+C +T + SGAH+   +G S + ADR+W R+K+WF     C+S+DG D N L      E
Sbjct  882  DSCTRTTSCSGAHDRFVEGDSPLLADRLWARMKDWFSDEVRCVSEDGGDINGLVVERVVE  941

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            RMV++E VGKGW E++RLE +++G++IEGKLLEE+V+++VV L
Sbjct  942  RMVKKEVVGKGWSEHMRLEIDNLGRDIEGKLLEELVEESVVDL  984



>ref|XP_011024529.1| PREDICTED: uncharacterized protein LOC105125670 isoform X3 [Populus 
euphratica]
 ref|XP_011024530.1| PREDICTED: uncharacterized protein LOC105125670 isoform X3 [Populus 
euphratica]
Length=937

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 156/226 (69%), Gaps = 14/226 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ AGLD EVQ 
Sbjct  715  SVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTAAGLDCEVQL  772

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVNAAL++I T 
Sbjct  773  DSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVNAALVEI-TG  831

Query  398  HKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTER  240
            H +        SG  N + + +  + A+ VW ++KEWF S   C S DG   +N  + E 
Sbjct  832  HGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGGGSNSLVVEM  891

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  892  VVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  937



>ref|XP_011024531.1| PREDICTED: uncharacterized protein LOC105125670 isoform X4 [Populus 
euphratica]
 ref|XP_011024532.1| PREDICTED: uncharacterized protein LOC105125670 isoform X4 [Populus 
euphratica]
Length=932

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 156/226 (69%), Gaps = 14/226 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ AGLD EVQ 
Sbjct  710  SVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTAAGLDCEVQL  767

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVNAAL++I T 
Sbjct  768  DSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVNAALVEI-TG  826

Query  398  HKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTER  240
            H +        SG  N + + +  + A+ VW ++KEWF S   C S DG   +N  + E 
Sbjct  827  HGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGGGSNSLVVEM  886

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  887  VVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  932



>ref|XP_011024525.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024526.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024527.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
Length=996

 Score =   209 bits (532),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 156/226 (69%), Gaps = 14/226 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ AGLD EVQ 
Sbjct  774  SVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTAAGLDCEVQL  831

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVNAAL++I T 
Sbjct  832  DSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVNAALVEI-TG  890

Query  398  HKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTER  240
            H +        SG  N + + +  + A+ VW ++KEWF S   C S DG   +N  + E 
Sbjct  891  HGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGGGSNSLVVEM  950

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  951  VVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  996



>ref|XP_011024528.1| PREDICTED: uncharacterized protein LOC105125670 isoform X2 [Populus 
euphratica]
Length=991

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 156/226 (69%), Gaps = 14/226 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQS  579
            SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ AGLD EVQ 
Sbjct  769  SVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTAAGLDCEVQL  826

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVNAAL++I T 
Sbjct  827  DSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVNAALVEI-TG  885

Query  398  HKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTER  240
            H +        SG  N + + +  + A+ VW ++KEWF S   C S DG   +N  + E 
Sbjct  886  HGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGGGSNSLVVEM  945

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  946  VVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  991



>ref|XP_007050071.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX94228.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=894

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 151/215 (70%), Gaps = 9/215 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +T T   S +  VS     +EE++W+F +Q+LLS AGL  EV+ +S 
Sbjct  682  SIARTLSWDDSCSETVTLYPSKHSSVSP--GAKEEQDWVFSVQSLLSAAGLSGEVRLESF  739

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHSP+SPL+P LRDKY NLN+KE VH AKRR+ RS RKLVFDCVNAAL++I      
Sbjct  740  IGRWHSPESPLEPSLRDKYGNLNDKEPVHAAKRREWRSNRKLVFDCVNAALLEI----TG  795

Query  389  IAFSG-AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQEAVG  216
               SG A   + +G+S    D VWGR+KEWF S   CL  D  D N+L  +R+V++E VG
Sbjct  796  YGSSGRAQMRVMEGASGTLVDHVWGRMKEWFSSEVKCLVGDDGDSNSLVVDRVVQKEVVG  855

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + ++LE +++G+ IE KLLEE+V++AVV L+
Sbjct  856  KGWADRMKLEVDNLGRVIEVKLLEELVEEAVVDLS  890



>ref|XP_007050069.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94226.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=984

 Score =   206 bits (523),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 151/215 (70%), Gaps = 9/215 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +T T   S +  VS     +EE++W+F +Q+LLS AGL  EV+ +S 
Sbjct  772  SIARTLSWDDSCSETVTLYPSKHSSVSP--GAKEEQDWVFSVQSLLSAAGLSGEVRLESF  829

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHSP+SPL+P LRDKY NLN+KE VH AKRR+ RS RKLVFDCVNAAL++I      
Sbjct  830  IGRWHSPESPLEPSLRDKYGNLNDKEPVHAAKRREWRSNRKLVFDCVNAALLEI----TG  885

Query  389  IAFSG-AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQEAVG  216
               SG A   + +G+S    D VWGR+KEWF S   CL  D  D N+L  +R+V++E VG
Sbjct  886  YGSSGRAQMRVMEGASGTLVDHVWGRMKEWFSSEVKCLVGDDGDSNSLVVDRVVQKEVVG  945

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + ++LE +++G+ IE KLLEE+V++AVV L+
Sbjct  946  KGWADRMKLEVDNLGRVIEVKLLEELVEEAVVDLS  980



>ref|XP_007050070.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94227.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=988

 Score =   206 bits (523),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 152/217 (70%), Gaps = 9/217 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +T T   S +  VS     +EE++W+F +Q+LLS AGL  EV+ +S 
Sbjct  772  SIARTLSWDDSCSETVTLYPSKHSSVSP--GAKEEQDWVFSVQSLLSAAGLSGEVRLESF  829

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHSP+SPL+P LRDKY NLN+KE VH AKRR+ RS RKLVFDCVNAAL++I      
Sbjct  830  IGRWHSPESPLEPSLRDKYGNLNDKEPVHAAKRREWRSNRKLVFDCVNAALLEI----TG  885

Query  389  IAFSG-AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQEAVG  216
               SG A   + +G+S    D VWGR+KEWF S   CL  D  D N+L  +R+V++E VG
Sbjct  886  YGSSGRAQMRVMEGASGTLVDHVWGRMKEWFSSEVKCLVGDDGDSNSLVVDRVVQKEVVG  945

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            KGW + ++LE +++G+ IE KLLEE+V++AVV L+ +
Sbjct  946  KGWADRMKLEVDNLGRVIEVKLLEELVEEAVVDLSGS  982



>gb|KDO65806.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=952

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 12/221 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGLD  VQSD 
Sbjct  730  GSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGLDGRVQSDI  787

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL++I     
Sbjct  788  FFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAALVEITGYGS  846

Query  407  --DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-LTERM  237
              D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D N+ + ER+
Sbjct  847  ESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDSNSPVVERV  906

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L
Sbjct  907  VRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDL  947



>ref|XP_011083092.1| PREDICTED: uncharacterized protein LOC105165697 [Sesamum indicum]
Length=958

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 154/209 (74%), Gaps = 12/209 (6%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC+DTA SSY +   ++ Q T EE+ EW FF++TL+S+AGL  EV+S+S
Sbjct  735  GSIARTLSWDDSCMDTA-SSYPIKESLTTQGTGEEQ-EWFFFVKTLVSVAGLQGEVRSNS  792

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHS +SPLDP LRDKYI+LNEKET HEAKRRQ+RS +KLVFDCVNAAL+DI     
Sbjct  793  FLARWHSLESPLDPSLRDKYIDLNEKETQHEAKRRQKRSLQKLVFDCVNAALVDIVGYES  852

Query  407  DTCHKTIAFSGAHNTIPDGSSIISA---DRVWGRIKEWFPSAAGCLSDDGVDDNNL-TER  240
            D+  + I     ++++ + +S  S+   D VW R+ EWF    GC+  +  D+N+L  ER
Sbjct  853  DSGRRAIPCVETNSSVLENASTSSSTVLDEVWARLNEWFSGEVGCVWGECGDENSLVVER  912

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGK  153
            +VR+E VGKGW E LRLE +++GKEIEGK
Sbjct  913  VVRKEVVGKGWTENLRLEMDNLGKEIEGK  941



>gb|KDO65805.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1000

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 12/221 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGLD  VQSD 
Sbjct  778  GSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGLDGRVQSDI  835

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL++I     
Sbjct  836  FFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAALVEITGYGS  894

Query  407  --DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-LTERM  237
              D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D N+ + ER+
Sbjct  895  ESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDSNSPVVERV  954

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L
Sbjct  955  VRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDL  995



>gb|KDO65804.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1002

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 12/221 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGLD  VQSD 
Sbjct  780  GSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGLDGRVQSDI  837

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL++I     
Sbjct  838  FFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAALVEITGYGS  896

Query  407  --DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-LTERM  237
              D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D N+ + ER+
Sbjct  897  ESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDSNSPVVERV  956

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L
Sbjct  957  VRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDL  997



>ref|XP_006375643.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
 gb|ERP53440.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
Length=951

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 144/219 (66%), Gaps = 13/219 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSL--NPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSD  576
            SVAR LSWDDS  +TA S Y L  +P  +    EE+E++W F +QTLL+ AGLD ++Q D
Sbjct  734  SVARNLSWDDSRAETA-SPYPLKSSPSPAPSGAEEDEKDWFFLVQTLLTTAGLDSDLQLD  792

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI----  408
            S  +RWHSP SPLDP LRDKY NLN+KE + EAKRRQRRS RKLVFD VNAAL++I    
Sbjct  793  SFFARWHSPGSPLDPSLRDKYANLNDKELLLEAKRRQRRSNRKLVFDSVNAALVEITGHG  852

Query  407  -DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
             D   K +  SG  N + +G+     D +W ++K W  S   C   DG D N L   MV 
Sbjct  853  SDRSTKAVTCSGVQNWLVEGAQPQIVDYLWAQLKSWLCSDVRCTFGDGGDSNGLVVEMV-  911

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
               VGKGW + +R+E +S+G EIEGKLL+E+V++AV  L
Sbjct  912  ---VGKGWVDKMRVELDSLGNEIEGKLLDELVEEAVFDL  947



>gb|KDO65803.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1010

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 12/221 (5%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
             GS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGLD  VQSD 
Sbjct  788   GSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGLDGRVQSDI  845

Query  572   LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
               +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL++I     
Sbjct  846   FFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAALVEITGYGS  904

Query  407   --DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-LTERM  237
               D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D N+ + ER+
Sbjct  905   ESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDSNSPVVERV  964

Query  236   VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L
Sbjct  965   VRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDL  1005



>gb|KDP26434.1| hypothetical protein JCGZ_17592 [Jatropha curcas]
Length=965

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 148/213 (69%), Gaps = 8/213 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +TAT+ YSL         EEEE++  FFIQTLLS AG+D     DS+
Sbjct  755  SIARTLSWDDSCAETATT-YSLKASSISSCPEEEEQDMRFFIQTLLSAAGIDGSTPLDSI  813

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             +RWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVNAAL++I  C   
Sbjct  814  FARWHSPESPLDPALRDKYANLNDKELLHEAKRRQRRSNQKLVFDCVNAALVEITGCGSD  873

Query  389  IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQEAVGK  213
             +      T P        + +W ++KEWF S   C  +D  D ++L  ER+VR+E VGK
Sbjct  874  RSIRVIQGTPP-----TLVEHIWAQMKEWFCSEVRCTFEDSGDSSSLVVERVVRKEVVGK  928

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            GW + +R+E +++GKEIE KLL ++V+DAV+ L
Sbjct  929  GWIDNMRVELDNLGKEIEDKLLADLVEDAVIDL  961



>ref|XP_006443684.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
 ref|XP_006480168.1| PREDICTED: uncharacterized protein LOC102618918 [Citrus sinensis]
 gb|ESR56924.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
Length=991

 Score =   201 bits (512),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 149/220 (68%), Gaps = 12/220 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGLD  VQSD  
Sbjct  770  SIARTLSWDDSCAETV-SPYPLKS-SSVSSGAEEEQDWLLLVQTLIQSAGLDGRVQSDIF  827

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI------  408
             +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL++I      
Sbjct  828  FTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAALVEITGYGSE  886

Query  407  -DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-LTERMV  234
             D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D N+ + ER+V
Sbjct  887  SDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDSNSPVVERVV  946

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            R E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L
Sbjct  947  RNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDL  986



>ref|XP_010091854.1| hypothetical protein L484_015923 [Morus notabilis]
 gb|EXB46062.1| hypothetical protein L484_015923 [Morus notabilis]
Length=981

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 161/225 (72%), Gaps = 12/225 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS-  573
            S+ARTLSWDDSCV+ AT   SL P       EE+ER+WL F+QTLLS AG + E + DS 
Sbjct  759  SIARTLSWDDSCVEMATPC-SLKPSSVPTVAEEDERDWLAFVQTLLSAAGFNGETRCDSC  817

Query  572  --LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI---  408
              + SRW SP++PLDP LRDKY N+++KE + E++RRQ RSTRKLVFDCVNA+L+DI   
Sbjct  818  ELVFSRWPSPEAPLDPSLRDKYANIDDKEPLLESRRRQLRSTRKLVFDCVNASLVDISGY  877

Query  407  --DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERM  237
              D   +TI   GAH+++ +G + +  DRVWGR++EWF     CL +DG D N+L  +RM
Sbjct  878  GSDRSLRTIC-GGAHDSLMEGDTPLLVDRVWGRMQEWFSGEVRCLWEDGGDANSLVVDRM  936

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
             R+E VG GW E +R+E +++G E+EGKLLEE+V++AVV L + +
Sbjct  937  GRKEVVGGGWTELMRIEIDNLGNELEGKLLEELVEEAVVDLTERI  981



>ref|XP_010684824.1| PREDICTED: uncharacterized protein LOC104899346 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=981

 Score =   197 bits (501),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 8/206 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDS  573
            GS+ARTLSW++S  +TAT+ Y+LN P       E+E E+++ +Q+LL+MAGL DE Q  S
Sbjct  762  GSIARTLSWEESFAETATN-YALNSPFVSPGAGEDEVEYVYLVQSLLTMAGLSDEGQVGS  820

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
              +RWHS +SPLDPLLRDKYI+L  KE +HEAKRRQ RS+RKLVFDCVNAAL+DI     
Sbjct  821  NLARWHSTESPLDPLLRDKYIDLTAKEPLHEAKRRQLRSSRKLVFDCVNAALVDITGFGT  880

Query  392  TIA-----FSGAHNT-IPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
            T +     + G  N  +  G  +  AD+V   +KE  P      S DG D+++L ER+VR
Sbjct  881  TTSRWGGPYVGLSNGYLESGPGMGLADKVLAWMKELMPGEVKYYSIDGGDNHSLVERLVR  940

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGK  153
            +E +GKGW E +RL+ +++GKEIEGK
Sbjct  941  KEVIGKGWCEQIRLQVDNLGKEIEGK  966



>ref|XP_010684822.1| PREDICTED: uncharacterized protein LOC104899346 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=993

 Score =   197 bits (501),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 8/206 (4%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDS  573
            GS+ARTLSW++S  +TAT+ Y+LN P       E+E E+++ +Q+LL+MAGL DE Q  S
Sbjct  774  GSIARTLSWEESFAETATN-YALNSPFVSPGAGEDEVEYVYLVQSLLTMAGLSDEGQVGS  832

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
              +RWHS +SPLDPLLRDKYI+L  KE +HEAKRRQ RS+RKLVFDCVNAAL+DI     
Sbjct  833  NLARWHSTESPLDPLLRDKYIDLTAKEPLHEAKRRQLRSSRKLVFDCVNAALVDITGFGT  892

Query  392  TIA-----FSGAHNT-IPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
            T +     + G  N  +  G  +  AD+V   +KE  P      S DG D+++L ER+VR
Sbjct  893  TTSRWGGPYVGLSNGYLESGPGMGLADKVLAWMKELMPGEVKYYSIDGGDNHSLVERLVR  952

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGK  153
            +E +GKGW E +RL+ +++GKEIEGK
Sbjct  953  KEVIGKGWCEQIRLQVDNLGKEIEGK  978



>emb|CBI37234.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 127/194 (65%), Gaps = 41/194 (21%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDSL  570
            S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WLFF+QTLLS AG D+ VQ+D+ 
Sbjct  634  SIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWLFFVQTLLSAAGFDDNVQTDTF  692

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS RKLV+DCVNAAL+DI      
Sbjct  693  FSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSNRKLVYDCVNAALVDIT-----  747

Query  389  IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKG  210
                   +  PD       +RVWGR+KEWF                       +E VGKG
Sbjct  748  -------DYGPD------LERVWGRMKEWFSG---------------------EEVVGKG  773

Query  209  WHEYLRLEAESIGK  168
            W E++RL+ ++IGK
Sbjct  774  WVEHMRLQVDNIGK  787



>ref|XP_004493852.1| PREDICTED: uro-adherence factor A-like isoform X1 [Cicer arietinum]
 ref|XP_004493853.1| PREDICTED: uro-adherence factor A-like isoform X2 [Cicer arietinum]
Length=984

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 147/223 (66%), Gaps = 12/223 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDSL  570
            S+ARTLSWDDSC + A S+  L P +    T+ E ++ L F+Q LLS AGL D+VQSDS 
Sbjct  760  SIARTLSWDDSCAELANSN-PLKPSLVSLDTKLENQDMLVFVQKLLSAAGLDDQVQSDSF  818

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             SRWHS +SPLDPLLRDKYINLN+KE   +HEAKRRQRRS +KLVFDCVN ALI+I    
Sbjct  819  YSRWHSLESPLDPLLRDKYINLNDKEPQPLHEAKRRQRRSIQKLVFDCVNVALIEITGYR  878

Query  395  KTIAF-----SGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TER  240
               +      SG H    +  G+  +  D +  ++KE   S    +  D VD N+L  E 
Sbjct  879  SENSLMGRLWSGGHRRLQVSKGAPPLLVDLIVAQMKELTSSGMRSVWGDCVDSNSLVVET  938

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +VR+E VGKGW E + L+ + + KE+EGKLLEE+V+DAVV L 
Sbjct  939  VVRKEVVGKGWVELMGLDIDILVKEVEGKLLEELVEDAVVDLT  981



>ref|XP_007162644.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
 gb|ESW34638.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
Length=971

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 152/223 (68%), Gaps = 14/223 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC + A + Y L P +    T+ E+++WL F++ LLS AG+D +VQSDS 
Sbjct  749  SIARTLSWDDSCAEVA-NPYQLKPSLGSLDTKVEDQDWLVFVEKLLSAAGIDDQVQSDSF  807

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKET--VHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             SRWHS +SPLDP LRD Y NLN+KE   +HEAKRRQRRS +KLVF+CVN +LI+I T +
Sbjct  808  YSRWHSLESPLDPSLRDNYANLNDKEPQQLHEAKRRQRRSNQKLVFECVNLSLIEI-TGY  866

Query  395  KTIAF------SGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TE  243
             + ++      SG+H+   +P+G+     D V  ++KE    A   +  D  D N+L  E
Sbjct  867  GSQSYLMGRLWSGSHSRFQVPEGAPPPLVDLVVAQMKELISGAVRSVWGDCGDSNSLGVE  926

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             +VR+E VGKGW E + LE + + KE+EGKLLEE+V+DAVV L
Sbjct  927  SVVRKEVVGKGWVELMALEMDILVKEVEGKLLEELVEDAVVDL  969



>ref|XP_010243641.1| PREDICTED: uncharacterized protein LOC104587645 isoform X1 [Nelumbo 
nucifera]
Length=997

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 155/222 (70%), Gaps = 12/222 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-EEEREWLFFIQTLLSMAGLD-EVQSD  576
            GS+ARTLSWDD C+  A    SL+  +S   TE EEE+E   F+Q LLS AGLD E QSD
Sbjct  775  GSIARTLSWDDPCL-IAARPNSLH--LSRFATEAEEEQERFLFVQVLLSTAGLDYEEQSD  831

Query  575  SLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDID-T  402
             + SRWHS +SPLDP L +KY++L ++KE +HEAKRRQ RS R+L+FDCVNAAL+DI   
Sbjct  832  VIFSRWHSEESPLDPSLIEKYLSLKDDKEQLHEAKRRQWRSNRRLLFDCVNAALMDITGY  891

Query  401  CHKTIAFSGAHNTIPDG---SSIISADRVWGRIKEWFPSAAG-CLSDDGVDDNNLT-ERM  237
              K   +    +T+       S+++ D+VW  +KEW+ ++ G C SD+  D N+L  ERM
Sbjct  892  SSKANPWVKVSSTVQSKILVDSVVTLDKVWSCVKEWYSNSEGRCYSDESGDRNSLVVERM  951

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            VR+E  GKGW + +RLE +++GK+IEG++L+++V+DA+V L 
Sbjct  952  VRKEVAGKGWEDLMRLEIDTLGKQIEGEILQQLVEDAIVELT  993



>ref|XP_010243643.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010243644.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
Length=992

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 155/222 (70%), Gaps = 12/222 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-EEEREWLFFIQTLLSMAGLD-EVQSD  576
            GS+ARTLSWDD C+  A    SL+  +S   TE EEE+E   F+Q LLS AGLD E QSD
Sbjct  770  GSIARTLSWDDPCL-IAARPNSLH--LSRFATEAEEEQERFLFVQVLLSTAGLDYEEQSD  826

Query  575  SLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-DT  402
             + SRWHS +SPLDP L +KY++L ++KE +HEAKRRQ RS R+L+FDCVNAAL+DI   
Sbjct  827  VIFSRWHSEESPLDPSLIEKYLSLKDDKEQLHEAKRRQWRSNRRLLFDCVNAALMDITGY  886

Query  401  CHKTIAFSGAHNTIPDG---SSIISADRVWGRIKEWFPSAAG-CLSDDGVDDNNLT-ERM  237
              K   +    +T+       S+++ D+VW  +KEW+ ++ G C SD+  D N+L  ERM
Sbjct  887  SSKANPWVKVSSTVQSKILVDSVVTLDKVWSCVKEWYSNSEGRCYSDESGDRNSLVVERM  946

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            VR+E  GKGW + +RLE +++GK+IEG++L+++V+DA+V L 
Sbjct  947  VRKEVAGKGWEDLMRLEIDTLGKQIEGEILQQLVEDAIVELT  988



>ref|XP_010243642.1| PREDICTED: uncharacterized protein LOC104587645 isoform X2 [Nelumbo 
nucifera]
Length=996

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 155/222 (70%), Gaps = 12/222 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-EEEREWLFFIQTLLSMAGLD-EVQSD  576
            GS+ARTLSWDD C+  A    SL+  +S   TE EEE+E   F+Q LLS AGLD E QSD
Sbjct  774  GSIARTLSWDDPCL-IAARPNSLH--LSRFATEAEEEQERFLFVQVLLSTAGLDYEEQSD  830

Query  575  SLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDID-T  402
             + SRWHS +SPLDP L +KY++L ++KE +HEAKRRQ RS R+L+FDCVNAAL+DI   
Sbjct  831  VIFSRWHSEESPLDPSLIEKYLSLKDDKEQLHEAKRRQWRSNRRLLFDCVNAALMDITGY  890

Query  401  CHKTIAFSGAHNTIPDG---SSIISADRVWGRIKEWFPSAAG-CLSDDGVDDNNLT-ERM  237
              K   +    +T+       S+++ D+VW  +KEW+ ++ G C SD+  D N+L  ERM
Sbjct  891  SSKANPWVKVSSTVQSKILVDSVVTLDKVWSCVKEWYSNSEGRCYSDESGDRNSLVVERM  950

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            VR+E  GKGW + +RLE +++GK+IEG++L+++V+DA+V L 
Sbjct  951  VRKEVAGKGWEDLMRLEIDTLGKQIEGEILQQLVEDAIVELT  992



>gb|KEH23986.1| DUF3741 family protein [Medicago truncatula]
Length=901

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 145/223 (65%), Gaps = 11/223 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC + A S Y L P ++   T+ E+++ L F+  LLS AGLD+ +SD  
Sbjct  677  GSIARTLSWDDSCAEVA-SPYQLKPSLASLDTKVEDQDLLVFVHKLLSAAGLDDQESDLF  735

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNAALIDI----  408
             SRWHS +SPLDP LRDKY NLN+KE   +HEAKRRQRRS +KL+FDCVN AL++I    
Sbjct  736  YSRWHSLESPLDPTLRDKYANLNDKEPQPLHEAKRRQRRSNQKLIFDCVNVALMEITGYG  795

Query  407  -DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TER  240
             ++      +SG H    + +G+  +  D +   +KE   S    +  D  D N+L  E 
Sbjct  796  LESSLMGRLWSGGHRRLQVSEGAPSLLVDLIVSHMKELTSSGMRSVWGDCGDSNSLVVET  855

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +VR+E VGKGW E + LE +   KE+EGKLLEE+V+DAVV L 
Sbjct  856  VVRKEVVGKGWVELMGLEVDIWVKEVEGKLLEELVEDAVVDLT  898



>ref|XP_003625464.1| hypothetical protein MTR_7g099410 [Medicago truncatula]
 gb|AES81682.1| DUF3741 family protein [Medicago truncatula]
Length=982

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 145/223 (65%), Gaps = 11/223 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDSC + A S Y L P ++   T+ E+++ L F+  LLS AGLD+ +SD  
Sbjct  758  GSIARTLSWDDSCAEVA-SPYQLKPSLASLDTKVEDQDLLVFVHKLLSAAGLDDQESDLF  816

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNAALIDI----  408
             SRWHS +SPLDP LRDKY NLN+KE   +HEAKRRQRRS +KL+FDCVN AL++I    
Sbjct  817  YSRWHSLESPLDPTLRDKYANLNDKEPQPLHEAKRRQRRSNQKLIFDCVNVALMEITGYG  876

Query  407  -DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TER  240
             ++      +SG H    + +G+  +  D +   +KE   S    +  D  D N+L  E 
Sbjct  877  LESSLMGRLWSGGHRRLQVSEGAPSLLVDLIVSHMKELTSSGMRSVWGDCGDSNSLVVET  936

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +VR+E VGKGW E + LE +   KE+EGKLLEE+V+DAVV L 
Sbjct  937  VVRKEVVGKGWVELMGLEVDIWVKEVEGKLLEELVEDAVVDLT  979



>ref|XP_006576977.1| PREDICTED: uncharacterized protein LOC100793360 [Glycine max]
Length=979

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 147/226 (65%), Gaps = 19/226 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC + A S Y L P  +   T+++   WL F++ LLS AG+D +VQ  S 
Sbjct  754  SIARTLSWDDSCAEVA-SPYPLRPSSASLDTKQD---WLVFVKKLLSAAGIDDQVQPGSF  809

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKET---VHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
             SRWHS +SPLDP LRDKY NLN+KE    +HEAKRRQRRS +KLVFDCVN +LI+I   
Sbjct  810  YSRWHSLESPLDPSLRDKYANLNDKEPQQQLHEAKRRQRRSNQKLVFDCVNVSLIEITGY  869

Query  398  HKTIAF-------SGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCL--SDDGVDDNN  252
                 +       SG+H+   +P+ +S    D +  ++KE   SA   +   D G  ++ 
Sbjct  870  GSEKNYLMGSRLCSGSHSRVQVPEAASPPLVDLIVAQMKELISSAMSSVWVVDCGDSNSL  929

Query  251  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            + E +VR+E VGKGW E +RLE + + KE+EGKLLEE+V+DAVV L
Sbjct  930  VVESVVRKEVVGKGWVELMRLEMDILVKEVEGKLLEELVEDAVVDL  975



>gb|KHN09408.1| hypothetical protein glysoja_016507 [Glycine soja]
Length=979

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 148/226 (65%), Gaps = 19/226 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC + A S Y L P  +   T+++   WL F++ LLS AG+D +VQ  S 
Sbjct  754  SIARTLSWDDSCAEVA-SPYPLRPSSASLDTKQD---WLVFVKKLLSAAGIDDQVQPGSF  809

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKET---VHEAKRRQRRSTRKLVFDCVNAALIDI---  408
             SRWHS +SPLDP LRDKY NLN+KE    +HEAKRRQRRS +KLVFDCVN +LI+I   
Sbjct  810  YSRWHSLESPLDPSLRDKYANLNDKEPQQQLHEAKRRQRRSNQKLVFDCVNVSLIEITGY  869

Query  407  ----DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCL--SDDGVDDNN  252
                +    ++  SG+H+   +P+ +S    D +  ++KE   SA   +   D G  ++ 
Sbjct  870  GSEKNYLMGSMLCSGSHSRVQVPEAASPPLVDLIVAQMKELISSAMSSVWVVDCGDSNSL  929

Query  251  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            + E +VR+E VGKGW E + LE + + KE+EGKLLEE+V+DAVV L
Sbjct  930  VVESVVRKEVVGKGWVELMGLEMDILVKEVEGKLLEELVEDAVVDL  975



>ref|XP_006604525.1| PREDICTED: uncharacterized protein LOC100816611 isoform X1 [Glycine 
max]
 ref|XP_006604526.1| PREDICTED: uncharacterized protein LOC100816611 isoform X2 [Glycine 
max]
 gb|KHN02438.1| hypothetical protein glysoja_002462 [Glycine soja]
Length=982

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 146/224 (65%), Gaps = 14/224 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC + A S Y L P ++   T+ E+++W  F++ LLS AG+D +VQ DS 
Sbjct  756  SIARTLSWDDSCAEVA-SPYPLKPSLASLDTKVEDQDWFVFVEKLLSAAGIDDQVQPDSF  814

Query  569  SSRWHSPDSPLDPLLRDKYINLN--EKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             +RWHS +SPLDP LRDKY NL+  E + +HEAKRRQRRS +KLVFDCVN ALI+I    
Sbjct  815  YARWHSLESPLDPSLRDKYANLDDTEPQQLHEAKRRQRRSNQKLVFDCVNIALIEITGYG  874

Query  395  KTIAF------SGAHN--TIPDGSSIIS-ADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-  246
                +      SG+H+   +P+ +      D +  ++KE   SA   +  D  D N+L  
Sbjct  875  SEKNYLMGRLCSGSHSRVQVPEAAPPPPLVDLIVAQMKELISSAMRSVWVDCGDSNSLVV  934

Query  245  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            E +VR+E VGKGW E + LE + + KE EGKLLEE+V+DAVV L
Sbjct  935  ESVVRKEIVGKGWVELMGLEMDFLVKEFEGKLLEELVEDAVVDL  978



>gb|EYU17962.1| hypothetical protein MIMGU_mgv1a0013541mg, partial [Erythranthe 
guttata]
Length=276

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 129/201 (64%), Gaps = 17/201 (8%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPP--VSMQRTEEEEREWLFFIQTLLSMAGL-DEVQS  579
            GS+ARTLSW+DSCVDTA+S    N    ++ + T+EEEREW FF++TLLS AGL  E+QS
Sbjct  68   GSIARTLSWEDSCVDTASSYAVANESSLINARGTDEEEREWFFFVKTLLSAAGLHGELQS  127

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKET--VHEAKRRQRRSTRKLVFDCVNAALIDID  405
             S ++RWHSP  PLDP LRDKYI+LN+K T   HEAKRRQ+RS +KLVFDCVNA L++I 
Sbjct  128  SSFTARWHSPGIPLDPSLRDKYIDLNDKATNYTHEAKRRQKRSLQKLVFDCVNAVLVEIG  187

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQE  225
              +  I  +  +N +         D VWGR+  W      C + D  D   +   + ++ 
Sbjct  188  GENGLIKSNSNNNIV---------DEVWGRMNAWMNE---CGARDSNDSLAVERVVRKEV  235

Query  224  AVGKGWHEYLRLEAESIGKEI  162
              GK W E LR+E + +GKEI
Sbjct  236  VGGKWWVENLRMEVDYLGKEI  256



>gb|KJB26069.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=898

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 146/225 (65%), Gaps = 11/225 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS-DS  573
            GS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLLS AGL++ +  +S
Sbjct  675  GSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLLSSAGLNDKEYFES  733

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
                WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDCVNAA+++I     
Sbjct  734  FIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDCVNAAIVEITGYGS  793

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN---LTERM  237
            +     ++   +H    + +S    D V  +IKEW    +  + D+  D +    + E+ 
Sbjct  794  NNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDNDDDWDTDSLVVEKA  853

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  854  VRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  897



>gb|KJB10996.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=962

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL+ EVQ DS 
Sbjct  766  SIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGLNGEVQLDSF  825

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----D  405
             +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL++I     D
Sbjct  826  FARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAALLEISGYGSD  885

Query  404  TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDNNLTERM  237
             C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+ + ER+
Sbjct  886  RCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDSLVVERV  942



>gb|KJB26068.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=998

 Score =   178 bits (451),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 146/225 (65%), Gaps = 11/225 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS-DS  573
            GS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLLS AGL++ +  +S
Sbjct  775  GSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLLSSAGLNDKEYFES  833

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
                WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDCVNAA+++I     
Sbjct  834  FIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDCVNAAIVEITGYGS  893

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN---LTERM  237
            +     ++   +H    + +S    D V  +IKEW    +  + D+  D +    + E+ 
Sbjct  894  NNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDNDDDWDTDSLVVEKA  953

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  954  VRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  997



>gb|KJB26065.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=1002

 Score =   177 bits (450),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 146/225 (65%), Gaps = 11/225 (5%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS-DS  573
             GS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLLS AGL++ +  +S
Sbjct  779   GSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLLSSAGLNDKEYFES  837

Query  572   LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
                 WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDCVNAA+++I     
Sbjct  838   FIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDCVNAAIVEITGYGS  897

Query  407   DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN---LTERM  237
             +     ++   +H    + +S    D V  +IKEW    +  + D+  D +    + E+ 
Sbjct  898   NNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDNDDDWDTDSLVVEKA  957

Query  236   VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
             VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  958   VRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  1001



>gb|KJB26067.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=992

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 146/225 (65%), Gaps = 11/225 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS-DS  573
            GS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLLS AGL++ +  +S
Sbjct  769  GSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLLSSAGLNDKEYFES  827

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
                WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDCVNAA+++I     
Sbjct  828  FIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDCVNAAIVEITGYGS  887

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN---LTERM  237
            +     ++   +H    + +S    D V  +IKEW    +  + D+  D +    + E+ 
Sbjct  888  NNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDNDDDWDTDSLVVEKA  947

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
            VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  948  VRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  991



>gb|KHG04276.1| Methyl-coenzyme M reductase II subunit gamma [Gossypium arboreum]
Length=1005

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 145/225 (64%), Gaps = 11/225 (5%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS-DS  573
             GS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLLS AGL++ +  +S
Sbjct  782   GSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLLSSAGLNDKEYFES  840

Query  572   LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
                 WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS + LVFDCVNAA+++I     
Sbjct  841   FIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKTLVFDCVNAAIVEITGYGS  900

Query  407   DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN---LTERM  237
             +     ++   +H    + +S    D V  +IKEW       + D+  D ++   + E+ 
Sbjct  901   NNRMNEMSLRRSHMRDMESASPTLVDHVCAQIKEWVSGDGNHVVDNDDDWDSDSLVVEKA  960

Query  236   VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  102
             VR+E VGKGW +  + E E++G EIEGKLL+E+V++AVV L  TM
Sbjct  961   VRKE-VGKGWVDQTKTETENLGNEIEGKLLQELVEEAVVDLTGTM  1004



>gb|EYU46370.1| hypothetical protein MIMGU_mgv1a000965mg [Erythranthe guttata]
Length=929

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 140/211 (66%), Gaps = 16/211 (8%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GS+ARTLSWDDSC++TATS  +     +      E +EW FF +TLLS++GL+ E+QS S
Sbjct  731  GSIARTLSWDDSCINTATSHPTEESLTTTHDETNENQEWSFFFKTLLSVSGLECEMQSTS  790

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
              ++WHS +SPLDP LRDKY++L  +  +HEAK+RQ RS ++LVFDCVN+ALI+I     
Sbjct  791  FLAKWHSLESPLDPSLRDKYVDLQNENKLHEAKQRQGRSIQRLVFDCVNSALIEI-----  845

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
               +       P G      D VW  +  WF   +  + D G D   + ER+VR+E VGK
Sbjct  846  -TGYGSDSGQKPIG------DEVWALMNAWF---SEDVDDCGDDTCLMVERVVRKEVVGK  895

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            GW+ + RLE +++GKEIEGKLLEE+VQ+A+V
Sbjct  896  GWNRHFRLEIDNLGKEIEGKLLEELVQEALV  926



>ref|XP_010263991.1| PREDICTED: uncharacterized protein LOC104602116 isoform X3 [Nelumbo 
nucifera]
Length=993

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 146/220 (66%), Gaps = 10/220 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GSVARTLSWDDSC+  A+   SLN    +   EEE+ ++LFF Q LLS AGLD E Q+D 
Sbjct  772  GSVARTLSWDDSCL-IASRPNSLNFSRFLSEAEEEQDQFLFF-QALLSTAGLDHEEQADM  829

Query  572  LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
            + SRWHSP+SPLDP L +K I+L N+KE +HEAK RQRRS ++L+FDCVNAAL+D+    
Sbjct  830  IISRWHSPESPLDPSLIEKCISLHNDKEILHEAKHRQRRSNKRLLFDCVNAALVDMMGYS  889

Query  395  KTIA----FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG-CLSDDGVDDNNLTERMVR  231
              ++          +     + ++ D+VW  +K+ + S+ G C S +  D  +L    V 
Sbjct  890  SEVSPWVRMCSTFQSRASVDAPVTVDKVWSCVKKLYNSSEGRCYSAETGDSTSLVVEKVV  949

Query  230  QEA-VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            ++   G+GW + +RLE ++IGK+IEG++LE++VQ+A+V L
Sbjct  950  RKEVAGRGWEDVMRLEVDTIGKQIEGEMLEQLVQEALVEL  989



>ref|XP_010263990.1| PREDICTED: uncharacterized protein LOC104602116 isoform X2 [Nelumbo 
nucifera]
Length=1013

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 146/220 (66%), Gaps = 10/220 (5%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
             GSVARTLSWDDSC+  A+   SLN    +   EEE+ ++LFF Q LLS AGLD E Q+D 
Sbjct  792   GSVARTLSWDDSCL-IASRPNSLNFSRFLSEAEEEQDQFLFF-QALLSTAGLDHEEQADM  849

Query  572   LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             + SRWHSP+SPLDP L +K I+L N+KE +HEAK RQRRS ++L+FDCVNAAL+D+    
Sbjct  850   IISRWHSPESPLDPSLIEKCISLHNDKEILHEAKHRQRRSNKRLLFDCVNAALVDMMGYS  909

Query  395   KTIA----FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG-CLSDDGVDDNNLTERMVR  231
               ++          +     + ++ D+VW  +K+ + S+ G C S +  D  +L    V 
Sbjct  910   SEVSPWVRMCSTFQSRASVDAPVTVDKVWSCVKKLYNSSEGRCYSAETGDSTSLVVEKVV  969

Query  230   QEA-VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             ++   G+GW + +RLE ++IGK+IEG++LE++VQ+A+V L
Sbjct  970   RKEVAGRGWEDVMRLEVDTIGKQIEGEMLEQLVQEALVEL  1009



>ref|XP_010263989.1| PREDICTED: uncharacterized protein LOC104602116 isoform X1 [Nelumbo 
nucifera]
Length=1017

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 146/220 (66%), Gaps = 10/220 (5%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
             GSVARTLSWDDSC+  A+   SLN    +   EEE+ ++LFF Q LLS AGLD E Q+D 
Sbjct  796   GSVARTLSWDDSCL-IASRPNSLNFSRFLSEAEEEQDQFLFF-QALLSTAGLDHEEQADM  853

Query  572   LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             + SRWHSP+SPLDP L +K I+L N+KE +HEAK RQRRS ++L+FDCVNAAL+D+    
Sbjct  854   IISRWHSPESPLDPSLIEKCISLHNDKEILHEAKHRQRRSNKRLLFDCVNAALVDMMGYS  913

Query  395   KTIA----FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG-CLSDDGVDDNNLTERMVR  231
               ++          +     + ++ D+VW  +K+ + S+ G C S +  D  +L    V 
Sbjct  914   SEVSPWVRMCSTFQSRASVDAPVTVDKVWSCVKKLYNSSEGRCYSAETGDSTSLVVEKVV  973

Query  230   QEA-VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             ++   G+GW + +RLE ++IGK+IEG++LE++VQ+A+V L
Sbjct  974   RKEVAGRGWEDVMRLEVDTIGKQIEGEMLEQLVQEALVEL  1013



>ref|XP_011011589.1| PREDICTED: uncharacterized protein LOC105116094, partial [Populus 
euphratica]
Length=271

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 134/217 (62%), Gaps = 18/217 (8%)
 Frame = -1

Query  731  LSWDDSCVDTATSSYSL--NPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSLSSR  561
            LS DDS  +TA S Y L  +P       EE+E++W F +QTLL+ AGLD ++Q DS  + 
Sbjct  1    LSQDDSRAETA-SPYPLKSSPSPVPSGAEEDEKDWFFLVQTLLTTAGLDSDLQLDSFFAG  59

Query  560  WHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH-----  396
             HSP SPLD  LRDKY NLN+KE + EAK R   S  KLVFD VNAAL++I T H     
Sbjct  60   GHSPGSPLDSSLRDKYANLNDKELLLEAKPR---SNGKLVFDSVNAALVEI-TGHGSGRS  115

Query  395  -KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAV  219
             K +  SG  N + +G+     D VW ++K WF S       DG D N+L   MV    V
Sbjct  116  TKAVTCSGVQNWLVEGAQPRIIDYVWAQLKSWFCSDMRRTFGDGGDSNSLVVEMV----V  171

Query  218  GKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
            GKGW + +R+E +S+G EIEGKLL+E+V++AV+ L D
Sbjct  172  GKGWVDKMRVELDSLGNEIEGKLLDELVEEAVLDLTD  208



>ref|XP_010038329.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038330.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038331.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038332.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038333.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038334.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 gb|KCW50152.1| hypothetical protein EUGRSUZ_K03587 [Eucalyptus grandis]
Length=974

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 147/220 (67%), Gaps = 10/220 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSL  570
            S+ARTLSWDDSC +  ++SYS+  P+     EEE  +WL F++T+LS AG D EVQ ++ 
Sbjct  753  SIARTLSWDDSCFER-SASYSIRSPMVCSNVEEE-LDWLVFVRTVLSAAGFDSEVQPETF  810

Query  569  SSRWHSPDSPLDPLLRDKYINLNE-KETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
             SRWH+P+SPLDP LR+K+ N  + KE + EA+RRQRRS RKLVFDCVN ALID      
Sbjct  811  FSRWHTPESPLDPSLREKFANTKDVKEPMPEARRRQRRSERKLVFDCVNEALIDSTGYGP  870

Query  392  T---IAFSG--AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDNNLTERMVR  231
            +   I++ G  A +  P+ +  IS DRVW R+ EWFP    C+S  DG   + + ER+VR
Sbjct  871  SLGPISWPGCKAPDGTPEQTLSISVDRVWARMTEWFPDEVRCVSRGDGGSSSLVVERVVR  930

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             E VGKGW E L LE  S+ K+IE  LL+E+V +AVV L 
Sbjct  931  NEVVGKGWIEQLSLEMHSLRKDIEWTLLDELVDEAVVELT  970



>ref|XP_003541385.2| PREDICTED: uncharacterized protein LOC100787955 [Glycine max]
Length=900

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 141/226 (62%), Gaps = 16/226 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            S+ARTLSWD S  + A SSY+L P  VS   ++ E++EWL  +  LLS AGLD + Q DS
Sbjct  667  SIARTLSWDGSSAEVA-SSYALKPLMVSSLDSKVEDQEWLLLVHKLLSAAGLDDQHQHDS  725

Query  572  LSSRWHSPDSPLDPLLRDK-YINLNEKET---VHEAKRRQRRSTRKLVFDCVNAALIDI-  408
              +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  KLVFD VNAAL+++ 
Sbjct  726  SYTRWHSLESPLDPSLRDALYANLNEKEPQPIMHERRRRKMRSNHKLVFDYVNAALLELV  785

Query  407  -DTCHKTIAFSGAHN--TIPDGSSIISA----DRVWGRIKEWFPSAAGCLSDDGVDDNNL  249
                 K +  S +H    + +G+S  ++    D +  ++KE   S   C  ++G    +L
Sbjct  786  GYGSEKCLKRSKSHYRVQVQEGASAAASPLLVDHIVAQMKELIASGVRCEWENGGASTSL  845

Query  248  T-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
              E +VR+E V  GW E + LE + +GKEIEG L++E+V++AVV L
Sbjct  846  VVENVVRKEVVQIGWVELMELEIDILGKEIEGDLIQELVENAVVDL  891



>gb|KHN48970.1| hypothetical protein glysoja_025347 [Glycine soja]
Length=900

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 141/226 (62%), Gaps = 16/226 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            S+ARTLSWD S  + A SSY+L P  VS   ++ E++EWL  +  LLS AGLD + Q DS
Sbjct  667  SIARTLSWDGSSAEVA-SSYALKPLMVSSLDSKVEDQEWLLLVHKLLSAAGLDDQHQHDS  725

Query  572  LSSRWHSPDSPLDPLLRDK-YINLNEKET---VHEAKRRQRRSTRKLVFDCVNAALIDI-  408
              +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  KLVFD VNAAL+++ 
Sbjct  726  SYTRWHSLESPLDPSLRDALYANLNEKEPQPIMHERRRRKMRSNHKLVFDYVNAALLELV  785

Query  407  -DTCHKTIAFSGAHN--TIPDGSSIISA----DRVWGRIKEWFPSAAGCLSDDGVDDNNL  249
                 K +  S +H    + +G+S  ++    D +  ++KE   S   C  ++G    +L
Sbjct  786  GYGSEKCLKRSKSHCRVQVQEGASAAASPLLVDHIVAQMKELIASGVRCEWENGGASTSL  845

Query  248  T-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
              E +VR+E V  GW E + LE + +GKEIEG L++E+V++AVV L
Sbjct  846  VVENVVRKEVVQIGWVELMELEIDILGKEIEGDLIQELVENAVVDL  891



>ref|XP_010436357.1| PREDICTED: uncharacterized protein LOC104720083 [Camelina sativa]
Length=221

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 131/223 (59%), Gaps = 30/223 (13%)
 Frame = -1

Query  746  SVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQS  579
            S+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V  
Sbjct  17   SIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAGFSRGCTVSH  68

Query  578  DSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
            D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + +
Sbjct  69   DPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIISE  128

Query  410  IDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWFPSAAGCL-SDDGVDDNNL-TER  240
              T            ++ +GS      + VW ++K+W         S + +D N+L +E 
Sbjct  129  TTT-----------TSMGNGSPCFDLMEHVWAQLKDWVLDEPSKFDSGEDMDANSLASES  177

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  178  LVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  220



>ref|XP_008461986.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
 ref|XP_008461987.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
Length=970

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 121/199 (61%), Gaps = 5/199 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDSL  570
            S++RTL+WDD+ +D  T  Y   P ++ +  EEEE++WL  +Q+L S AGLD+ V  +S 
Sbjct  752  SISRTLTWDDAYLDN-TEPYLFKPTLACEDREEEEQKWLSLVQSLFSAAGLDDSVHHNSF  810

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             SRWHS   PLDP LR+ + NL++KE   EAKRRQ RS  KL+FD VNA L+DI      
Sbjct  811  FSRWHSLKFPLDPSLRNNFANLSDKEPEQEAKRRQSRSNWKLIFDSVNAVLVDITGFRSE  870

Query  389  I-AFSGAHNTI-PDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQEAV  219
            + A S + N +  D  S    D VW R+K+W      C   +  D N+L  ER V +E V
Sbjct  871  MSAISISSNWVHADAPSQPLVDIVWDRLKDWLSGKTQCGGCEIGDSNSLVVERAVGKEVV  930

Query  218  GKGWHEYLRLEAESIGKEI  162
            GKGW + L+ E E +GKEI
Sbjct  931  GKGWIQKLQEELEDLGKEI  949



>ref|XP_008809665.1| PREDICTED: uncharacterized protein LOC103721293 isoform X5 [Phoenix 
dactylifera]
Length=915

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 138/222 (62%), Gaps = 17/222 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL+  +SD +
Sbjct  701  SVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGLNSEKSDMV  758

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--TCH  396
             + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL++I   T  
Sbjct  759  FASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALLEIGRTTLL  814

Query  395  KTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                + GA+     NT P G+    A  VWG ++ WF      ++ +  + N L +R++R
Sbjct  815  SAYPWKGAYHHAQKNTSP-GTPF--AVEVWGLLRNWFSGEGKHVTCEADNSNLLMDRVLR  871

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            +E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  872  REVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  913



>gb|KEH42420.1| DUF3741 family protein [Medicago truncatula]
Length=841

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 140/224 (63%), Gaps = 20/224 (9%)
 Frame = -1

Query  746  SVARTLSWD-DSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD--EVQSD  576
            SVARTLSWD DSC + A+  Y L    S+  T+ E+ EWL  +Q LLS +GLD  + Q D
Sbjct  618  SVARTLSWDEDSCGELASPYYPLKRACSLD-TKLEDHEWLILVQKLLSASGLDDDQQQYD  676

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEK----ETVHEAKRRQRRSTRKLVFDCVNAALIDI  408
            S  +RW+S +SPLDP LRD Y+N+NE     + ++EAKRR+ RS +KLVFDCVNAAL+++
Sbjct  677  SFHTRWYSLESPLDPSLRDTYVNINENKDSTQPLNEAKRRKMRSNQKLVFDCVNAALLEV  736

Query  407  ---DTCHKTIAF-SGAHNT---IPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  249
               D         SG H     + +GS ++  D +  ++ E    A G     G D ++L
Sbjct  737  VGYDGSENYFKMCSGTHRRPFFVQEGSCLM--DHIVAQMNELI--ANGMKFVWGGDSHSL  792

Query  248  -TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
              E +VR+E V  G  E +R+E +++G+EIEGK++EE+V++ V+
Sbjct  793  VVENVVRKEVVESGLVEVMRMEIDALGREIEGKIIEELVENLVL  836



>ref|XP_008809662.1| PREDICTED: uncharacterized protein LOC103721293 isoform X2 [Phoenix 
dactylifera]
Length=1003

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 138/222 (62%), Gaps = 17/222 (8%)
 Frame = -1

Query  746   SVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
             SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL+  +SD +
Sbjct  789   SVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGLNSEKSDMV  846

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--TCH  396
              + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL++I   T  
Sbjct  847   FASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALLEIGRTTLL  902

Query  395   KTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                 + GA+     NT P G+    A  VWG ++ WF      ++ +  + N L +R++R
Sbjct  903   SAYPWKGAYHHAQKNTSP-GTPF--AVEVWGLLRNWFSGEGKHVTCEADNSNLLMDRVLR  959

Query  230   QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
             +E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  960   REVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  1001



>ref|XP_008809661.1| PREDICTED: uncharacterized protein LOC103721293 isoform X1 [Phoenix 
dactylifera]
Length=1007

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 138/222 (62%), Gaps = 17/222 (8%)
 Frame = -1

Query  746   SVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
             SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL+  +SD +
Sbjct  793   SVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGLNSEKSDMV  850

Query  569   SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--TCH  396
              + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL++I   T  
Sbjct  851   FASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALLEIGRTTLL  906

Query  395   KTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                 + GA+     NT P G+    A  VWG ++ WF      ++ +  + N L +R++R
Sbjct  907   SAYPWKGAYHHAQKNTSP-GTPF--AVEVWGLLRNWFSGEGKHVTCEADNSNLLMDRVLR  963

Query  230   QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
             +E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  964   REVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  1005



>ref|XP_008809663.1| PREDICTED: uncharacterized protein LOC103721293 isoform X3 [Phoenix 
dactylifera]
Length=990

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 138/222 (62%), Gaps = 17/222 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL+  +SD +
Sbjct  776  SVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGLNSEKSDMV  833

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--TCH  396
             + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL++I   T  
Sbjct  834  FASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALLEIGRTTLL  889

Query  395  KTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                + GA+     NT P G+    A  VWG ++ WF      ++ +  + N L +R++R
Sbjct  890  SAYPWKGAYHHAQKNTSP-GTPF--AVEVWGLLRNWFSGEGKHVTCEADNSNLLMDRVLR  946

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            +E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  947  REVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  988



>ref|XP_008809664.1| PREDICTED: uncharacterized protein LOC103721293 isoform X4 [Phoenix 
dactylifera]
Length=986

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 138/222 (62%), Gaps = 17/222 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL+  +SD +
Sbjct  772  SVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGLNSEKSDMV  829

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--TCH  396
             + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL++I   T  
Sbjct  830  FASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALLEIGRTTLL  885

Query  395  KTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                + GA+     NT P G+    A  VWG ++ WF      ++ +  + N L +R++R
Sbjct  886  SAYPWKGAYHHAQKNTSP-GTPF--AVEVWGLLRNWFSGEGKHVTCEADNSNLLMDRVLR  942

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            +E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  943  REVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  984



>ref|XP_010438386.1| PREDICTED: uncharacterized protein LOC104721992 isoform X2 [Camelina 
sativa]
Length=857

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 133/226 (59%), Gaps = 34/226 (15%)
 Frame = -1

Query  749  GSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V 
Sbjct  652  GSIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAGFSRGCTVS  703

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALI  414
             D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + 
Sbjct  704  HDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIIS  763

Query  413  DIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-  249
            +  T            ++ +GS      + VW ++K+W    PS     S + +D N+L 
Sbjct  764  ETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFD--SGEDMDANSLA  810

Query  248  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  811  AESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  856



>ref|XP_010438384.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
 ref|XP_010438385.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
Length=916

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 133/226 (59%), Gaps = 34/226 (15%)
 Frame = -1

Query  749  GSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V 
Sbjct  711  GSIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAGFSRGCTVS  762

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALI  414
             D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + 
Sbjct  763  HDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIIS  822

Query  413  DIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-  249
            +  T            ++ +GS      + VW ++K+W    PS     S + +D N+L 
Sbjct  823  ETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFD--SGEDMDANSLA  869

Query  248  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  870  AESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  915



>gb|KHN05903.1| hypothetical protein glysoja_026491 [Glycine soja]
Length=565

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 140/234 (60%), Gaps = 24/234 (10%)
 Frame = -1

Query  746  SVARTLSWD-DSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSD  576
            S+ARTLSWD DS  + A S Y+L P  VS   ++ +++EWL  +  LLS AGLD + Q D
Sbjct  335  SIARTLSWDIDSSAEVA-SPYALKPLMVSSLDSKVDDQEWLLLVHKLLSAAGLDDQHQFD  393

Query  575  SLSSRWHSPDSPLDPLLRDK-YINLNEKE---TVHEAKRRQRRSTRKLVFDCVNAALIDI  408
            S  +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  KLVFD VN AL+++
Sbjct  394  SSYTRWHSLESPLDPSLRDTLYANLNEKEPQPNMHEGRRRRMRSNHKLVFDYVNDALLEL  453

Query  407  -----DTCHK-------TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  264
                 + C K        +   GA  +    SS +S D +  ++KE   S   C  ++G 
Sbjct  454  VGYGSEKCLKRSGSRCRVLVQEGASASA--TSSPLSVDHIVAQMKELRASGMRCEWENGG  511

Query  263  DDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             ++   + E +VR+E V  GW E   LE + +GKEIEG L++E+V++AVV L +
Sbjct  512  GNSTSLVVENIVRKEVVQIGWVELTDLEIDILGKEIEGDLIQELVENAVVDLLN  565



>ref|XP_007144434.1| hypothetical protein PHAVU_007G155800g [Phaseolus vulgaris]
 gb|ESW16428.1| hypothetical protein PHAVU_007G155800g [Phaseolus vulgaris]
Length=887

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 131/219 (60%), Gaps = 13/219 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS-DSL  570
            S+ARTLSWDDS  +  +        +    ++ EE+EWL  +  LLS AGLD+ Q  DS 
Sbjct  666  SIARTLSWDDSSAEVMSPHLLKRLMIPSLDSKVEEKEWLLLVHKLLSAAGLDDQQQYDSF  725

Query  569  SSRWHSPDSPLDPLLRDK-YINLNEKE--TVHEAKRRQRRSTRKLVFDCVNAALIDI--D  405
             ++W+S +SPLDP LRD  YINLNEKE   +HE +RR+ RS  KL+FD +NA L+++   
Sbjct  726  YTKWYSLESPLDPSLRDTLYINLNEKEPQPMHERRRRKMRSDHKLLFDYINAELLELVGH  785

Query  404  TCHKTIAFSGAHNTI----PDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  237
               K +  SG+H  +       +S +  D +  +IKE   S   C  D    ++ + E +
Sbjct  786  GSGKCLKGSGSHCRVLLQERASASPLLVDHIVAKIKELMASGVRCEQD---SNSLVVENV  842

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            VR+E V  GW E + LE + +GKEIEG L++E++++AVV
Sbjct  843  VRKEIVQIGWVELMELEIDILGKEIEGDLIQELLENAVV  881



>ref|XP_002869475.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45734.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
Length=924

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 132/226 (58%), Gaps = 36/226 (16%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+ARTLSWDD SC D  +      P + +     E+ +W  FI+T+L+ AG      V 
Sbjct  721  GSIARTLSWDDDSCTDDIS-----KPAMGVH----EDEDWYLFIETILTAAGFSSGCTVS  771

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D L SRWH P+SPLD LLRDKY N    N KE +HE KRRQ+RSTRKL+FD +N+ +++
Sbjct  772  HDPLMSRWHLPNSPLDSLLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIILE  831

Query  410  IDTCHKTIAFSGAHNTIP-DGSSIIS-ADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-  249
              T            T+P +GS   +  + VW  +K+W    PS     S + +D N+L 
Sbjct  832  TTT------------TLPGNGSPHFNLVEHVWAHLKDWVSDEPSKRD--SGEDMDANSLA  877

Query  248  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  878  AESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  923



>ref|XP_010433166.1| PREDICTED: uncharacterized protein LOC104717316 isoform X2 [Camelina 
sativa]
Length=856

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 133/225 (59%), Gaps = 34/225 (15%)
 Frame = -1

Query  746  SVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQS  579
            S+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V  
Sbjct  652  SIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAGFSRGCTVSH  703

Query  578  DSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
            D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + +
Sbjct  704  DPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIISE  763

Query  410  IDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-T  246
              T            ++ +GS      + VW ++K+W    PS     S + +D N+L +
Sbjct  764  TTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFD--SGEDMDANSLAS  810

Query  245  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  811  ESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  855



>ref|XP_010433164.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
 ref|XP_010433165.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
Length=915

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 133/225 (59%), Gaps = 34/225 (15%)
 Frame = -1

Query  746  SVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQS  579
            S+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V  
Sbjct  711  SIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAGFSRGCTVSH  762

Query  578  DSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
            D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + +
Sbjct  763  DPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIISE  822

Query  410  IDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-T  246
              T            ++ +GS      + VW ++K+W    PS     S + +D N+L +
Sbjct  823  TTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFD--SGEDMDANSLAS  869

Query  245  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  870  ESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  914



>ref|XP_004139729.1| PREDICTED: uncharacterized protein LOC101207165 [Cucumis sativus]
 ref|XP_004154490.1| PREDICTED: uncharacterized protein LOC101227256 [Cucumis sativus]
 gb|KGN44553.1| hypothetical protein Csa_7G329380 [Cucumis sativus]
Length=960

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 121/205 (59%), Gaps = 17/205 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDSL  570
            S++RTL+W+D+  D  T  Y   P  + +  EEEE++WL  +++L S AGLD+ V  +S 
Sbjct  742  SISRTLTWEDAYSDN-TEPYLFKPTSACEDREEEEQKWLGLVRSLFSAAGLDDSVHHNSF  800

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             SRWHS   PLDP LR+ + NL++KE   EAKRRQ RS  KL+FD VNA L++I      
Sbjct  801  FSRWHSLKYPLDPSLRNNFANLSDKEPEQEAKRRQSRSNWKLIFDSVNAVLVEI------  854

Query  389  IAFSGAHNTIPDGSSIISADR--------VWGRIKEWFPSAAGCLSDDGVDDNNL-TERM  237
              F    +TI   S+ + AD         VW R+K+W      C+  +  D N+L  ER+
Sbjct  855  TGFRSEMSTISISSNWVHADAPSQPLVDIVWDRLKDWLSDETQCVGCEIGDSNSLVVERV  914

Query  236  VRQEAVGKGWHEYLRLEAESIGKEI  162
            V +E VGKGW   L+ E +++GKEI
Sbjct  915  VGKEVVGKGWIHQLQEELDNLGKEI  939



>ref|XP_003537148.1| PREDICTED: uncharacterized protein LOC100814302 isoform X1 [Glycine 
max]
 ref|XP_006588715.1| PREDICTED: uncharacterized protein LOC100814302 isoform X2 [Glycine 
max]
Length=898

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 139/232 (60%), Gaps = 24/232 (10%)
 Frame = -1

Query  746  SVARTLSWD-DSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSD  576
            S+ARTLSWD DS  + A S Y+L P  VS   ++ +++EWL  +  LLS AGLD + Q D
Sbjct  668  SIARTLSWDIDSSAEVA-SPYALKPLMVSSLDSKVDDQEWLLLVHKLLSAAGLDDQHQFD  726

Query  575  SLSSRWHSPDSPLDPLLRDK-YINLNEKE---TVHEAKRRQRRSTRKLVFDCVNAALIDI  408
            S  +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  KLVFD VN AL+++
Sbjct  727  SSYTRWHSLESPLDPSLRDTLYANLNEKEPQPNMHEGRRRRMRSNHKLVFDYVNDALLEL  786

Query  407  -----DTCHK-------TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  264
                 + C K        +   GA  +    SS +S D +  ++KE   S   C  ++G 
Sbjct  787  VGYGSEKCLKRSGSRCRVLVQEGASASA--TSSPLSVDHIVAQMKELRASGMRCEWENGG  844

Query  263  DDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             ++   + E +VR+E V  GW E   LE + +GKEIEG L++E+V++AVV L
Sbjct  845  GNSTSLVVENIVRKEVVQIGWVELTDLEIDILGKEIEGDLIQELVENAVVDL  896



>ref|XP_010069683.1| PREDICTED: uncharacterized protein LOC104456566 [Eucalyptus grandis]
 gb|KCW58104.1| hypothetical protein EUGRSUZ_H00827 [Eucalyptus grandis]
Length=971

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 126/218 (58%), Gaps = 10/218 (5%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDS  573
            GSVAR+LSW +       +   L+ P +   ++EEE +   FI+ LLS++  D    S S
Sbjct  753  GSVARSLSWGEY---PERAFLCLSKPSTTYGSKEEEEDCFVFIEKLLSISSQDGTAPSYS  809

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-----  408
              S WHS  SPLDPLLR+KY + ++K  ++EAKRRQRRS RKL+FDCVNAA+  I     
Sbjct  810  NVSSWHSLHSPLDPLLREKYADEDDK-PLNEAKRRQRRSNRKLIFDCVNAAIAGITGFGP  868

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQ  228
            + C          + + +  S I AD VW +IKEWF        DD        ER V++
Sbjct  869  EECLVDRFCCRPGDLLMEEKSSIRADVVWSQIKEWFTEVRSVSGDDEDHTCLEVERAVKE  928

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            E VGK W  + RL  +++G+EIEG+LLE +V +AV  L
Sbjct  929  EVVGKIWLGHFRLVVDNLGREIEGELLEALVAEAVSDL  966



>ref|XP_006284953.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
 gb|EOA17851.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
Length=925

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 132/219 (60%), Gaps = 27/219 (12%)
 Frame = -1

Query  749  GSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSW DDSC D  +         +M    E+E +W FFI+TLL+ AG      V 
Sbjct  721  GSIARILSWNDDSCTDNISKP-------AMAGVHEDE-DWYFFIETLLTAAGFSRGCTVS  772

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D L SRWH P++PLDP LR+KY N    N KE +HE KRRQ+RSTRKL+FDC+++ +  
Sbjct  773  HDPLISRWHLPNNPLDPSLREKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDCISSII--  830

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL-SDDGVDDNNL-TERM  237
                 +T A S   N+ P    +   + VW ++K+W       L S + +D N+L  E +
Sbjct  831  ----SETTATSMG-NSSPRFDLM---EHVWEQLKDWVLDEPSQLDSGEDMDANSLAAESL  882

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            V+ E VG+ W + L++E ++ G EIE +LL+++V++AV+
Sbjct  883  VKNEIVGRTWTQSLQVEVDNFGIEIERRLLQDLVEEAVI  921



>dbj|BAD94795.1| hypothetical protein [Arabidopsis thaliana]
Length=288

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 124/224 (55%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG      V 
Sbjct  85   GSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAGFSSGCIVS  135

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD +N+ + +
Sbjct  136  HDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIVSE  195

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-TE  243
              T          H  +         + VW ++K+W    PS     S + +D N+L  E
Sbjct  196  TTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDMDANSLAAE  243

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  244  SLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  287



>ref|XP_006412913.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
 gb|ESQ54366.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
Length=913

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 123/224 (55%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSWDD SC D  +      P V +     E+ +W   I+TLL+ AG      V 
Sbjct  710  GSIARILSWDDESCTDNTS-----KPVVGVH----EDEDWYALIETLLTSAGFSRGCTVS  760

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D L +RWH P+SPLDP LRDKY N+   N KE +HE KRRQ RSTRKL+FD +N+ + +
Sbjct  761  HDQLMTRWHLPNSPLDPSLRDKYTNVDNNNIKEFIHEGKRRQHRSTRKLIFDRINSIISE  820

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-TE  243
              T               D       + VW ++K+W    P     + D  +D N+L  E
Sbjct  821  TTTTRMGN----------DSQPFDLVEHVWAQVKDWVSDEPGKRDYVED--IDANSLAAE  868

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +V+ E VG+ W+  L++E +  G EIE  LL+E+V+DAV+ L 
Sbjct  869  SLVKDEIVGRTWNHGLQVEIDDFGIEIERTLLQELVEDAVIDLT  912



>ref|XP_010540954.1| PREDICTED: uncharacterized protein LOC104814547 isoform X3 [Tarenaya 
hassleriana]
Length=804

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 127/215 (59%), Gaps = 22/215 (10%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDS  573
            GS+ARTL WD         S   N P ++   +E++ +W FF++TLL+ AGL   V SD 
Sbjct  606  GSIARTLLWDGDL------STDKNRPETV--IQEDDEDWYFFVETLLTDAGLGRSVSSDP  657

Query  572  LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
               RWHSP+SPLDP LRDKY +  N K+ +HE+KRRQ+RS RKL+FD VNA + +  T  
Sbjct  658  FLVRWHSPESPLDPSLRDKYTDQDNNKDPIHESKRRQKRSNRKLIFDRVNAIIAETTTAT  717

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQEAV  219
                            ++   D  W ++K W   + G    + V+ N++  ER+VR + V
Sbjct  718  TMTCAR-------TNLTLDMVDLAWSQLKGWLCGSEG----ETVEPNSVAAERVVRDDVV  766

Query  218  GKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            G+ W + LRLE + +G EIEGKLL+E+V++ V+ L
Sbjct  767  GRTWLDGLRLEMDDLGLEIEGKLLKELVEETVIDL  801



>ref|XP_010447918.1| PREDICTED: uncharacterized protein LOC104730452 isoform X2 [Camelina 
sativa]
Length=860

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 130/223 (58%), Gaps = 27/223 (12%)
 Frame = -1

Query  749  GSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V 
Sbjct  654  GSIARILSWNDDSCTD------NISKPAVVGVHEDED--WYFFIETLLTAAGFSRGCTVS  705

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALI  414
             D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + 
Sbjct  706  HDPLISRWHLPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIIS  765

Query  413  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL-SDDGVDDNNL-TER  240
            +  T   T   S   + +         + VW ++K+W       L S + +D N+L  E 
Sbjct  766  ETTTTTSTGNGSPCFDLM---------EHVWEQLKDWVLDEPSKLDSGEDMDANSLAAES  816

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +V+ E VG+ W   L++E +  G EIE +LL++++++AV+   
Sbjct  817  LVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDFT  859



>ref|XP_010540953.1| PREDICTED: uncharacterized protein LOC104814547 isoform X2 [Tarenaya 
hassleriana]
Length=834

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 127/215 (59%), Gaps = 22/215 (10%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDS  573
            GS+ARTL WD         S   N P ++   +E++ +W FF++TLL+ AGL   V SD 
Sbjct  636  GSIARTLLWDGDL------STDKNRPETV--IQEDDEDWYFFVETLLTDAGLGRSVSSDP  687

Query  572  LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
               RWHSP+SPLDP LRDKY +  N K+ +HE+KRRQ+RS RKL+FD VNA + +  T  
Sbjct  688  FLVRWHSPESPLDPSLRDKYTDQDNNKDPIHESKRRQKRSNRKLIFDRVNAIIAETTTAT  747

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQEAV  219
                            ++   D  W ++K W   + G    + V+ N++  ER+VR + V
Sbjct  748  TMTCAR-------TNLTLDMVDLAWSQLKGWLCGSEG----ETVEPNSVAAERVVRDDVV  796

Query  218  GKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            G+ W + LRLE + +G EIEGKLL+E+V++ V+ L
Sbjct  797  GRTWLDGLRLEMDDLGLEIEGKLLKELVEETVIDL  831



>ref|XP_010447916.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
 ref|XP_010447917.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
Length=919

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 130/220 (59%), Gaps = 27/220 (12%)
 Frame = -1

Query  749  GSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG      V 
Sbjct  713  GSIARILSWNDDSCTD------NISKPAVVGVHEDED--WYFFIETLLTAAGFSRGCTVS  764

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALI  414
             D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC+N+ + 
Sbjct  765  HDPLISRWHLPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDCINSIIS  824

Query  413  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL-SDDGVDDNNL-TER  240
            +  T   T   S   + +         + VW ++K+W       L S + +D N+L  E 
Sbjct  825  ETTTTTSTGNGSPCFDLM---------EHVWEQLKDWVLDEPSKLDSGEDMDANSLAAES  875

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            +V+ E VG+ W   L++E +  G EIE +LL++++++AV+
Sbjct  876  LVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVI  915



>ref|XP_010540945.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540947.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540948.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540949.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540950.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540951.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540952.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
Length=863

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 127/215 (59%), Gaps = 22/215 (10%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE-VQSDS  573
            GS+ARTL WD         S   N P ++   +E++ +W FF++TLL+ AGL   V SD 
Sbjct  665  GSIARTLLWDGDL------STDKNRPETV--IQEDDEDWYFFVETLLTDAGLGRSVSSDP  716

Query  572  LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
               RWHSP+SPLDP LRDKY +  N K+ +HE+KRRQ+RS RKL+FD VNA + +  T  
Sbjct  717  FLVRWHSPESPLDPSLRDKYTDQDNNKDPIHESKRRQKRSNRKLIFDRVNAIIAETTTAT  776

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQEAV  219
                            ++   D  W ++K W   + G    + V+ N++  ER+VR + V
Sbjct  777  TMTCAR-------TNLTLDMVDLAWSQLKGWLCGSEG----ETVEPNSVAAERVVRDDVV  825

Query  218  GKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            G+ W + LRLE + +G EIEGKLL+E+V++ V+ L
Sbjct  826  GRTWLDGLRLEMDDLGLEIEGKLLKELVEETVIDL  860



>ref|XP_010918845.1| PREDICTED: uncharacterized protein LOC105043126 [Elaeis guineensis]
Length=993

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 128/220 (58%), Gaps = 14/220 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVAR+L+WDD    T   + S NP     ++ + + EE+E   F+Q LLS AGLD  +SD
Sbjct  780  SVARSLAWDD----THQEALSANPSKMYRALSKADNEEQERYMFVQKLLSSAGLDSEKSD  835

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--T  402
             + + WHS DSPLDP+L DK+++        EAK R+RRS +KL+FDCVNAAL++I   T
Sbjct  836  MVFASWHSVDSPLDPILLDKFLD----RKGEEAKSRERRSNQKLLFDCVNAALLEIGRTT  891

Query  401  CHKTIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQE  225
                  + GA H+   + S       VWG ++ WF      +  +  + N L +R++++E
Sbjct  892  LLSAYPWKGAYHHARRNTSRDTYPVEVWGLLRNWFSGEGKQVMYEADNSNLLMDRVLKRE  951

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
              G+GW E +R E + I  EI   +LE++V++A+V    T
Sbjct  952  VEGRGWAESMRSEIDEISIEIGRDVLEDLVKEALVDFDGT  991



>dbj|BAF01823.1| hypothetical protein [Arabidopsis thaliana]
Length=660

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 124/224 (55%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG      V 
Sbjct  457  GSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAGFSSGCIVS  507

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD +N+ + +
Sbjct  508  HDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIVSE  567

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-TE  243
              T          H  +         + VW ++K+W    PS     S + +D N+L  E
Sbjct  568  TTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDMDANSLAAE  615

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  616  SLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  659



>emb|CAA22976.1| putative protein [Arabidopsis thaliana]
 emb|CAB81464.1| putative protein [Arabidopsis thaliana]
Length=880

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 124/224 (55%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG      V 
Sbjct  677  GSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAGFSSGCIVS  727

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD +N+ + +
Sbjct  728  HDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIVSE  787

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-TE  243
              T          H  +         + VW ++K+W    PS     S + +D N+L  E
Sbjct  788  TTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDMDANSLAAE  835

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  836  SLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  879



>ref|XP_010933202.1| PREDICTED: uncharacterized protein LOC105053649 isoform X1 [Elaeis 
guineensis]
Length=963

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVAR+LSWDD   +T+    S NP +   ++ + + E +E L F+Q LLS AGLD  +SD
Sbjct  750  SVARSLSWDDIHQETS----SPNPSILCRALSKADVERQEQLMFVQKLLSSAGLDGEKSD  805

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--T  402
             + SRW+S DSPL+P+L +K+++  E+    EA+  +RRS ++L+FDCVNAAL+++   T
Sbjct  806  MVFSRWYSVDSPLNPILLNKFLDRKEE----EAESWERRSNQRLLFDCVNAALLELGQAT  861

Query  401  CHKTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTE  243
                  + G +     +T PD    +    VWG ++ WF      ++    DDN+  + +
Sbjct  862  LLNAYPWKGPYHHPQKDTSPDAPCAV---EVWGLVRNWFSGERKLVAG---DDNSSLMVD  915

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            R++R+E  G+GW E ++ E + I  EI G++LE++V++A++  A T
Sbjct  916  RVLRREVEGRGWDESIKSETQEISAEIGGEILEDVVREALLEFAST  961



>ref|XP_010933204.1| PREDICTED: uncharacterized protein LOC105053649 isoform X3 [Elaeis 
guineensis]
Length=927

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVAR+LSWDD   +T+    S NP +   ++ + + E +E L F+Q LLS AGLD  +SD
Sbjct  714  SVARSLSWDDIHQETS----SPNPSILCRALSKADVERQEQLMFVQKLLSSAGLDGEKSD  769

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--T  402
             + SRW+S DSPL+P+L +K+++  E+    EA+  +RRS ++L+FDCVNAAL+++   T
Sbjct  770  MVFSRWYSVDSPLNPILLNKFLDRKEE----EAESWERRSNQRLLFDCVNAALLELGQAT  825

Query  401  CHKTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTE  243
                  + G +     +T PD    +    VWG ++ WF      ++    DDN+  + +
Sbjct  826  LLNAYPWKGPYHHPQKDTSPDAPCAV---EVWGLVRNWFSGERKLVAG---DDNSSLMVD  879

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            R++R+E  G+GW E ++ E + I  EI G++LE++V++A++  A T
Sbjct  880  RVLRREVEGRGWDESIKSETQEISAEIGGEILEDVVREALLEFAST  925



>ref|NP_567819.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974633.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK93687.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44897.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85538.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
 gb|AEE85539.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
Length=924

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 124/224 (55%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG      V 
Sbjct  721  GSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAGFSSGCIVS  771

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD +N+ + +
Sbjct  772  HDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIVSE  831

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-TE  243
              T          H  +         + VW ++K+W    PS     S + +D N+L  E
Sbjct  832  TTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDMDANSLAAE  879

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  880  SLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  923



>ref|XP_010933203.1| PREDICTED: uncharacterized protein LOC105053649 isoform X2 [Elaeis 
guineensis]
Length=965

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVAR+LSWDD   +T+    S NP +   ++ + + E +E L F+Q LLS AGLD  +SD
Sbjct  752  SVARSLSWDDIHQETS----SPNPSILCRALSKADVERQEQLMFVQKLLSSAGLDGEKSD  807

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--T  402
             + SRW+S DSPL+P+L +K+++  E+    EA+  +RRS ++L+FDCVNAAL+++   T
Sbjct  808  MVFSRWYSVDSPLNPILLNKFLDRKEE----EAESWERRSNQRLLFDCVNAALLELGQAT  863

Query  401  CHKTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTE  243
                  + G +     +T PD    +    VWG ++ WF      ++    DDN+  + +
Sbjct  864  LLNAYPWKGPYHHPQKDTSPDAPCAV---EVWGLVRNWFSGERKLVAG---DDNSSLMVD  917

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            R++R+E  G+GW E ++ E + I  EI G++LE++V++A++  A T
Sbjct  918  RVLRREVEGRGWDESIKSETQEISAEIGGEILEDVVREALLEFAST  963



>dbj|BAH19995.1| AT4G28760 [Arabidopsis thaliana]
Length=924

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 124/224 (55%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQ  582
            GS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG      V 
Sbjct  721  GSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAGFSSGCIVS  771

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
             D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD +N+ + +
Sbjct  772  HDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIVSE  831

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGVDDNNL-TE  243
              T          H  +         + VW ++K+W    PS     S + +D N+L  E
Sbjct  832  TTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDMDANSLAAE  879

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  880  SLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  923



>ref|XP_004495031.1| PREDICTED: uro-adherence factor A-like isoform X1 [Cicer arietinum]
 ref|XP_004495032.1| PREDICTED: uro-adherence factor A-like isoform X2 [Cicer arietinum]
Length=853

 Score =   137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 140/224 (63%), Gaps = 19/224 (8%)
 Frame = -1

Query  746  SVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEE-EEREWLFFIQTLLSMAGLDEVQS-D  576
            SVARTLSWDD SC + AT  Y   P  +     + EE EWL  +Q LLS +GLD  Q  D
Sbjct  627  SVARTLSWDDDSCGELATPYYPSKPIRATSLDNKLEENEWLLLVQKLLSASGLDNQQHYD  686

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKET--VHEAKRRQRRSTRKLVFDCVNAALIDI--  408
            S  +RWHS +SPLDP LRD Y N+NEK+T  ++EAKRR+ RS +KLVFDCVN A++++  
Sbjct  687  SFHTRWHSFESPLDPSLRDTYANINEKDTQPLNEAKRRKIRSNQKLVFDCVNDAILEVVG  746

Query  407  ---DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAG---CLSDDGVDDNN  252
               D   K +  SG HN   + +GS ++  D +  ++KE   +  G    L + G D ++
Sbjct  747  YGPDNYFKKMC-SGTHNRPLVQEGSCLV--DHIVTQMKELIIANNGMRFVLEECGGDSHS  803

Query  251  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            L  E +VR+E V  G  E  R+E + +G+EIEG ++EEIV+DAV
Sbjct  804  LVVENVVRKEVVQLGLVEVTRMEIDVLGREIEGMIIEEIVEDAV  847



>ref|XP_010526475.1| PREDICTED: uncharacterized protein LOC104804028 isoform X2 [Tarenaya 
hassleriana]
Length=824

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 126/223 (57%), Gaps = 36/223 (16%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEERE-WLFFIQTLLSMAGLDEVQSDS  573
            GS+ARTLSW             L+P ++   T  +E E W FFI+TLL+   L       
Sbjct  627  GSIARTLSW--------DDDDDLSPDITRPVTVIQEYEDWYFFIETLLTSVSLG------  672

Query  572  LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
              +RWHSPDSPLDP LRDKY +  N K+  +E+KRRQ+ S +KL+FDCVNA + +     
Sbjct  673  -CNRWHSPDSPLDPSLRDKYPDPDNHKDLTYESKRRQQGSNQKLIFDCVNAIVAET----  727

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD-------DNNLT-ER  240
             T   S    ++P    +   D  W ++K+W  S +G  +D  +D        N+L  ER
Sbjct  728  -TTTLSRNSLSLP----VDLVDHAWSQLKDWL-SGSGS-TDTSLDMGETVHTTNSLAAER  780

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +VR E VG+ W + LR+E + +G EIEGKLL+E+V++  + L 
Sbjct  781  VVRDEVVGRTWLDGLRIEMDELGIEIEGKLLQELVEETFLDLT  823



>ref|XP_010526471.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526472.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526473.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526474.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
Length=882

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 126/223 (57%), Gaps = 36/223 (16%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEERE-WLFFIQTLLSMAGLDEVQSDS  573
            GS+ARTLSW             L+P ++   T  +E E W FFI+TLL+   L       
Sbjct  685  GSIARTLSW--------DDDDDLSPDITRPVTVIQEYEDWYFFIETLLTSVSLG------  730

Query  572  LSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
              +RWHSPDSPLDP LRDKY +  N K+  +E+KRRQ+ S +KL+FDCVNA + +     
Sbjct  731  -CNRWHSPDSPLDPSLRDKYPDPDNHKDLTYESKRRQQGSNQKLIFDCVNAIVAET----  785

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD-------DNNLT-ER  240
             T   S    ++P    +   D  W ++K+W  S +G  +D  +D        N+L  ER
Sbjct  786  -TTTLSRNSLSLP----VDLVDHAWSQLKDWL-SGSGS-TDTSLDMGETVHTTNSLAAER  838

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +VR E VG+ W + LR+E + +G EIEGKLL+E+V++  + L 
Sbjct  839  VVRDEVVGRTWLDGLRIEMDELGIEIEGKLLQELVEETFLDLT  881



>emb|CDY31985.1| BnaA07g00100D [Brassica napus]
Length=758

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 118/215 (55%), Gaps = 38/215 (18%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            GS+AR  SW+D S  D       +          +E+ +W +FI+TLL  +G     SD 
Sbjct  579  GSIARVFSWEDESYTDITKPGNGI----------KEDEDWYYFIKTLLKTSGFS--GSDP  626

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHSPDSPLDP LRD++ N   KE +   KRR +RS RKLVFDCVNA + +  +   
Sbjct  627  LMTRWHSPDSPLDPSLRDRFAN---KEPI---KRRNQRSNRKLVFDCVNAIITETSS---  677

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQEAVG  216
            T A +G   T P G  ++  + VW   KEW             D N+L  E +VR+E VG
Sbjct  678  TAARTGV--TTP-GFDMV--EHVWTEFKEWMVQ----------DSNSLEGESLVREEVVG  722

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            K W   L++E  ++G EIE  LL+E+V+ AV  L 
Sbjct  723  KMWSHNLQVEVNNLGVEIEEMLLQELVEKAVFDLT  757



>emb|CDY65848.1| BnaCnng48860D [Brassica napus]
Length=716

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 113/215 (53%), Gaps = 39/215 (18%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            GS+AR  SW+D S  D       +          +E+ +W +FI+TLL  +G     SD 
Sbjct  538  GSIARVFSWEDESYTDITKPGNGI----------KEDEDWYYFIKTLLKTSGFS--GSDP  585

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHSPDSPL+P LRD++ N   KE +   KRR +RS RKLVFDCVNA + +  +   
Sbjct  586  LMTRWHSPDSPLEPSLRDRFAN---KEPI---KRRNQRSNRKLVFDCVNAIITETTSTAA  639

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERMVRQEAVG  216
                +   + +         + VW   KEW             D N+L  E +VR+E VG
Sbjct  640  RTGLTSGFDMV---------EHVWTEFKEWVVQ----------DSNSLEGESLVREEVVG  680

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            K W   L++E  ++G EIE  LLEE+V++AV  L 
Sbjct  681  KMWSHNLQVEVNNLGIEIEVMLLEELVEEAVFDLT  715



>emb|CDY06873.1| BnaC01g09720D [Brassica napus]
Length=845

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 123/218 (56%), Gaps = 35/218 (16%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            GS++R LSWDD SC D      +++ P    R   E+ +W  FI+T+L+ AG    +  +
Sbjct  651  GSISRILSWDDDSCTD------NISKPA--MRGVHEDEDWFLFIETILTAAGFS--KGCT  700

Query  572  LSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT  402
            LS     P+SPLDP LR+KY NL   N KE V+E KRRQ RSTRKL+FDC+N+ + +  T
Sbjct  701  LSHDTVMPNSPLDPSLREKYTNLDNNNIKEFVNEGKRRQHRSTRKLIFDCINSMVSETTT  760

Query  401  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT----ERMV  234
                           D  ++   +RVW +IK+W       LSD+ V+D + +    E +V
Sbjct  761  TRMG----------KDSPALDLVERVWSQIKDW-------LSDEYVEDMDASSVAAESLV  803

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            ++E VG+ W    + E   +G  IE  LL+E+V++AV+
Sbjct  804  KEEIVGRRWMNSFQGEINDLGIGIEKALLQELVEEAVL  841



>ref|XP_008789491.1| PREDICTED: uncharacterized protein LOC103706972 isoform X3 [Phoenix 
dactylifera]
Length=944

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 126/218 (58%), Gaps = 23/218 (11%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVS---MQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            S+AR+LS D S +        +NPP     + + EE E+E    +Q LLS AG    +S 
Sbjct  734  SIARSLSRDGSSLGRIL----MNPPKPSRLLPKVEEGEQERFVLVQKLLSSAGFRNEKSC  789

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVNAAL++I    
Sbjct  790  MIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVNAALLNIGQSA  845

Query  395  KTIAFS------GAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERM  237
               ++       GA    P G+S+   + V   ++ W+ S    L + G    NLT ER+
Sbjct  846  VLASYPWAGACCGAWKDGPAGASV--TEEVCELVRNWY-SGESVLGEPG--GINLTVERV  900

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  901  VKREVAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  938



>ref|XP_008789489.1| PREDICTED: uncharacterized protein LOC103706972 isoform X1 [Phoenix 
dactylifera]
Length=963

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 126/218 (58%), Gaps = 23/218 (11%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVS---MQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            S+AR+LS D S +        +NPP     + + EE E+E    +Q LLS AG    +S 
Sbjct  753  SIARSLSRDGSSLGRIL----MNPPKPSRLLPKVEEGEQERFVLVQKLLSSAGFRNEKSC  808

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVNAAL++I    
Sbjct  809  MIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVNAALLNIGQSA  864

Query  395  KTIAFS------GAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERM  237
               ++       GA    P G+S+   + V   ++ W+ S    L + G    NLT ER+
Sbjct  865  VLASYPWAGACCGAWKDGPAGASV--TEEVCELVRNWY-SGESVLGEPG--GINLTVERV  919

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  920  VKREVAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  957



>ref|XP_008789490.1| PREDICTED: uncharacterized protein LOC103706972 isoform X2 [Phoenix 
dactylifera]
Length=962

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 126/218 (58%), Gaps = 23/218 (11%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVS---MQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            S+AR+LS D S +        +NPP     + + EE E+E    +Q LLS AG    +S 
Sbjct  752  SIARSLSRDGSSLGRIL----MNPPKPSRLLPKVEEGEQERFVLVQKLLSSAGFRNEKSC  807

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
             + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVNAAL++I    
Sbjct  808  MIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVNAALLNIGQSA  863

Query  395  KTIAFS------GAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERM  237
               ++       GA    P G+S+   + V   ++ W+ S    L + G    NLT ER+
Sbjct  864  VLASYPWAGACCGAWKDGPAGASV--TEEVCELVRNWY-SGESVLGEPG--GINLTVERV  918

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  919  VKREVAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  956



>ref|XP_004165945.1| PREDICTED: uncharacterized LOC101204012 [Cucumis sativus]
Length=866

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 121/199 (61%), Gaps = 14/199 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDSL  570
            S+AR++ WD S  D++      + PVS     EEE+ W   +Q LL+M+GL +EVQ  SL
Sbjct  654  SIARSIFWDGSYSDSSAPCALKSAPVST--CLEEEQNWHSLVQALLTMSGLSNEVQQCSL  711

Query  569  -SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC--  399
              ++WHS  +PLD  LR+KY NLN KE + EA+RRQ RS+RKLVFDCVNAALIDI +   
Sbjct  712  LFAKWHSLANPLDLSLRNKYANLNSKEPMLEAERRQLRSSRKLVFDCVNAALIDITSQEL  771

Query  398  -HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
             H+          +   +S+   D V  ++K+W    + C++ D  D N+L    V ++ 
Sbjct  772  DHRRTEI------LAQDTSLTLLDCVMVKVKDWVCVESRCVTGDIGDINSLVVERVVRKE  825

Query  221  V-GKGWHEYLRLEAESIGK  168
            V G+ W E+LR+E +++GK
Sbjct  826  VGGRNWDEHLRMEMDNLGK  844



>ref|XP_004152072.1| PREDICTED: uncharacterized protein LOC101204012 [Cucumis sativus]
Length=904

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 121/199 (61%), Gaps = 14/199 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDSL  570
            S+AR++ WD S  D++      + PVS     EEE+ W   +Q LL+M+GL +EVQ  SL
Sbjct  692  SIARSIFWDGSYSDSSAPCALKSAPVST--CLEEEQNWHSLVQALLTMSGLSNEVQQCSL  749

Query  569  -SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC--  399
              ++WHS  +PLD  LR+KY NLN KE + EA+RRQ RS+RKLVFDCVNAALIDI +   
Sbjct  750  LFAKWHSLANPLDLSLRNKYANLNSKEPMLEAERRQLRSSRKLVFDCVNAALIDITSQEL  809

Query  398  -HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
             H+          +   +S+   D V  ++K+W    + C++ D  D N+L    V ++ 
Sbjct  810  DHRRTEI------LAQDTSLTLLDCVMVKVKDWVCVESRCVTGDIGDINSLVVERVVRKE  863

Query  221  V-GKGWHEYLRLEAESIGK  168
            V G+ W E+LR+E +++GK
Sbjct  864  VGGRNWDEHLRMEMDNLGK  882



>gb|KGN58324.1| hypothetical protein Csa_3G622430 [Cucumis sativus]
Length=963

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 121/199 (61%), Gaps = 14/199 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDSL  570
            S+AR++ WD S  D++      + PVS     EEE+ W   +Q LL+M+GL +EVQ  SL
Sbjct  751  SIARSIFWDGSYSDSSAPCALKSAPVST--CLEEEQNWHSLVQALLTMSGLSNEVQQCSL  808

Query  569  -SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC--  399
              ++WHS  +PLD  LR+KY NLN KE + EA+RRQ RS+RKLVFDCVNAALIDI +   
Sbjct  809  LFAKWHSLANPLDLSLRNKYANLNSKEPMLEAERRQLRSSRKLVFDCVNAALIDITSQEL  868

Query  398  -HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
             H+          +   +S+   D V  ++K+W    + C++ D  D N+L    V ++ 
Sbjct  869  DHRRTEI------LAQDTSLTLLDCVMVKVKDWVCVESRCVTGDIGDINSLVVERVVRKE  922

Query  221  V-GKGWHEYLRLEAESIGK  168
            V G+ W E+LR+E +++GK
Sbjct  923  VGGRNWDEHLRMEMDNLGK  941



>ref|XP_008447347.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
 ref|XP_008447348.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
Length=971

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 122/199 (61%), Gaps = 14/199 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL-DEVQSDSL  570
            S+AR++  D S   ++      +PPVS     +EE+ W   +Q LL+M+GL +E+Q  SL
Sbjct  759  SIARSIFRDGSYSGSSAPCALKSPPVST--CLKEEQNWHCLVQALLTMSGLSNEIQQCSL  816

Query  569  -SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC--  399
              ++WHS  +PLDP LR+KY NL+ KE + EA+RRQ RS+RKLVFDCVNAALI+I +   
Sbjct  817  LFTKWHSLANPLDPSLRNKYANLSSKEPMLEAERRQLRSSRKLVFDCVNAALINITSQEL  876

Query  398  -HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
             H+      AH+T     S+   D V  ++K+W    + CL+ D  D N+L    V ++ 
Sbjct  877  DHRQTKIL-AHDT-----SLTLLDYVMVKLKDWICGESRCLTGDIGDSNSLVVERVVRKE  930

Query  221  V-GKGWHEYLRLEAESIGK  168
            V GK W E+L +E +++GK
Sbjct  931  VGGKNWDEHLLMEMDNLGK  949



>ref|XP_010940678.1| PREDICTED: uncharacterized protein LOC105059154 isoform X1 [Elaeis 
guineensis]
Length=955

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 123/216 (57%), Gaps = 18/216 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP--PVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            S+AR+LS D S +        +NP  P S+    EEE+E    +Q LLS AGL   +S  
Sbjct  744  SIARSLSRDGSSLGRIL----MNPLKPSSLVPKVEEEQERFVLVQKLLSSAGLQNEKSYM  799

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVNAAL+ +     
Sbjct  800  IFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVNAALLSVGQSAI  855

Query  392  TIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
              ++      SGA      G+S+   + V   ++ W+      L  +    N + +R+V+
Sbjct  856  LASYPWAGACSGAWKDGTAGASV--TEEVCELVRNWYSGEEKSLPSEPRSINLVVDRVVK  913

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            +E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  914  REIAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  949



>ref|XP_010940679.1| PREDICTED: uncharacterized protein LOC105059154 isoform X2 [Elaeis 
guineensis]
Length=954

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 123/216 (57%), Gaps = 18/216 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNP--PVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            S+AR+LS D S +        +NP  P S+    EEE+E    +Q LLS AGL   +S  
Sbjct  743  SIARSLSRDGSSLGRIL----MNPLKPSSLVPKVEEEQERFVLVQKLLSSAGLQNEKSYM  798

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVNAAL+ +     
Sbjct  799  IFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVNAALLSVGQSAI  854

Query  392  TIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
              ++      SGA      G+S+   + V   ++ W+      L  +    N + +R+V+
Sbjct  855  LASYPWAGACSGAWKDGTAGASV--TEEVCELVRNWYSGEEKSLPSEPRSINLVVDRVVK  912

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            +E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  913  REIAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  948



>dbj|BAK01535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=705

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 120/218 (55%), Gaps = 28/218 (13%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVARTLSWDDS  + A        P S +  +  E+E   F++ +LS AGL  V +  +
Sbjct  495  GSVARTLSWDDSSSEEAA-------PCSSKEEDSHEQEQYEFVEKILSSAGLCSVTTSDV  547

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCH  396
             +RWHS DSPL P + D+++    +  V +AKRR+RRS ++L+ D VNAAL+DI   T  
Sbjct  548  FARWHSLDSPLAPNVPDQFL----ERKVEDAKRRERRSGQRLLIDSVNAALLDIGQSTLW  603

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-------TERM  237
                 +G    +      + AD  W  +K W       LSDD   +N L        +R+
Sbjct  604  SAYPCAGPVANVSRRDEPV-ADAAWRLVKGW-------LSDDEASNNGLPGNVGVAADRV  655

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            V +E  G+GW E LRLE + + K+I G +L E+V++A+
Sbjct  656  VGEEIEGRGWSEMLRLEVDDMTKQICGDVLGEVVEEAL  693



>ref|XP_008812928.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
 ref|XP_008812929.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
 ref|XP_008812930.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
 ref|XP_008812931.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
Length=713

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 131/226 (58%), Gaps = 26/226 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SV R+LSWDD   +T+    S NP     ++ + + E +E + F+Q LLS AGLD  + D
Sbjct  500  SVTRSLSWDDVHQETS----SPNPSKLYRALSKADVEGQELVMFVQKLLSSAGLDSEKPD  555

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--T  402
             + SRW+S DSPL+P+L DK+++  E+    EAK R+RRS ++L+FD VNAAL++I   T
Sbjct  556  MVFSRWYSVDSPLNPILLDKFLDQKEE----EAKSRERRSNQRLLFDWVNAALLEIGQAT  611

Query  401  CHKTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL--TE  243
                  + G +     +T PD    +    VWG I+ WF      ++    DDN++   +
Sbjct  612  LLNAYPWKGPYHHPQKDTSPDTPYGV---EVWGLIRNWFSGERKLVTG---DDNSILVVD  665

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
             ++R+E  G+GW E ++ E + I  EI  ++LE++V++A+     T
Sbjct  666  GVLRREVEGRGWAESMKSEIDEISTEIGREILEDLVREALPDFTGT  711



>dbj|BAJ95378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=896

 Score =   123 bits (308),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 120/218 (55%), Gaps = 28/218 (13%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVARTLSWDDS  + A        P S +  +  E+E   F++ +LS AGL  V +  +
Sbjct  686  GSVARTLSWDDSSSEEAA-------PCSSKEEDSHEQEQYEFVEKILSSAGLCSVTTSDV  738

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCH  396
             +RWHS DSPL P + D+++    +  V +AKRR+RRS ++L+ D VNAAL+DI   T  
Sbjct  739  FARWHSLDSPLAPNVPDQFL----ERKVEDAKRRERRSGQRLLIDSVNAALLDIGQSTLW  794

Query  395  KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-------TERM  237
                 +G    +      + AD  W  +K W       LSDD   +N L        +R+
Sbjct  795  SAYPCAGPVANVSRRDEPV-ADAAWRLVKGW-------LSDDEASNNGLPGNVGVAADRV  846

Query  236  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            V +E  G+GW E LRLE + + K+I G +L E+V++A+
Sbjct  847  VGEEIEGRGWSEMLRLEVDDMTKQICGDVLGEVVEEAL  884



>ref|XP_009129280.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
 ref|XP_009129285.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
Length=837

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 119/221 (54%), Gaps = 39/221 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+AR LSWDD            +   +M   +E+E +W  FI+T+L+ AG    +  + 
Sbjct  647  GSIARILSWDD------------DSKPAMGGVQEDE-DWFLFIETILTAAGFS--KGCTF  691

Query  569  SSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT  402
            S     P+SPLDP LR+KY NL    N KE V+E KRRQ RSTRKL+FDC+N+ + +  T
Sbjct  692  SHDTVMPNSPLDPSLREKYTNLDNNNNIKEFVNEGKRRQHRSTRKLIFDCINSIVSETTT  751

Query  401  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT----ERMV  234
                  +S   + +         + VW ++K+W       LSD+ V+D +      E +V
Sbjct  752  TRIGTDYSRPLDLV---------EHVWSQVKDW-------LSDEYVEDMDANSVAAESLV  795

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            ++E VG+ W    + E + +G  IE  LL E++++AV+ L 
Sbjct  796  KEEIVGRRWMNSFQGEVDDLGIGIESALLRELIEEAVLDLT  836



>gb|EMT32262.1| hypothetical protein F775_21072 [Aegilops tauschii]
Length=839

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 123/227 (54%), Gaps = 37/227 (16%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVARTLSWDDS  + A        P S +  +  E+E   F++ +LS AGL    + ++
Sbjct  633  GSVARTLSWDDSSEEEAA-------PCSSKEEDSHEQEQYEFVEKILSSAGLCNGATSNV  685

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             +RWHS DSPL P + D+++    +  V +AK R+RRS+++L+ D VNAAL+DI      
Sbjct  686  FARWHSLDSPLAPNVPDQFL----ERKVEDAKCRERRSSQRLLIDSVNAALLDIGQSKLW  741

Query  389  IAFSGAHNTIPDGSSIIS--------ADRVWGRIKEWFPSAAGCLSDD----GVDDN--N  252
             A+      I     II+         D  W  +K W       LSDD    G+ DN   
Sbjct  742  GAYPCTAGPI-----IINVSQRDEPVGDAAWRLVKGW-------LSDDEAGNGLPDNVGT  789

Query  251  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
              +R+V +E  G+GW E LRLE + + KEI G +L E+V++A+  LA
Sbjct  790  AADRVVGEEIGGRGWSEMLRLEVDDMTKEICGGVLGEVVEEALSELA  836



>emb|CDY35217.1| BnaA01g08140D [Brassica napus]
Length=837

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 120/225 (53%), Gaps = 45/225 (20%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE---VQS  579
            GS+AR LSWDD                +M   +E+E +W  FI+T+L+ AG  +   V  
Sbjct  647  GSIARILSWDDDSKP------------AMGGVQEDE-DWFLFIETILTAAGFSKGCTVSH  693

Query  578  DSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
            D++      P+SPLDP LR+KY NL    N KE V+E KRRQ RSTRKL+FDC+N+ + +
Sbjct  694  DTVM-----PNSPLDPSLREKYTNLDNNNNIKEFVNEGKRRQHRSTRKLIFDCINSIISE  748

Query  410  IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT----E  243
              T      +S   + +         + VW ++K W       LSD+ V+D +      E
Sbjct  749  TTTTRMGNDYSPPLDLV---------EHVWSQVKVW-------LSDEYVEDMDANSVAAE  792

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             +V++E VG+ W    + E + +G  IE  LL E++++AV+ L +
Sbjct  793  SLVKEEIVGRRWMNSFQGEVDDLGIGIESALLRELIEEAVLDLTE  837



>ref|XP_006408939.1| hypothetical protein EUTSA_v10001917mg [Eutrema salsugineum]
 gb|ESQ50392.1| hypothetical protein EUTSA_v10001917mg [Eutrema salsugineum]
Length=735

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 113/213 (53%), Gaps = 42/213 (20%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            S+AR  SW+D        SY   P   ++    EE +W + I+TLL  +G     SD L 
Sbjct  561  SIARVFSWEDE-------SYITKPATGIK----EEEDWYYLIKTLLKASGFR--GSDPLM  607

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            +RWHSPD PLDP LRD + N   KE V   KRR++RS RKLVFDCVNA + +      T 
Sbjct  608  TRWHSPDCPLDPSLRDTFAN---KELV---KRRKQRSNRKLVFDCVNAIITET-----TS  656

Query  386  AFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT--ERMVRQEAVGK  213
            A +GA  +   G  ++  + VW  +K           D  V D+N    E ++R E VGK
Sbjct  657  AAAGAETS---GFDML--EHVWTELK-----------DLAVQDSNSLEGESVLRDEVVGK  700

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W    + E  ++G EIE  LL+E+VQ+AV  L
Sbjct  701  MWSRNSQAEVNNLGIEIEVMLLQELVQEAVFDL  733



>ref|NP_179614.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD21764.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06984.1| uncharacterized protein AT2G20240 [Arabidopsis thaliana]
Length=713

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 115/213 (54%), Gaps = 49/213 (23%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            G++AR L+W+D S  DT+  +  +          EE+ +W  FI+TLL+ +G     SDS
Sbjct  548  GTIARILAWEDESYTDTSKPAMGI----------EEDEDWYGFIKTLLTASGFS--GSDS  595

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHS +SPLDP LRDK+ N   KE +   KRR++RS RKLVFDCVNA + +  +   
Sbjct  596  LMTRWHSLESPLDPSLRDKFAN---KELI---KRRKQRSNRKLVFDCVNAIITETTS---  646

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
                + AH  +  G +++  + VW  ++EW                      V  E  GK
Sbjct  647  ----TLAHTGLTKGFNML--EHVWTELQEW---------------------AVNDEVAGK  679

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W   L++E  ++G EIE  LL+E+V++AV  L
Sbjct  680  MWSYGLQVEMNNLGIEIEVILLQELVEEAVFDL  712



>dbj|BAD43822.1| unknown protein [Arabidopsis thaliana]
Length=713

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 115/213 (54%), Gaps = 49/213 (23%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            G++AR L+W+D S  DT+  +  +          EE+ +W  FI+TLL+ +G     SDS
Sbjct  548  GTIARILAWEDESYTDTSKPAMGI----------EEDEDWYGFIKTLLTASGFS--GSDS  595

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHS +SPLDP LRDK+ N   KE +   KRR++RS RKLVFDCVNA + +  +   
Sbjct  596  LMTRWHSLESPLDPSLRDKFAN---KELI---KRRKQRSNRKLVFDCVNAIITETTS---  646

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
                + AH  +  G +++  + VW  ++EW                      V  E  GK
Sbjct  647  ----TLAHTGLTKGFNML--EHVWTELQEW---------------------AVNDEVAGK  679

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W   L++E  ++G EIE  LL+E+V++AV  L
Sbjct  680  MWSYGLQVEMNNLGIEIEVILLQELVEEAVFDL  712



>ref|XP_002883937.1| hypothetical protein ARALYDRAFT_319541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60196.1| hypothetical protein ARALYDRAFT_319541 [Arabidopsis lyrata subsp. 
lyrata]
Length=697

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 112/213 (53%), Gaps = 47/213 (22%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+AR  SW+D      T      P + +    EE+  W  F++TLL+ +G     SDSL
Sbjct  531  GSIARVFSWEDESYTNTT-----KPAMGI----EEDENWYGFVKTLLTASGFS--GSDSL  579

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             +RWHSP+SPLDP LRDK+ N   KE +   KRR++RST KLVFDCVNA + +  +    
Sbjct  580  MTRWHSPESPLDPSLRDKFAN---KELI---KRRKQRSTCKLVFDCVNAIITETTS----  629

Query  389  IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKG  210
               + AH  +  G +++  + VW             L D  V D          E VGK 
Sbjct  630  ---TLAHTGLTKGFNMV--EHVW-----------TALQDSAVSD----------EVVGKM  663

Query  209  WHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            W   L++E  ++G EIE  LL+E+V++AV  L 
Sbjct  664  WSYGLQVETNNLGIEIEVILLQELVEEAVFDLT  696



>gb|EMS51091.1| hypothetical protein TRIUR3_23853 [Triticum urartu]
Length=996

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 116/217 (53%), Gaps = 15/217 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SV R+LS +D+   + +  + LN        E+ E E    +Q +LS AGLD +Q   + 
Sbjct  769  SVPRSLSCEDTYSHSPSHMHHLNS----SNAEDNESECYALVQKILSSAGLDNLQVSMVF  824

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + WHS D PLDP L DK+++  E+     AK R+RRS +KL+FDCVN AL++   D   +
Sbjct  825  TGWHSADCPLDPALCDKFLDRKEE----AAKSRERRSNQKLLFDCVNMALVETGQDALLR  880

Query  392  TIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
            T  +  A       S  +S D    VW  +++W   A    +++  D   + ER+V QE 
Sbjct  881  TYPWGKA--CFGARSEALSQDLGQEVWSHVRDWLYRAERLAANECGDAAMMLERIVHQEV  938

Query  221  VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             G GW +  R EA+ + K+I   LL E+V +AV  LA
Sbjct  939  EGGGWVKSTRSEADEMTKQIADGLLVELVGEAVADLA  975



>ref|XP_009411376.1| PREDICTED: uncharacterized protein LOC103993144 [Musa acuminata 
subsp. malaccensis]
Length=932

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 128/216 (59%), Gaps = 13/216 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+LSWDD+ + T +   S N   +  + +  ++++  F+Q LL  AGL+  +SD + 
Sbjct  719  SVARSLSWDDAHLGTLSPRPS-NLYKASSKADHTDQDYFVFVQNLLYFAGLE--KSDMIF  775

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID--TCHK  393
            + WHS DSPLDP+L DK++   E+    E +  ++ ST +L+FDCVN+AL ++   T   
Sbjct  776  TGWHSLDSPLDPMLLDKFLGWKEE----EPRCTEKSSTLRLLFDCVNSALEEVSWTTLTS  831

Query  392  TIAFSGAH--NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TERMVRQEA  222
               ++GA   + I  G+S   ++ VW  +++W+ S  G       D+N+L  +R +R+E 
Sbjct  832  LYLWNGASCGSRINAGASSTLSEAVWSLMRDWY-SGNGISVFAETDNNSLGVDRALRREV  890

Query  221  VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             G  W E +R+E E I  EI G++L+++V +A+  L
Sbjct  891  EGNKWVESIRIEVEEITGEISGEVLKDLVVEALADL  926



>gb|EAZ23822.1| hypothetical protein OsJ_07535 [Oryza sativa Japonica Group]
Length=931

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 118/216 (55%), Gaps = 23/216 (11%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTAT----SSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS  579
            +VA +LSWDD+  ++A        S  P V     +++E E    +Q ++S AGLD+ QS
Sbjct  724  AVACSLSWDDTTSESALPGTRGQSSFLPDV-----DDDESECHVLVQNIMSSAGLDDAQS  778

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--D  405
              L + WH PD PLDP+L +K + L           R++ S ++L+FDCVN AL++I  +
Sbjct  779  SMLFTGWHLPDCPLDPILFNKVLEL-----------REQSSYQRLLFDCVNVALVEIGEN  827

Query  404  TCHKTIAFSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQ  228
            T   T  +S AH+ T  D SS      VW  +K+W   A   +     +   + ER+V+Q
Sbjct  828  TLLSTFPWSKAHSRTWMDASSPALGIEVWSILKDWIYGARMFVVSRRDNAGIMIERVVKQ  887

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            E  G GW + +R +   I ++IEG + EE+V +AV+
Sbjct  888  EVEGTGWVKTMRTQLVDITEQIEGGVWEELVGEAVL  923



>ref|XP_006296647.1| hypothetical protein CARUB_v10015415mg [Capsella rubella]
 gb|EOA29545.1| hypothetical protein CARUB_v10015415mg [Capsella rubella]
Length=717

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 109/213 (51%), Gaps = 49/213 (23%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            GS+AR LSW+D S  DT  S+  +          EE+ +W  FI+TLL+ +G     SDS
Sbjct  551  GSIARVLSWEDESYTDTTNSTMGI----------EEDEDWYGFIKTLLTASGFS--GSDS  598

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHSPD PLDP LRDK  N   KE +   KRR++RS  KLVFDCVN  +       K
Sbjct  599  LMARWHSPDGPLDPSLRDKCAN---KELI---KRRKQRSNCKLVFDCVNDII-------K  645

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
                + A  ++  G  ++  + VW  +++W                      V  E VGK
Sbjct  646  VTTSTLARTSLTKGFDMM--EHVWTELQDW---------------------AVSDEIVGK  682

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W     +E  ++G EIE  LL+E+V++AV  L
Sbjct  683  VWSYSREMEMNNLGIEIEVILLQELVEEAVFDL  715



>ref|XP_010495916.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Camelina 
sativa]
Length=678

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 108/213 (51%), Gaps = 48/213 (23%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            GS+AR LSW+D S  DT   +  +          EE+ +W  FI+ +L  +G     S S
Sbjct  511  GSIARVLSWEDESHTDTTKPAMRI----------EEDEDWYGFIKAILIASGFS--GSGS  558

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHSPDSPLDP L+DK  N   KE +   KRR++RS RKLVFDCVN      D   +
Sbjct  559  LMARWHSPDSPLDPSLKDKIAN---KELI---KRRKQRSDRKLVFDCVN------DIITE  606

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
            T   + A   +  G  ++  D VW  +++W                       R E VGK
Sbjct  607  TTLLTLASTGLTKGFDMV--DHVWTELQDW---------------------ASRDEFVGK  643

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W    ++E  ++G EIE  LL+E+V++AV  L
Sbjct  644  MWSYRQQVEMNNLGAEIEVMLLQELVEEAVFDL  676



>ref|XP_010489077.1| PREDICTED: uncharacterized protein LOC104766813 [Camelina sativa]
Length=680

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 112/213 (53%), Gaps = 49/213 (23%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            GS+AR LSW+D S  DT   +  +          EE+ +W  FI+ LL  +G     SDS
Sbjct  514  GSIARVLSWEDESYTDTTKPAMGI----------EEDEDWYGFIKALLIASGFS--GSDS  561

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHSPDSPLDP L+DK  N   KE +   KRR++RS RKLVFDCVN  + +      
Sbjct  562  LMARWHSPDSPLDPSLKDKIAN---KELI---KRRKQRSNRKLVFDCVNDIIRETTL---  612

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
            T+A +G    +  G  ++  + VW  +++W  S                      E VGK
Sbjct  613  TLASTG----LTKGFDMV--EHVWTELQDWASS---------------------DEFVGK  645

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W+   ++E  ++G EIE  LL+E+V++AV  L
Sbjct  646  MWNYRQQVEMNNLGAEIEVMLLQELVEEAVFDL  678



>gb|EAY86700.1| hypothetical protein OsI_08082 [Oryza sativa Indica Group]
Length=931

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 25/217 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRT-----EEEEREWLFFIQTLLSMAGLDEVQ  582
            +VA +LSWDD      T+S S  P    Q +     +++E E    +Q ++S AGLD+ Q
Sbjct  724  AVACSLSWDD------TTSESTLPGTRGQSSFLPDVDDDESECHVLVQNIMSSAGLDDAQ  777

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--  408
            S  L + WH PD PLDP+L +K + L           R++ S ++L+FDCVN AL++I  
Sbjct  778  SSMLFTGWHLPDCPLDPILFNKVLEL-----------REQSSYQRLLFDCVNVALVEIGE  826

Query  407  DTCHKTIAFSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
            +T   T  +S AH+ T  D SS      VW  +K+W   A   +     +   + ER+V+
Sbjct  827  NTLLSTFPWSKAHSKTWMDASSPALGIEVWSILKDWIYGARMFVVSRRDNAGIMIERVVK  886

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            QE  G GW + +R +   I ++IEG + EE++ +AV+
Sbjct  887  QEVEGTGWVKTMRTQLVDITEQIEGGVWEELLGEAVL  923



>ref|NP_001047438.1| Os02g0617100 [Oryza sativa Japonica Group]
 dbj|BAD21441.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD21647.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09352.1| Os02g0617100 [Oryza sativa Japonica Group]
Length=164

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 94/167 (56%), Gaps = 14/167 (8%)
 Frame = -1

Query  611  LSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  432
            +S AGLD+ QS  L + WH PD PLDP+L +K + L           R++ S ++L+FDC
Sbjct  1    MSSAGLDDAQSSMLFTGWHLPDCPLDPILFNKVLEL-----------REQSSYQRLLFDC  49

Query  431  VNAALIDI--DTCHKTIAFSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  261
            VN AL++I  +T   T  +S AH+ T  D SS      VW  +K+W   A   +     +
Sbjct  50   VNVALVEIGENTLLSTFPWSKAHSRTWMDASSPALGIEVWSILKDWIYGARMFVVSRRDN  109

Query  260  DNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
               + ER+V+QE  G GW + +R +   I ++IEG + EE+V +AV+
Sbjct  110  AGIMIERVVKQEVEGTGWVKTMRTQLVDITEQIEGGVWEELVGEAVL  156



>gb|EMT13565.1| hypothetical protein F775_11179 [Aegilops tauschii]
Length=1048

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 104/204 (51%), Gaps = 7/204 (3%)
 Frame = -1

Query  716   SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPL  537
             SC DT + S      ++    E+ E E    +Q +LS AGLD +Q   + + WHS D PL
Sbjct  833   SCEDTYSHSPLHMHHLNSSNAEDNESECYALVQKILSSAGLDNLQVSMVFTGWHSADCPL  892

Query  536   DPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIP  357
             DP L DK+++  E+     AK R+RRS +KL+FDCVN AL++         +        
Sbjct  893   DPALCDKFLDRKEE----AAKSRERRSNQKLLFDCVNMALVETGQEALLRTYPWGKACFG  948

Query  356   DGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLE  186
               S  +S D    VW  +++W        +++  D   + ER+V QE  G GW +  R E
Sbjct  949   ARSEALSQDLGEEVWNHVRDWLYGVDRLAANEYGDAAMMLERIVHQEVEGGGWMKSARSE  1008

Query  185   AESIGKEIEGKLLEEIVQDAVVGL  114
             A+ I K+I   LL E+V +AV  L
Sbjct  1009  ADEITKQIADGLLVELVGEAVADL  1032



>ref|XP_002448137.1| hypothetical protein SORBIDRAFT_06g021940 [Sorghum bicolor]
 gb|EES12465.1| hypothetical protein SORBIDRAFT_06g021940 [Sorghum bicolor]
Length=940

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 121/220 (55%), Gaps = 19/220 (9%)
 Frame = -1

Query  746  SVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            S+ R+LSW+D S         +L P  SM   + +E E + F+Q ++S AGL +++   +
Sbjct  717  SITRSLSWEDMSSTSPLLDLTNLTPLSSM---DNDELECVAFVQKIVSSAGLGDLELGMV  773

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCH  396
             + W+ PD PLDP L DK ++  E+     AK R+RRS +KL+FD VN AL++I  DT  
Sbjct  774  FTGWYLPDCPLDPALCDKLLDRKEEA----AKSRERRSNQKLLFDYVNMALVEIGHDTLL  829

Query  395  KTIAFSGAHN-----TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                +  AH+     T+P        + V   +++W         ++  D  ++ ER+++
Sbjct  830  SAYPWRQAHSMAWKETLPQAL----VEEVPQHMRDWLYGLGKFAVNENDDAGSILERIMQ  885

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            QE  G+GW + +R E + I ++I GK+LEE+V++A   L 
Sbjct  886  QEVEGRGWVKSMRWELDEIMEQIAGKVLEELVEEATEDLG  925



>ref|XP_009382189.1| PREDICTED: uncharacterized protein LOC103970221 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=899

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 122/220 (55%), Gaps = 20/220 (9%)
 Frame = -1

Query  746  SVARTLSWDDSCVDT---ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVARTLSWDD+ ++      SS+     V++ + +  +++   F+Q LLS AGL+  +SD
Sbjct  687  SVARTLSWDDTRLEMRLPEPSSFK----VALSKADGADQDHFVFVQKLLSYAGLE--KSD  740

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID---  405
             + + WHSPDSPLDP+L DK + L E     E+K  ++  T +L+FDCVN+AL+++    
Sbjct  741  MMFTGWHSPDSPLDPVLLDKLLGLKED----ESKCMEKTPTLRLLFDCVNSALLEVSWST  796

Query  404  --TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
              + +     S         SS +S D VWG +++W       +  +    + + +R++R
Sbjct  797  LMSVYPWNRASCGAQINACASSALSED-VWGLVRDWSSGNRTVVFTENDIGSLVVDRVLR  855

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             EA G  W E  R+  E I KEI   +L+++V +A   LA
Sbjct  856  TEAGGNRWVELNRI-VEEIAKEITSDVLKDLVGEAFSDLA  894



>ref|XP_010416091.1| PREDICTED: uncharacterized protein LOC104701996 [Camelina sativa]
Length=674

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 111/212 (52%), Gaps = 49/212 (23%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+AR LSW+D     AT      P + +    EE+ +W  FI+ +L  +G     SDSL
Sbjct  510  GSIARVLSWEDESYTDAT-----KPAMGI----EEDEDWYGFIKAILIASGFS--GSDSL  558

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             +RWHSPDSPLDP L+DK  N   KE +   KRR++RS RKLVFDCVN  + +      T
Sbjct  559  MARWHSPDSPLDPSLKDKIAN---KELI---KRRKQRSNRKLVFDCVNDIITETTL---T  609

Query  389  IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKG  210
            +A +G    +  G  ++  + VW  +++W  S                      E  GK 
Sbjct  610  LASTG----LTKGFDMV--EHVWTELQDWASS---------------------DEFFGKM  642

Query  209  WHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            W +  ++E  ++G EIE  LL+E+V++AV  L
Sbjct  643  WSQ--QVEMNNLGAEIEVMLLQELVEEAVFDL  672



>ref|XP_009382176.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382177.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382178.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382179.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382180.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382181.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382182.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382183.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382184.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382185.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382186.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382187.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=925

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 122/220 (55%), Gaps = 20/220 (9%)
 Frame = -1

Query  746  SVARTLSWDDSCVDT---ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVARTLSWDD+ ++      SS+     V++ + +  +++   F+Q LLS AGL+  +SD
Sbjct  713  SVARTLSWDDTRLEMRLPEPSSFK----VALSKADGADQDHFVFVQKLLSYAGLE--KSD  766

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID---  405
             + + WHSPDSPLDP+L DK + L E E+    K  ++  T +L+FDCVN+AL+++    
Sbjct  767  MMFTGWHSPDSPLDPVLLDKLLGLKEDES----KCMEKTPTLRLLFDCVNSALLEVSWST  822

Query  404  --TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
              + +     S         SS +S D VWG +++W       +  +    + + +R++R
Sbjct  823  LMSVYPWNRASCGAQINACASSALSED-VWGLVRDWSSGNRTVVFTENDIGSLVVDRVLR  881

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             EA G  W E  R+  E I KEI   +L+++V +A   LA
Sbjct  882  TEAGGNRWVELNRI-VEEIAKEITSDVLKDLVGEAFSDLA  920



>ref|XP_006647519.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Oryza 
brachyantha]
Length=385

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 115/219 (53%), Gaps = 24/219 (11%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRT-----EEEEREWLFFIQTLLSMAGLDEVQ  582
            SVA +LSWDD      T+S S  P    Q +     ++EE E    +Q ++S AGLD+ Q
Sbjct  180  SVACSLSWDD------TTSESPLPRTRGQSSFLPDADDEESECHILVQNIMSSAGLDDAQ  233

Query  581  SDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--  408
            S  +   WH PD PLDP+L  K + L           R++ S ++L+FDCVN +L++I  
Sbjct  234  SSMIFIGWHLPDCPLDPVLFSKVLEL-----------REQSSYQRLLFDCVNVSLVEIGE  282

Query  407  DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQ  228
            +T   T  +S AH+    G++      VW  +K+W       + +   +   + +R+V+Q
Sbjct  283  NTLLSTFPWSKAHSRTWGGATSALGIEVWSILKDWIYGTRMFVVNRRDNAGIMMDRIVKQ  342

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            E  G GW + +  +   I ++IE  +L++++ +AV+  A
Sbjct  343  EVEGTGWVKMVTTQFVGITEQIEAGVLDDLMGEAVLDFA  381



>ref|XP_009382188.1| PREDICTED: uncharacterized protein LOC103970221 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=918

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 122/220 (55%), Gaps = 20/220 (9%)
 Frame = -1

Query  746  SVARTLSWDDSCVDT---ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            SVARTLSWDD+ ++      SS+     V++ + +  +++   F+Q LLS AGL+  +SD
Sbjct  706  SVARTLSWDDTRLEMRLPEPSSFK----VALSKADGADQDHFVFVQKLLSYAGLE--KSD  759

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID---  405
             + + WHSPDSPLDP+L DK + L E E+    K  ++  T +L+FDCVN+AL+++    
Sbjct  760  MMFTGWHSPDSPLDPVLLDKLLGLKEDES----KCMEKTPTLRLLFDCVNSALLEVSWST  815

Query  404  --TCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
              + +     S         SS +S D VWG +++W       +  +    + + +R++R
Sbjct  816  LMSVYPWNRASCGAQINACASSALSED-VWGLVRDWSSGNRTVVFTENDIGSLVVDRVLR  874

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             EA G  W E  R+  E I KEI   +L+++V +A   LA
Sbjct  875  TEAGGNRWVELNRI-VEEIAKEITSDVLKDLVGEAFSDLA  913



>dbj|BAK04299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=922

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 107/215 (50%), Gaps = 11/215 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SV R LSW+ +   +    + LN        E+ E E    +Q ++S AGL  +Q   + 
Sbjct  701  SVPRLLSWEGTYSHSPLHMHHLN----SSNAEDNESECYALVQKIVSSAGLGNLQVSMVF  756

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + WH  D PLDP L DK+++  E+     AK R+RRS +KL+FDCVN AL++        
Sbjct  757  TGWHLADCPLDPALCDKFLDRKEEA----AKSRERRSNQKLLFDCVNMALVETGQEALLR  812

Query  386  AFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             +          S  +S D    VW  +++W   A    +++  D   + ER+V QE   
Sbjct  813  TYPWGKACFGARSEALSQDLGEEVWSHVRDWLYGAERFAANEYGDAAMMLERIVHQEVEV  872

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             GW +  R EA+ I K+I   LLE+++ +A   LA
Sbjct  873  GGWMKSARSEADEITKQIADGLLEQLIGEAAADLA  907



>ref|XP_004953111.1| PREDICTED: uncharacterized protein LOC101762070 isoform X2 [Setaria 
italica]
Length=913

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 115/217 (53%), Gaps = 20/217 (9%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVS--MQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            +VAR +SWDDS    A+ S  L+ P +  M   +++E E    +Q ++S AGL   QS+ 
Sbjct  707  TVARFISWDDS----ASESRLLSTPRTSLMSDVDDDESECHVLVQNIMSSAGLGSSQSNM  762

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            + + WH PD PLDP+L +K   L EK            S R+L+FDCVN ALI+I     
Sbjct  763  VFTGWHLPDYPLDPVLCNKVSELQEKS-----------SYRRLLFDCVNIALIEIGENAL  811

Query  392  TIAFS--GAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
              AF     H+ T  + SS      VW  +K+W   A   +     +   + +R+V+QE 
Sbjct  812  LSAFPWRKRHSRTWRNTSSPDLGVEVWSILKDWIYGARMFVVSRRDNAGIMLDRIVKQEV  871

Query  221  VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             G+GW   + L+   I + +EG ++EE+V++AV+  A
Sbjct  872  EGRGWVNSMMLQVVGITEHLEGGVMEELVEEAVLDFA  908



>ref|XP_004953110.1| PREDICTED: uncharacterized protein LOC101762070 isoform X1 [Setaria 
italica]
Length=914

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 115/217 (53%), Gaps = 20/217 (9%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVS--MQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            +VAR +SWDDS    A+ S  L+ P +  M   +++E E    +Q ++S AGL   QS+ 
Sbjct  708  TVARFISWDDS----ASESRLLSTPRTSLMSDVDDDESECHVLVQNIMSSAGLGSSQSNM  763

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            + + WH PD PLDP+L +K   L EK            S R+L+FDCVN ALI+I     
Sbjct  764  VFTGWHLPDYPLDPVLCNKVSELQEKS-----------SYRRLLFDCVNIALIEIGENAL  812

Query  392  TIAFS--GAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
              AF     H+ T  + SS      VW  +K+W   A   +     +   + +R+V+QE 
Sbjct  813  LSAFPWRKRHSRTWRNTSSPDLGVEVWSILKDWIYGARMFVVSRRDNAGIMLDRIVKQEV  872

Query  221  VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             G+GW   + L+   I + +EG ++EE+V++AV+  A
Sbjct  873  EGRGWVNSMMLQVVGITEHLEGGVMEELVEEAVLDFA  909



>ref|XP_008796409.1| PREDICTED: uncharacterized protein LOC103711875 [Phoenix dactylifera]
Length=879

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 117/214 (55%), Gaps = 14/214 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            S+AR+LS++ S + T  +   L P   + R EEE+ E    +Q LLS AG  + +SD + 
Sbjct  668  SIARSLSFNCSKLGTMLAG-PLKPSRLLPRVEEEQ-ERFMLVQKLLSSAGFRDEKSDMIF  725

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            +RWHS DSPL+ +L DKY  L++KE    AK R  RS ++L+FDCVNAAL+DI       
Sbjct  726  TRWHSLDSPLNTMLLDKY--LDKKEAA--AKCRVWRSNQRLLFDCVNAALLDIGRTAILA  781

Query  386  AFS------GAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQE  225
            ++       GA    P G  +    +V   ++ W+      +       + + +R+V++E
Sbjct  782  SYPWAGACRGAWEDGPAGDLV--TQKVCELVRNWYSGEEKSVPGGPGGVSLMVDRVVKRE  839

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
              G+ W E + LE     K+I G +LEE+ ++A+
Sbjct  840  MAGREWAELMWLEIFEFSKDIGGLVLEELFEEAL  873



>ref|XP_004985732.1| PREDICTED: uncharacterized protein LOC101771093 isoform X2 [Setaria 
italica]
Length=829

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 115/218 (53%), Gaps = 17/218 (8%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+  + +         +   + +  E+E   F++ +L+  G    ++  +
Sbjct  621  GSIARTLSWDDASQEAS---------LCCTKGDSHEQEQYEFVEKILTSVGFCNEKAQDI  671

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHS D PLDP++ D+ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  672  FVRWHSLDCPLDPVVLDQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQRKLW  727

Query  389  IAF--SGAHNTIPDGSS--IISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
             A+  +  ++  P  ++  ++  D  W  +K W       ++  G +     + +V +E 
Sbjct  728  GAYPCTARYSNAPRVATCDVLVTDEAWRLVKSWLFDDENDIAGLGDNAGLAADWVVDKEI  787

Query  221  VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             GKGW E LR E + I KEI G +L E+V +A   LAD
Sbjct  788  HGKGWSEMLRSEVDEISKEICGDVLSELVGEAFSELAD  825



>ref|XP_004985731.1| PREDICTED: uncharacterized protein LOC101771093 isoform X1 [Setaria 
italica]
Length=884

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 115/218 (53%), Gaps = 17/218 (8%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+  + +         +   + +  E+E   F++ +L+  G    ++  +
Sbjct  676  GSIARTLSWDDASQEAS---------LCCTKGDSHEQEQYEFVEKILTSVGFCNEKAQDI  726

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHS D PLDP++ D+ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  727  FVRWHSLDCPLDPVVLDQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQRKLW  782

Query  389  IAF--SGAHNTIPDGSS--IISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEA  222
             A+  +  ++  P  ++  ++  D  W  +K W       ++  G +     + +V +E 
Sbjct  783  GAYPCTARYSNAPRVATCDVLVTDEAWRLVKSWLFDDENDIAGLGDNAGLAADWVVDKEI  842

Query  221  VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             GKGW E LR E + I KEI G +L E+V +A   LAD
Sbjct  843  HGKGWSEMLRSEVDEISKEICGDVLSELVGEAFSELAD  880



>ref|XP_006649387.1| PREDICTED: uncharacterized protein LOC102700033 [Oryza brachyantha]
Length=952

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 115/227 (51%), Gaps = 34/227 (15%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+AR LSWDDS  +    S          + +  E++   FI+ ++S AG    +  ++
Sbjct  743  GSIARALSWDDSSQEATLCS---------TKGDSHEQDQYEFIEKIISSAGFGNEKISNI  793

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHS D PL   + D+++    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  794  FVRWHSHDFPLGATVLDQFL----EHKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKLW  849

Query  389  IAFSGAHNTIPDGSSIIS-----ADRVWGRIKEWFPSAAGCLSDDG--------VDDNNL  249
             A+      + +   + +     AD VW  +K W       LSDDG        VD+  L
Sbjct  850  GAYPCTDRHVNNAQRVATGDMLVADEVWRLVKGW-------LSDDGGDKYMVNVVDNAGL  902

Query  248  TER-MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
                +V +E  G+ W E LRLE + I KEI G++L+E+V +A   LA
Sbjct  903  VADWVVSKEIQGRSWPEALRLEVDEISKEICGEVLDELVGEAFSELA  949



>ref|XP_002454174.1| hypothetical protein SORBIDRAFT_04g026030 [Sorghum bicolor]
 gb|EES07150.1| hypothetical protein SORBIDRAFT_04g026030 [Sorghum bicolor]
Length=919

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 115/216 (53%), Gaps = 23/216 (11%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVS--MQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            +V R LSWDD+   T+ S    NP +S  +   +++E E    +Q ++S AGL   QS  
Sbjct  707  TVTRFLSWDDT---TSESQSPCNPRLSSRLPDVDDDESECHVLVQNIMSSAGLGTSQSCM  763

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTC  399
            + + WH PD PLDP+L +K   L EK            S R+L+FDCVN ALI+I  +T 
Sbjct  764  VFTGWHLPDHPLDPVLCNKLSELQEKS-----------SYRRLLFDCVNVALIEIGENTL  812

Query  398  HKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQ  228
                 +S  H+    G+S  S D    VW  +K+W   A   +     +   + +R+V+Q
Sbjct  813  LSAFPWSKRHSRTWRGTS--SPDLGVEVWSILKDWIYGARMFVVSKRDNAGIILDRIVKQ  870

Query  227  EAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            E   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  871  EVEARGWVKLMMAQVVDITEELEGGVMEELVEEAVL  906



>gb|EMS67579.1| hypothetical protein TRIUR3_06787 [Triticum urartu]
Length=1015

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 110/215 (51%), Gaps = 18/215 (8%)
 Frame = -1

Query  746   SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
             +VA +LSWDD    T + S  L  P      +++E E    +Q ++S +GL++ QS  + 
Sbjct  815   AVACSLSWDD----TTSESPLLRRPYLPSDVDDDESECHVLVQNIMSSSGLEDAQSSIVF  870

Query  566   SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
             + WH PD PLDP+L +K + L           R++RS ++L+FDCVN ALI+I       
Sbjct  871   AGWHLPDCPLDPVLCNKLLEL-----------REQRSYKRLLFDCVNVALIEIGENALLS  919

Query  386   AF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             AF        T  D SS      VW  +K+W   A   +     +   + +R+V+QE  G
Sbjct  920   AFPWSKARTGTWRDSSSPALGVEVWSILKDWIYGARMFMVSKRDNTGIMMDRIVKQEVEG  979

Query  215   KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
              GW +    +   I ++IE  +LEE+V +AV+  A
Sbjct  980   SGWVKMRMSQVVDIAEQIEWGVLEELVAEAVLDFA  1014



>tpg|DAA37015.1| TPA: hypothetical protein ZEAMMB73_770868 [Zea mays]
Length=214

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 113/197 (57%), Gaps = 10/197 (5%)
 Frame = -1

Query  692  SYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKY  513
            S +L P   +   +++E E + F+Q ++S AGL +++ D + + W+ PD P+DP L DK 
Sbjct  10   STNLTP---ISSVDDDELECVAFVQKIVSSAGLGDLRLDMVFTGWYLPDCPVDPALCDKL  66

Query  512  INLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHKTIAFSGAHNTIPDGS-SI  342
            ++  E+     AK R+RRS +KL+FD VN A+++I  DT      +  A +   + + S 
Sbjct  67   LDRKEEA----AKSRERRSNQKLLFDYVNMAVVEIGHDTLLCAYPWRQACSMAWEETLSQ  122

Query  341  ISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEI  162
              A+ V   +++W   +     ++  +   L ER++RQE  G+GW + +R E + I ++I
Sbjct  123  ALAEEVPHHMRDWLHGSGKFAGNENDNAGTLLERVMRQEVEGRGWVKSMRWELDEITEQI  182

Query  161  EGKLLEEIVQDAVVGLA  111
             G +L+EIV +A+ GL 
Sbjct  183  AGNVLDEIVVEALDGLG  199



>ref|NP_001053260.1| Os04g0506900 [Oryza sativa Japonica Group]
 dbj|BAF15174.1| Os04g0506900 [Oryza sativa Japonica Group]
Length=881

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 120/215 (56%), Gaps = 7/215 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +Q   + 
Sbjct  656  SVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHLQLSMVF  715

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I  DT   
Sbjct  716  TGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIGQDTLLC  771

Query  392  TIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            +  +S A   T  +  S    + VW  + +W        ++   +   + ER++++E  G
Sbjct  772  SYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIMQEEVEG  831

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  832  KGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  866



>gb|EEC77598.1| hypothetical protein OsI_16564 [Oryza sativa Indica Group]
Length=939

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 120/215 (56%), Gaps = 7/215 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +Q   + 
Sbjct  714  SVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHLQLSMVF  773

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I  DT   
Sbjct  774  TGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIGQDTLLC  829

Query  392  TIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            +  +S A   T  +  S    + VW  + +W        ++   +   + ER++++E  G
Sbjct  830  SYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIMQEEVEG  889

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  890  KGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  924



>ref|XP_010556872.1| PREDICTED: uncharacterized protein LOC104826058 [Tarenaya hassleriana]
Length=937

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 109/203 (54%), Gaps = 19/203 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVD-TATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD--EVQS  579
            GS +RTLS DDS  + T  + YS    VS Q TE+ E +W   + TLLS A LD  E  S
Sbjct  720  GSFSRTLSRDDSRAEPTMATRYSSKRFVSSQDTEDVEEDWRLLVNTLLSTANLDGDESLS  779

Query  578  DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTC  399
            ++  S+WHS  SPLDP LR+KY   ++ ETV+EAKR++  S+RKLVFD VN+ L+   T 
Sbjct  780  ENHLSKWHSLQSPLDPSLRNKYTKTDDSETVNEAKRQRLSSSRKLVFDLVNSFLLSELT-  838

Query  398  HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD-DNNLTERMV----  234
              T  F     T   G S+    R+W  ++EWF         D  D D +L+   V    
Sbjct  839  --TTGFGRGKETAL-GDSV----RIW--MQEWFSGRRKVNCGDEEDGDGDLSSLAVDRAA  889

Query  233  -RQEAVGKGWHEYLRLEAESIGK  168
              + A   GW E  R E + +G+
Sbjct  890  RAEAAEEGGWPENKRREVDGVGE  912



>emb|CAE04715.1| OSJNBa0043L24.3 [Oryza sativa Japonica Group]
 emb|CAE05684.1| OSJNBb0002J11.11 [Oryza sativa Japonica Group]
Length=875

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 120/215 (56%), Gaps = 7/215 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +Q   + 
Sbjct  650  SVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHLQLSMVF  709

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I  DT   
Sbjct  710  TGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIGQDTLLC  765

Query  392  TIAFSGAH-NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            +  +S A   T  +  S    + VW  + +W        ++   +   + ER++++E  G
Sbjct  766  SYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIMQEEVEG  825

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  826  KGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  860



>gb|EEE61300.1| hypothetical protein OsJ_15391 [Oryza sativa Japonica Group]
Length=939

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 120/215 (56%), Gaps = 7/215 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +Q   + 
Sbjct  714  SVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHLQLSMVF  773

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I  DT   
Sbjct  774  TGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIGQDTLLC  829

Query  392  TIAFSGAH-NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            +  +S A   T  +  S    + VW  + +W        ++   +   + ER++++E  G
Sbjct  830  SYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIMQEEVEG  889

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  890  KGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  924



>emb|CAH67333.1| OSIGBa0157A06.2 [Oryza sativa Indica Group]
Length=938

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 120/215 (56%), Gaps = 7/215 (3%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +Q   + 
Sbjct  713  SVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHLQLSMVF  772

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I  DT   
Sbjct  773  TGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIGQDTLLC  828

Query  392  TIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            +  +S A   T  +  S    + VW  + +W        ++   +   + ER++++E  G
Sbjct  829  SYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIMQEEVEG  888

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            KGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  889  KGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  923



>ref|XP_010911761.1| PREDICTED: uncharacterized protein LOC105037843 [Elaeis guineensis]
Length=157

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -1

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTC  399
            + +RWHS +SPL+P+L DKY++  E+E    AK R+RRS ++L FDCVNAAL+++     
Sbjct  2    IFTRWHSLESPLNPMLLDKYLDRKEEE----AKCRERRSNQRLPFDCVNAALLNVGQSAI  57

Query  398  HKTIAFSGA-HNTIPDGSSIISA-DRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQE  225
              +  ++GA      DG++  S  + V   ++ W+         +    N + +R+V++E
Sbjct  58   LASYPWAGACSGAWMDGTACASVTEEVCELVRNWYSGEEKSPPSEPRSINPVVDRVVKRE  117

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
              G+GW E++ LE     +E+ G +LEE+V++A+
Sbjct  118  IAGRGWAEFMWLEMYEFSQEVGGLVLEELVEEAL  151



>gb|EMT10669.1| hypothetical protein F775_15662 [Aegilops tauschii]
Length=886

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 109/212 (51%), Gaps = 18/212 (8%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            +VA +LSWDD    T + S SL  P      +++E E    +Q ++S + L++ QS  + 
Sbjct  686  AVACSLSWDD----TTSESPSLRRPYLPSDIDDDESECHVLVQNIMSSSRLEDAQSSMVF  741

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + WH PD PLDP+L +K + L           R++RS ++L+FDCVN ALI+I       
Sbjct  742  AGWHLPDCPLDPVLCNKLLEL-----------REQRSYKRLLFDCVNVALIEIGENALLS  790

Query  386  AF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            AF        T  D SS      VW  +K+W   A   +     +   + +R+V+QE  G
Sbjct  791  AFPWSKACTGTWRDSSSPALGVEVWSILKDWIYGARMFMVSKRDNTGIMMDRIVKQEVEG  850

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
             GW +    +   I ++IE  +LEE+V ++V+
Sbjct  851  GGWVKMRMSQVVDIMEQIEKGVLEELVAESVL  882



>ref|XP_006651030.1| PREDICTED: uncharacterized protein LOC102706550 [Oryza brachyantha]
Length=915

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 112/220 (51%), Gaps = 20/220 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDS  +    S          + +  E++   FI+ ++S AG    +  ++
Sbjct  706  GSIARTLSWDDSSQEATLCS---------AKGDSCEQDQYEFIEKIISSAGFGNEKISNI  756

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHS D PL   + D+++    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  757  FVRWHSHDFPLGATVLDQFL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKLW  812

Query  389  IAFSGAHNTIPDGSSIIS-----ADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             A+      + +   + +     AD VW  +K W    AG      V DN   + + +V 
Sbjct  813  GAYPCMERHVNNAQRVATCHMLVADEVWRLVKGWLSDDAGNKYMVNVVDNAGLVADWVVD  872

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            +E  G+ W E LRLE + I KEI   +L+E+V +A   LA
Sbjct  873  KEIQGRSWPEALRLEVDEISKEICRDVLDELVGEAFSELA  912



>ref|XP_010240106.1| PREDICTED: uncharacterized protein LOC100830890 isoform X3 [Brachypodium 
distachyon]
Length=898

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 109/215 (51%), Gaps = 11/215 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+L W+D    T + S  L         +++E E   F++ +LS +GLD +Q   + 
Sbjct  677  SVARSLPWED----TNSRSALLGSLNFSNADDDDELECHAFVEKILSSSGLDNLQLTMVF  732

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + W+ PD PLDP L    ++ NE+     AK R+ RS RKL+FDCVN AL++        
Sbjct  733  TGWYLPDCPLDPELCHMLLDHNEEA----AKSRECRSNRKLLFDCVNMALVEAGQDALLS  788

Query  386  AFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             +  +   +      +S D    VW  +K W   A   +++   D   + ER+V+QE  G
Sbjct  789  TYPWSKTCLGAWKEKLSQDLREEVWSHVKGWLYGAEMLVANKDGDTARMLERVVQQEVEG  848

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             GW +  R   + + K I   LLE++V +AV  LA
Sbjct  849  GGWMKSGRSGVDEVAKLIASCLLEDLVGEAVADLA  883



>gb|AFW72333.1| hypothetical protein ZEAMMB73_984204 [Zea mays]
Length=918

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 116/217 (53%), Gaps = 25/217 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSL-NPPVS--MQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            +VAR LS DD    TA+ S SL NP  S  +   +++E E    +Q ++S AGL   QS 
Sbjct  706  TVARFLSLDD----TASESQSLCNPRPSSLLPDADDDESECHVLVQNIMSSAGLGTSQSR  761

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DT  402
             + + WH PD PLDP+LR+K   L EK            S R+L+FDCVN ALI+I  + 
Sbjct  762  MVFAGWHLPDHPLDPVLRNKVSQLQEKS-----------SYRRLLFDCVNVALIEIGENA  810

Query  401  CHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                + +S   +    G+S  S D    VW  +K+W   A   +     +   + +R+V+
Sbjct  811  LLSALPWSKRSSRTWRGTS--SPDLGVEVWSILKDWIHGARMFVVSKRDNAGIILDRIVK  868

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  869  QEVEARGWVKLMMAQVVVITEELEGGVMEELVEEAVL  905



>ref|XP_010240105.1| PREDICTED: uncharacterized protein LOC100830890 isoform X2 [Brachypodium 
distachyon]
Length=914

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 109/215 (51%), Gaps = 11/215 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+L W+D    T + S  L         +++E E   F++ +LS +GLD +Q   + 
Sbjct  693  SVARSLPWED----TNSRSALLGSLNFSNADDDDELECHAFVEKILSSSGLDNLQLTMVF  748

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + W+ PD PLDP L    ++ NE+     AK R+ RS RKL+FDCVN AL++        
Sbjct  749  TGWYLPDCPLDPELCHMLLDHNEEA----AKSRECRSNRKLLFDCVNMALVEAGQDALLS  804

Query  386  AFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             +  +   +      +S D    VW  +K W   A   +++   D   + ER+V+QE  G
Sbjct  805  TYPWSKTCLGAWKEKLSQDLREEVWSHVKGWLYGAEMLVANKDGDTARMLERVVQQEVEG  864

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             GW +  R   + + K I   LLE++V +AV  LA
Sbjct  865  GGWMKSGRSGVDEVAKLIASCLLEDLVGEAVADLA  899



>ref|XP_008643431.1| PREDICTED: uncharacterized protein LOC100278954 isoform X1 [Zea 
mays]
Length=885

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 116/217 (53%), Gaps = 25/217 (12%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSL-NPPVS--MQRTEEEEREWLFFIQTLLSMAGLDEVQSD  576
            +VAR LS DD    TA+ S SL NP  S  +   +++E E    +Q ++S AGL   QS 
Sbjct  673  TVARFLSLDD----TASESQSLCNPRPSSLLPDADDDESECHVLVQNIMSSAGLGTSQSR  728

Query  575  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DT  402
             + + WH PD PLDP+LR+K   L EK            S R+L+FDCVN ALI+I  + 
Sbjct  729  MVFAGWHLPDHPLDPVLRNKVSQLQEKS-----------SYRRLLFDCVNVALIEIGENA  777

Query  401  CHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVR  231
                + +S   +    G+S  S D    VW  +K+W   A   +     +   + +R+V+
Sbjct  778  LLSALPWSKRSSRTWRGTS--SPDLGVEVWSILKDWIHGARMFVVSKRDNAGIILDRIVK  835

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
            QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  836  QEVEARGWVKLMMAQVVVITEELEGGVMEELVEEAVL  872



>ref|XP_010240102.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010240103.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010240104.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
Length=915

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 109/215 (51%), Gaps = 11/215 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+L W+D    T + S  L         +++E E   F++ +LS +GLD +Q   + 
Sbjct  694  SVARSLPWED----TNSRSALLGSLNFSNADDDDELECHAFVEKILSSSGLDNLQLTMVF  749

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + W+ PD PLDP L    ++ NE+     AK R+ RS RKL+FDCVN AL++        
Sbjct  750  TGWYLPDCPLDPELCHMLLDHNEEA----AKSRECRSNRKLLFDCVNMALVEAGQDALLS  805

Query  386  AFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             +  +   +      +S D    VW  +K W   A   +++   D   + ER+V+QE  G
Sbjct  806  TYPWSKTCLGAWKEKLSQDLREEVWSHVKGWLYGAEMLVANKDGDTARMLERVVQQEVEG  865

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             GW +  R   + + K I   LLE++V +AV  LA
Sbjct  866  GGWMKSGRSGVDEVAKLIASCLLEDLVGEAVADLA  900



>ref|NP_001140716.1| uncharacterized protein LOC100272791 [Zea mays]
 gb|ACF84447.1| unknown [Zea mays]
Length=547

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 114/228 (50%), Gaps = 33/228 (14%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+       S    P    +     E+E   F++  L+ AG    ++  +
Sbjct  332  GSIARTLSWDDA-------SQEAPPQCCTKGDNSHEQEQHEFVEKTLASAGFCNEKTQDI  384

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT----  402
             +RWHS D PLDP + ++ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  385  FARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKVW  440

Query  401  --CHKTIA--FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDD-----GVDDNN-  252
               +   A  +S A         ++  D  W  ++ W       L DD     G+ DN  
Sbjct  441  GGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSW-------LFDDENDIAGLGDNAG  493

Query  251  -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
               + +V +E  GKGW E LR+E + + +EI G++L E+V +A   LA
Sbjct  494  LAADWVVGREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAFSELA  541



>ref|XP_008666987.1| PREDICTED: uncharacterized protein LOC100272791 isoform X3 [Zea 
mays]
Length=876

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 112/221 (51%), Gaps = 19/221 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+       S    P  S +     E+E   F++  L+ AG    ++  +
Sbjct  661  GSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQEQHEFVEKTLASAGFCNEKTQDI  713

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT----  402
             +RWHS D PLDP + ++ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  714  FARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKVW  769

Query  401  --CHKTIA--FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  234
               +   A  +S A         ++  D  W  ++ W       ++  G +     + +V
Sbjct  770  GGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSWLFDDENDIAGLGDNAGLAADWVV  829

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E  GKGW E LR+E + + +EI G++L E+V +A   LA
Sbjct  830  GREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAFSELA  870



>gb|ACN35840.1| unknown [Zea mays]
 tpg|DAA43322.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
Length=892

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 112/221 (51%), Gaps = 19/221 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+       S    P  S +     E+E   F++  L+ AG    ++  +
Sbjct  677  GSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQEQHEFVEKTLASAGFCNEKTQDI  729

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT----  402
             +RWHS D PLDP + ++ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  730  FARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKVW  785

Query  401  --CHKTIA--FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  234
               +   A  +S A         ++  D  W  ++ W       ++  G +     + +V
Sbjct  786  GGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSWLFDDENDIAGLGDNAGLAADWVV  845

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E  GKGW E LR+E + + +EI G++L E+V +A   LA
Sbjct  846  GREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAFSELA  886



>ref|XP_008666979.1| PREDICTED: uncharacterized protein LOC100272791 isoform X2 [Zea 
mays]
 ref|XP_008666982.1| PREDICTED: uncharacterized protein LOC100272791 isoform X2 [Zea 
mays]
 ref|XP_008666985.1| PREDICTED: uncharacterized protein LOC100272791 isoform X2 [Zea 
mays]
 tpg|DAA43324.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
 tpg|DAA43325.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
 tpg|DAA43326.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
Length=893

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 112/221 (51%), Gaps = 19/221 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+       S    P  S +     E+E   F++  L+ AG    ++  +
Sbjct  678  GSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQEQHEFVEKTLASAGFCNEKTQDI  730

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT----  402
             +RWHS D PLDP + ++ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  731  FARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKVW  786

Query  401  --CHKTIA--FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  234
               +   A  +S A         ++  D  W  ++ W       ++  G +     + +V
Sbjct  787  GGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSWLFDDENDIAGLGDNAGLAADWVV  846

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E  GKGW E LR+E + + +EI G++L E+V +A   LA
Sbjct  847  GREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAFSELA  887



>ref|XP_008666975.1| PREDICTED: uncharacterized protein LOC100272791 isoform X1 [Zea 
mays]
 ref|XP_008666976.1| PREDICTED: uncharacterized protein LOC100272791 isoform X1 [Zea 
mays]
 ref|XP_008666977.1| PREDICTED: uncharacterized protein LOC100272791 isoform X1 [Zea 
mays]
 tpg|DAA43323.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
Length=899

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 112/221 (51%), Gaps = 19/221 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDD+       S    P  S +     E+E   F++  L+ AG    ++  +
Sbjct  684  GSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQEQHEFVEKTLASAGFCNEKTQDI  736

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT----  402
             +RWHS D PLDP + ++ +    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  737  FARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKVW  792

Query  401  --CHKTIA--FSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  234
               +   A  +S A         ++  D  W  ++ W       ++  G +     + +V
Sbjct  793  GGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSWLFDDENDIAGLGDNAGLAADWVV  852

Query  233  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
             +E  GKGW E LR+E + + +EI G++L E+V +A   LA
Sbjct  853  GREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAFSELA  893



>ref|NP_001048940.1| Os03g0143700 [Oryza sativa Japonica Group]
 gb|ABF93931.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10854.1| Os03g0143700 [Oryza sativa Japonica Group]
 gb|EEE62228.1| hypothetical protein OsJ_17015 [Oryza sativa Japonica Group]
Length=901

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 110/219 (50%), Gaps = 20/219 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDS  +    S          + +  E++   F++ +LS  G D  ++  +
Sbjct  692  GSIARTLSWDDSSQEATLCS---------AKGDSHEQDQHEFVEKILSSVGFDNEKTSDI  742

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHS D PL   + D+++    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  743  FVRWHSHDFPLGTGVLDQFL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKLW  798

Query  389  IAFSGAHNTIPDG-----SSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             A+      + +        ++  D VW  +K W     G       +DN   + + +V 
Sbjct  799  GAYPCTDPQVNNARRVATGEVLVVDEVWRLVKGWLSDDDGEKHMVNAEDNAGLVADWVVG  858

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E  G+ W E LRLE + I  EI G++L+E+V +A   L
Sbjct  859  KEIQGRSWPEALRLEVDEISTEICGEVLDELVGEAFSEL  897



>ref|XP_009410914.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410921.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410929.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410937.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410945.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410954.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=938

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 105/202 (52%), Gaps = 14/202 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SV R+LS   SC D A S+   N    M    E E E L F+  L++ AG+D  +S    
Sbjct  731  SVVRSLSRSTSCSDAA-SAKPFNS-CMMFSEAEREHEQLVFVHELMASAGMDSRESVVFG  788

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
              WHS DSPL+PLL  +Y++++E+E     K R+RRS R+L+FD VNAAL+D+       
Sbjct  789  G-WHSIDSPLNPLLLYEYLHVDEEE----GKCRERRSGRRLLFDAVNAALLDLSQAALRA  843

Query  386  AF--SGAHNTIPDGSSI--ISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAV  219
            A+  +G  +       +   +AD+VW  ++    S     ++     +   ER+VR+E  
Sbjct  844  AYPWNGPRHDARKNDKVGGSAADQVWAFVRNVLSSEKRVPTESA---SAAVERLVRKEVA  900

Query  218  GKGWHEYLRLEAESIGKEIEGK  153
            G+ W E   LE     KEI GK
Sbjct  901  GRQWAESSWLEVCEFSKEIGGK  922



>ref|XP_009410963.1| PREDICTED: uncharacterized protein LOC103992789 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=932

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 105/202 (52%), Gaps = 14/202 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SV R+LS   SC D A S+   N    M    E E E L F+  L++ AG+D  +S    
Sbjct  725  SVVRSLSRSTSCSDAA-SAKPFNS-CMMFSEAEREHEQLVFVHELMASAGMDSRESVVFG  782

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
              WHS DSPL+PLL  +Y++++E+E     K R+RRS R+L+FD VNAAL+D+       
Sbjct  783  G-WHSIDSPLNPLLLYEYLHVDEEE----GKCRERRSGRRLLFDAVNAALLDLSQAALRA  837

Query  386  AF--SGAHNTIPDGSSI--ISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAV  219
            A+  +G  +       +   +AD+VW  ++    S     ++     +   ER+VR+E  
Sbjct  838  AYPWNGPRHDARKNDKVGGSAADQVWAFVRNVLSSEKRVPTESA---SAAVERLVRKEVA  894

Query  218  GKGWHEYLRLEAESIGKEIEGK  153
            G+ W E   LE     KEI GK
Sbjct  895  GRQWAESSWLEVCEFSKEIGGK  916



>gb|EAY88501.1| hypothetical protein OsI_09972 [Oryza sativa Indica Group]
Length=883

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 110/219 (50%), Gaps = 20/219 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ARTLSWDDS  +    S          + +  E++   F++ +LS  G +  ++  +
Sbjct  674  GSIARTLSWDDSSQEATLCS---------AKGDSHEQDQHEFVEKILSSVGFNNEKTSDI  724

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              RWHS D PL   + D+++    +  V +AK R+RRS ++L+ D VNAAL+DI      
Sbjct  725  FVRWHSHDFPLGTGVLDQFL----ERKVEDAKCRERRSNQRLLIDSVNAALLDIGQSKLW  780

Query  389  IAFSGAHNTIPDG-----SSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--LTERMVR  231
             A+      + +        ++  D VW  +K W     G       +DN   + + +V 
Sbjct  781  GAYPCTDPQVNNARRVATGEVLVVDEVWRLVKGWLSDDDGEKHMVNAEDNAGLVADWVVG  840

Query  230  QEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
            +E  G+ W E LRLE + I  EI G++L+E+V +A   L
Sbjct  841  KEIQGRSWPEALRLEVDEISTEICGEVLDELVGEAFSEL  879



>gb|AAO37163.1| hypothetical protein [Arabidopsis thaliana]
Length=713

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 111/213 (52%), Gaps = 49/213 (23%)
 Frame = -1

Query  749  GSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
            G++AR L+W+D S  DT+  +  +          EE+ +W  FI+TLL+ +G     SDS
Sbjct  548  GTIARILAWEDESYTDTSKPAMGI----------EEDEDWYGFIKTLLTASGFS--GSDS  595

Query  572  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
            L +RWHS +SPLDP LRDK+ N   KE +      ++RS RKLVFD VNA + +  +   
Sbjct  596  LMTRWHSLESPLDPSLRDKFAN---KELIKRR---KQRSXRKLVFDXVNAIITETTS---  646

Query  392  TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGK  213
                + AH  +  G +++  + VW  ++EW                      V  E  GK
Sbjct  647  ----TLAHTGLTKGFNML--EHVWTELQEW---------------------AVNDEVAGK  679

Query  212  GWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  114
             W   L++E  ++G EIE  LL+E+V++AV  L
Sbjct  680  MWSYGLQVEMNNLGIEIEVILLQELVEEAVFDL  712



>ref|NP_001145529.1| uncharacterized protein LOC100278954 [Zea mays]
 gb|ACG48238.1| hypothetical protein [Zea mays]
Length=169

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 90/169 (53%), Gaps = 18/169 (11%)
 Frame = -1

Query  611  LSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  432
            +S AGL   QS  + + WH PD PLDP+LR+K   L EK            S R+L+FDC
Sbjct  1    MSSAGLGTSQSRMVFAGWHLPDHPLDPVLRNKVSQLQEKS-----------SYRRLLFDC  49

Query  431  VNAALIDI--DTCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDG  267
            VN ALI+I  +     + +S   +    G+S  S D    VW  +K+W   A   +    
Sbjct  50   VNVALIEIGENALLSALPWSKRSSRTWRGTS--SPDLGVEVWSILKDWIHGARMFVVSKR  107

Query  266  VDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  120
             +   + +R+V+QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  108  DNAGIILDRIVKQEVEARGWVKLMMAQVVVITEELEGGVMEELVEEAVL  156



>ref|XP_006652490.1| PREDICTED: uncharacterized protein LOC102722484 isoform X2 [Oryza 
brachyantha]
Length=979

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 111/211 (53%), Gaps = 12/211 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            S AR+LSW+D+      S  SL   +     + +E +    +Q ++S AGL  +Q   + 
Sbjct  756  SFARSLSWEDT-----NSCSSLLGCLKHSNDDYDELQCYSLVQEIVSSAGLGHLQLSIVF  810

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + W+ PDSP+DP L DK+++  E+     AK R+RRS +KL+FD V+ AL++I       
Sbjct  811  TGWYLPDSPIDPALCDKFLDRKEE----NAKSRERRSNQKLIFDSVSTALVEIGQDALLC  866

Query  386  AFSGAHNTIPDGSSIIS---ADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             +  +   +      +S    + VW  + +W       +++   D     ER++++E  G
Sbjct  867  TYPWSRECLGTWREKLSRTLGEEVWNIVSDWLYGDGSFVANMEDDAGTTLERIMQEEVEG  926

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            KGW + L ++ + I ++I  ++L+++V D V
Sbjct  927  KGWIKLLTMDTDEITEQIACEVLDDLVTDTV  957



>ref|XP_006652489.1| PREDICTED: uncharacterized protein LOC102722484 isoform X1 [Oryza 
brachyantha]
Length=980

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 111/211 (53%), Gaps = 12/211 (6%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            S AR+LSW+D+      S  SL   +     + +E +    +Q ++S AGL  +Q   + 
Sbjct  757  SFARSLSWEDT-----NSCSSLLGCLKHSNDDYDELQCYSLVQEIVSSAGLGHLQLSIVF  811

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + W+ PDSP+DP L DK+++  E+     AK R+RRS +KL+FD V+ AL++I       
Sbjct  812  TGWYLPDSPIDPALCDKFLDRKEE----NAKSRERRSNQKLIFDSVSTALVEIGQDALLC  867

Query  386  AFSGAHNTIPDGSSIIS---ADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
             +  +   +      +S    + VW  + +W       +++   D     ER++++E  G
Sbjct  868  TYPWSRECLGTWREKLSRTLGEEVWNIVSDWLYGDGSFVANMEDDAGTTLERIMQEEVEG  927

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            KGW + L ++ + I ++I  ++L+++V D V
Sbjct  928  KGWIKLLTMDTDEITEQIACEVLDDLVTDTV  958



>ref|XP_009418989.1| PREDICTED: uncharacterized protein LOC103998847 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=900

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 120/218 (55%), Gaps = 19/218 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVAR+LSW  S +D  TS+ +L P V   + +EE  +++F +  L+S  G+D+ +S ++
Sbjct  695  GSVARSLSWSSSYLDI-TSATTLKPSVKFSKADEEHEQFVF-VNKLISSVGMDDNKS-TI  751

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
               WHS DSPL+P L  + + + ++E     K R+R+S  +L+FD VNAAL+DI      
Sbjct  752  FGGWHSLDSPLNPSLLYESLQIEDEED----KCRERQSHWRLLFDFVNAALLDISQSILL  807

Query  389  IAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTE--RMVRQE  225
             A    +  H    D ++  S   VW  ++         LS D    N   E  R+V++E
Sbjct  808  TACPWKTACHGPRRDDTAGTSVAEVWSLVR-------NTLSGDTKSGNGGIEVDRLVKEE  860

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
              G+ W E   LE   + KEI  K+LEE+V++AV GL+
Sbjct  861  VGGRQWTESRWLEGYELSKEISEKVLEELVEEAVSGLS  898



>ref|XP_009418765.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418843.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418912.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=922

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 120/218 (55%), Gaps = 19/218 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVAR+LSW  S +D  TS+ +L P V   + +EE  +++F +  L+S  G+D+ +S ++
Sbjct  717  GSVARSLSWSSSYLDI-TSATTLKPSVKFSKADEEHEQFVF-VNKLISSVGMDDNKS-TI  773

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
               WHS DSPL+P L  + + + ++E     K R+R+S  +L+FD VNAAL+DI      
Sbjct  774  FGGWHSLDSPLNPSLLYESLQIEDEED----KCRERQSHWRLLFDFVNAALLDISQSILL  829

Query  389  IAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTE--RMVRQE  225
             A    +  H    D ++  S   VW  ++         LS D    N   E  R+V++E
Sbjct  830  TACPWKTACHGPRRDDTAGTSVAEVWSLVR-------NTLSGDTKSGNGGIEVDRLVKEE  882

Query  224  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
              G+ W E   LE   + KEI  K+LEE+V++AV GL+
Sbjct  883  VGGRQWTESRWLEGYELSKEISEKVLEELVEEAVSGLS  920



>ref|XP_004976162.1| PREDICTED: uncharacterized protein LOC101760628 isoform X1 [Setaria 
italica]
 ref|XP_004976163.1| PREDICTED: uncharacterized protein LOC101760628 isoform X2 [Setaria 
italica]
Length=946

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 108/200 (54%), Gaps = 9/200 (5%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SV R+LSW+D  + + +    +     +   + +E E + F+Q ++S +GL ++Q  ++ 
Sbjct  723  SVTRSLSWED--MSSPSPLLGMTKLTHLSSGDNDELECVAFVQRIVSSSGLGDLQLGTVF  780

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTCHK  393
            + WH PD PLDP L DK ++  E+     AK R+RRS +KL+FD VN  L++I  DT  +
Sbjct  781  TGWHLPDCPLDPALCDKLLDRKEE----AAKSRERRSNQKLLFDYVNMTLVEIGQDTLLR  836

Query  392  TIAFSGAHNTI-PDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
               +S A +    +  S+   + +   + +W   +     ++  D   + ER+++QE  G
Sbjct  837  AYPWSQARSMAWKESLSLDLVEEIPHLMTDWLYGSGKFAVNENDDAGTILERIMQQEVEG  896

Query  215  KGWHEYLRLEAESIGKEIEG  156
            +GW + +R E + I + I G
Sbjct  897  RGWVKSMRWELDGITELIAG  916



>ref|XP_010235705.1| PREDICTED: uncharacterized protein LOC100838495 [Brachypodium 
distachyon]
Length=896

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 107/211 (51%), Gaps = 15/211 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            +VA +L WDD+  ++ +      P +     +++E E    +Q ++S AGLD+  S  + 
Sbjct  689  AVACSLPWDDASSESPSVGIPRLPCLPSD-IDDDESECHVLVQNIMSSAGLDDTHSSMVF  747

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + WH PD P+DP+L +K + L           R++RS ++L+FDCVN AL++I       
Sbjct  748  TGWHLPDCPVDPVLCNKLLAL-----------REQRSCQRLLFDCVNVALVEIGENALLS  796

Query  386  AF--SGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            AF  S AH  T    SS      VW  +K+W       +         + +R+V+QE  G
Sbjct  797  AFSWSKAHTRTWRYISSPALGVEVWSILKDWIYGTRMFVVSKRDSTGIMMDRIVKQEVEG  856

Query  215  KGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
              W + +  +   I ++IE  +LEE+V +A+
Sbjct  857  SSWVKMMMSQVVDITEQIEEGVLEELVGEAL  887



>ref|XP_003558830.1| PREDICTED: uncharacterized protein LOC100833211 [Brachypodium 
distachyon]
Length=885

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 112/225 (50%), Gaps = 36/225 (16%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVARTLS+DDS  +    S          + +  E+E   F++ +L  AG    Q++ +
Sbjct  682  GSVARTLSFDDSSEEAVPCS---------SKEDCHEQEQYEFVEKILFSAGFCNKQTNDI  732

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              +WHS D PL P + D+++    ++        +RRS ++L+ D VNAAL+DI      
Sbjct  733  FVQWHSLDCPLGPDVVDQFLERKVED--------ERRSNQRLLIDSVNAALLDIGQSRLW  784

Query  389  IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAA-----GCLSDD------GVDDNNLTE  243
             A+       P    I++A RV  R  E     A     G L DD      G+D+  +  
Sbjct  785  CAY-------PCTWPIVNARRVASRDDELVADEAWKLVKGWLLDDEAHMVNGLDNVGVAA  837

Query  242  R-MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
              +V +E  G+GW + LRLE + I KEI G++L E+V++A    A
Sbjct  838  DWVVGREIEGRGWPKTLRLEVDEISKEICGEVLSELVEEAFSEFA  882



>ref|XP_009407163.1| PREDICTED: uncharacterized protein LOC103989929 [Musa acuminata 
subsp. malaccensis]
Length=943

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 119/224 (53%), Gaps = 23/224 (10%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR+LS  DS +D   S+  L   + + + +EE  +++F +  L+S A + + +S   S
Sbjct  731  SVARSLSRGDSYLDI-RSTKPLRSSMIISKVDEEHEQFVF-VHKLISSAQMKKNKSMKFS  788

Query  566  SRWHSPDSPLDP-LLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
              WHS DSPL+P LL D +   +E     E K  +R+++R+L+FD VNAAL+DI    ++
Sbjct  789  G-WHSLDSPLNPSLLYDSWHTDDE-----EGKHGKRQTSRRLLFDAVNAALLDIS---QS  839

Query  389  IAFSGAHNTIP-------DGSSIISADRVWGRIKEWFPSAAGCLSDD---GVDDNNLTER  240
              F+    T P       D     +AD VW  I+ W  S   C+ ++       + + + 
Sbjct  840  ALFAAYPWTKPCCGPPKDDTVGTSAADEVWAIIRNWL-SGEKCVPNESTSSSSSSRMVDG  898

Query  239  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
            +V +E  G+ W E    E     KE+ GK+L+E++++A+  L D
Sbjct  899  LVMKEVGGRQWTESRWSELCEFSKEMGGKVLDELIEEALAVLFD  942



>ref|XP_009405681.1| PREDICTED: uncharacterized protein LOC103988772 [Musa acuminata 
subsp. malaccensis]
Length=931

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 102/187 (55%), Gaps = 13/187 (7%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            SVAR++S + S +DTA  S  L   + + + +EE  +++F ++ L++ AGLD  +S    
Sbjct  728  SVARSISKEFSYLDTA--SNPLRYSIVLSKADEEYEQYVF-VEKLIASAGLDCKKSSVNF  784

Query  566  SRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTI  387
            + WHS +SPL+P+L + ++N        EAK R+R S ++L+FD +NAAL++I       
Sbjct  785  TGWHSLESPLNPMLLELHMN------GEEAKFRKRGSNKRLLFDSINAALLNISQKETLA  838

Query  386  AF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVG  216
            ++           D  S   A+ VWG IK WF S    ++ +    +N  + +V++E  G
Sbjct  839  SYPWSQACDRNKDDSLSGPLAEEVWGTIKSWF-SGHSYVTGEFNYSSNSVDWLVKKEMTG  897

Query  215  KGWHEYL  195
              W E +
Sbjct  898  GQWVESM  904



>ref|XP_006279983.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12881.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=893

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 108/213 (51%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V    SS       S   T +EE +    I TLLS A LD + SD L
Sbjct  685  GSIGRTFSFDDSTVARCLSSKR-----STTSTRDEEEDLRLLINTLLSAADLDAI-SDDL  738

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR+ Y +  E++       R   + +KLVFD VN  L+++     T
Sbjct  739  LSKWHSVESPLDPSLRNSYADSTEQQ-------RLGSNMKKLVFDLVNTLLLEL-----T  786

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
             +F G     P    IIS    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  787  PSFLG-----PRSPLIISGKSLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  834

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  835  LAVNKVVRVEVAELGSPECLRLEMDSMGEELEL  867



>ref|XP_006279984.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12882.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=838

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 108/213 (51%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V    SS       S   T +EE +    I TLLS A LD + SD L
Sbjct  630  GSIGRTFSFDDSTVARCLSSKR-----STTSTRDEEEDLRLLINTLLSAADLDAI-SDDL  683

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR+ Y +  E++       R   + +KLVFD VN  L+++     T
Sbjct  684  LSKWHSVESPLDPSLRNSYADSTEQQ-------RLGSNMKKLVFDLVNTLLLEL-----T  731

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
             +F G     P    IIS    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  732  PSFLG-----PRSPLIISGKSLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  779

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  780  LAVNKVVRVEVAELGSPECLRLEMDSMGEELEL  812



>ref|XP_010494373.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
 ref|XP_010494374.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
Length=837

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 106/213 (50%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V    SS       S   T +EE +    I TLLS A LD + SD+L
Sbjct  629  GSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSAADLDAI-SDNL  682

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR+ Y    E++       R   + +KLVFD VN  L+++   +  
Sbjct  683  LSKWHSAESPLDPSLRNSYAESTEQQ-------RLGSNVKKLVFDLVNTLLLELTPSY--  733

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
                     +P    I+S    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  734  --------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  778

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  779  LAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  811



>ref|XP_010494375.1| PREDICTED: uncharacterized protein LOC104771538 isoform X2 [Camelina 
sativa]
Length=835

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 106/213 (50%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V    SS       S   T +EE +    I TLLS A LD + SD+L
Sbjct  627  GSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSAADLDAI-SDNL  680

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR+ Y    E++       R   + +KLVFD VN  L+++   +  
Sbjct  681  LSKWHSAESPLDPSLRNSYAESTEQQ-------RLGSNVKKLVFDLVNTLLLELTPSY--  731

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
                     +P    I+S    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  732  --------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  776

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  777  LAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  809



>ref|XP_010481813.1| PREDICTED: uncharacterized protein LOC104760567 isoform X2 [Camelina 
sativa]
Length=754

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 105/213 (49%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V    SS       S   T +EE +    I TLLS A LD V SD+L
Sbjct  553  GSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSEADLDAV-SDNL  606

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR  Y  L E++       R   + + LVFD VN  L+++   +  
Sbjct  607  LSKWHSAESPLDPSLRTSYAELTEQQ-------RLGSNVKNLVFDLVNTLLLELTPSY--  657

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
                     +P    I+S    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  658  --------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  702

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  703  LAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  735



>ref|XP_010481809.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
 ref|XP_010481810.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
Length=829

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 105/213 (49%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V    SS       S   T +EE +    I TLLS A LD V SD+L
Sbjct  628  GSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSEADLDAV-SDNL  681

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR  Y  L E++       R   + + LVFD VN  L+++   +  
Sbjct  682  LSKWHSAESPLDPSLRTSYAELTEQQ-------RLGSNVKNLVFDLVNTLLLELTPSY--  732

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
                     +P    I+S    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  733  --------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  777

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  778  LAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  810



>ref|NP_199201.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA98068.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM91604.1| putative protein [Arabidopsis thaliana]
 gb|AED95020.1| uncharacterized protein AT5G43880 [Arabidopsis thaliana]
Length=836

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 110/214 (51%), Gaps = 46/214 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RTLS+DDS   T    YS     +  R EEE+   L  I TLLS A LD + SD+L
Sbjct  627  GSIGRTLSFDDS---TVARCYSSKRSTTSARDEEEDLRLL--INTLLSAADLDAI-SDNL  680

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR+ Y +  E+       +R   + + LVFD VN  L+++     T
Sbjct  681  LSKWHSSESPLDPSLRNSYADSTEQ-------KRLGSNVKNLVFDLVNTLLLEL-----T  728

Query  389  IAFSGAHNTIPDGSSIISADRVWG-----RIKEWFPSAAGCLSDDGV-------DDNNLT  246
             ++ G     P  S +I + +  G     R++E       CL+ +G        +D +L+
Sbjct  729  PSYLG-----PRSSPMILSGKPLGVYVINRMQE-------CLTGNGRVEDRWWDEDGDLS  776

Query  245  ----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                 ++VR E    G  E LRLE +S+G+E+E 
Sbjct  777  SLAVNKVVRIEVAEIGSQESLRLEMDSMGEELEL  810



>ref|XP_002863627.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39886.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
Length=833

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 105/209 (50%), Gaps = 37/209 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RTLS+DDS V    SS       S   T +EE +    I TLLS A  D + SD+L
Sbjct  625  GSIGRTLSFDDSTVARCYSSKR-----STTSTRDEEEDLRLLINTLLSAADFDTI-SDNL  678

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR+ Y +  E+       +R   + + LVFD VN  L+++     T
Sbjct  679  LSKWHSAESPLDPSLRNSYADSTEQ-------KRLGSNVKNLVFDLVNTLLLEL-----T  726

Query  389  IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-------DDNNLT----E  243
             ++ G  + +      +    V  R++E       CL+ +G        +D +L+     
Sbjct  727  PSYLGPRSPLTLSGKPLQV-YVINRMQE-------CLTGNGRVEDRWWDEDGDLSSLAVN  778

Query  242  RMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
            ++VR E    G  E LRLE +S+G+E+E 
Sbjct  779  KVVRIEVAEIGSQESLRLEMDSMGEELEL  807



>ref|XP_010441972.1| PREDICTED: uncharacterized protein LOC104725068 isoform X2 [Camelina 
sativa]
Length=832

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 105/213 (49%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V     +   +   S   T +EE +    I TLLS A LD V SD+L
Sbjct  633  GSIGRTFSFDDSTV-----ARCFSSKRSTSSTRDEEEDLRLLINTLLSAADLDAV-SDNL  686

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR  Y    E++       R   + +KLVFD VN  L+++   +  
Sbjct  687  LSKWHSAESPLDPSLRTSYAESTEQQ-------RLGSNVKKLVFDLVNTLLLELSPSY--  737

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
                     +P    I+S    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  738  --------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  782

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  783  LAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  815



>ref|XP_010441970.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
 ref|XP_010441971.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
Length=827

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 105/213 (49%), Gaps = 45/213 (21%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ RT S+DDS V     +   +   S   T +EE +    I TLLS A LD V SD+L
Sbjct  628  GSIGRTFSFDDSTV-----ARCFSSKRSTSSTRDEEEDLRLLINTLLSAADLDAV-SDNL  681

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
             S+WHS +SPLDP LR  Y    E++       R   + +KLVFD VN  L+++   +  
Sbjct  682  LSKWHSAESPLDPSLRTSYAESTEQQ-------RLGSNVKKLVFDLVNTLLLELSPSY--  732

Query  389  IAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
                     +P    I+S    RV+   R++E       CL+ +G        +D +L+ 
Sbjct  733  --------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWWDEDGDLSS  777

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE +S+G+E+E 
Sbjct  778  LAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  810



>ref|XP_009113974.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113975.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113976.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
Length=757

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 103/213 (48%), Gaps = 38/213 (18%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE--VQS--  579
            S+ R  S++DS V    SS       +   T +EE +    I TLLS A LDE  V S  
Sbjct  541  SIGRNFSFNDSTVARCHSSKR----STTISTRDEEEDLRLLINTLLSAANLDEESVPSSI  596

Query  578  -DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT  402
             D+L S+WHS +SPLDP LR+ Y +  E++       +   + +KLVFD VN  L+++  
Sbjct  597  IDNLLSKWHSVESPLDPSLRESYADSTEQQ-------KHGSNVKKLVFDLVNTLLLELTP  649

Query  401  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
             +  +     H  +  G ++     V  R++E       CL  +G        +D +L+ 
Sbjct  650  SY--LGHGSHHMLLLSGKTL--GVYVINRMRE-------CLKGNGRVEYRWWDEDGDLSS  698

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE E +G+EIE 
Sbjct  699  LAVNKVVRTEVAEIGSKESLRLEMECMGEEIEL  731



>ref|XP_006854321.1| hypothetical protein AMTR_s00039p00119340 [Amborella trichopoda]
 gb|ERN15788.1| hypothetical protein AMTR_s00039p00119340 [Amborella trichopoda]
Length=1073

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 102/209 (49%), Gaps = 55/209 (26%)
 Frame = -1

Query  650   EEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLN--------EK  495
             E E+E   F++T+L+ +GL +    S+  RW+SP+SPLDP+L DK ++ N        E+
Sbjct  875   ESEQEVFLFVETILNASGLLDEPECSIFGRWYSPNSPLDPVLLDKCLDKNGSVSSKGGER  934

Query  494   E---------TVHEAKRR-------------QRRST--RKLVFDCVNAALIDI-DTCHKT  390
             E         T  E +R+             +RR    RKLVFDC+NA L++I   C   
Sbjct  935   ECCSKQNDPVTCIEGERKSCSDQNGMVICKVERRDEMERKLVFDCINAVLVEITGPCLDA  994

Query  389   IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKG  210
               ++      P G  ++ A   W  ++EW   A G    +G+      ER +       G
Sbjct  995   HPWARPRRQGPVGQQLVQA--TWNLLREW---AHG----EGL------ERDL------SG  1033

Query  209   WHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
             W + L  E + IG EIE  +LE++++DA+
Sbjct  1034  WFD-LGQEMDWIGTEIERCVLEDLIEDAL  1061



>emb|CDY22327.1| BnaA06g36490D [Brassica napus]
Length=198

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 93/181 (51%), Gaps = 30/181 (17%)
 Frame = -1

Query  662  QRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSS----RWHSPDSPLDPLLRDKYINLNEK  495
            Q+ EEEE +    + TLLS A LDE +S+SLSS    +WHS +SPLDP LR  Y N  E 
Sbjct  10   QKIEEEEEDLRVLVNTLLSAADLDE-ESESLSSYVLSKWHSVESPLDPSLRGIYANSAEH  68

Query  494  ETVHEAKRRQRRSTRKLVFDCVNAALIDIDT------CHKTIAFS--GAHNTIPDGSSII  339
            +       R   + +KLVFD VN  L+++        C K ++    GA+  I      +
Sbjct  69   Q-------RLGTNVKKLVFDLVNTLLLELTPSYLGPRCLKILSGKTLGAY-VINRMQKCL  120

Query  338  SADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIE  159
              +   GR+++ +    G LS   V+      R+VR E    G  E LRLE +S+G+E+E
Sbjct  121  KGN---GRVEDRWWDEDGDLSSLAVN------RVVRMEEAEIGSPESLRLEMDSMGEELE  171

Query  158  G  156
             
Sbjct  172  L  172



>gb|EEC74239.1| hypothetical protein OsI_09439 [Oryza sativa Indica Group]
Length=934

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 115/229 (50%), Gaps = 41/229 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+++ L FIQ L+  AG+D  
Sbjct  730  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDQDSLTFIQKLVCSAGIDR-  781

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +   LSS       PL+  L +K+ +  E+ T    K R+RRS  K +FD VN AL ++ 
Sbjct  782  EGCMLSS-------PLELYLLEKFSDYQEEGT----KLRERRSKEKFLFDAVNEALTELT  830

Query  404  TCHKTIAFS-GAHNTI-----PDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDD  258
               + +A+S G  +++      +  S  +AD +W  I+ W     +P        + ++ 
Sbjct  831  WTAELMAYSWGTSSSLERKDCENAFSNSAADEIWRVIRNWSILDKYPPG------ETIER  884

Query  257  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            N L E ++++E +     +  RLE   +   +   +LE+++ DAVV L+
Sbjct  885  NLLVEMILKREVLEAASSDTTRLETFELTSMVCTMVLEDLIADAVVDLS  933



>emb|CDY32928.1| BnaA09g16650D [Brassica napus]
Length=755

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 103/213 (48%), Gaps = 38/213 (18%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE--VQS--  579
            S+ R  S++DS V    SS       +   T +EE +    I TLLS A LDE  V S  
Sbjct  539  SIGRNFSFNDSTVARCHSSKR----STTTSTRDEEEDLRLLINTLLSAANLDEESVPSSI  594

Query  578  -DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT  402
             D+L S+WHS +SPLDP LR+ Y +  E++       R   + +KLVFD VN  L+++  
Sbjct  595  IDNLLSKWHSVESPLDPSLRESYADSTEQQ-------RHGSNVKKLVFDLVNTLLLELTP  647

Query  401  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
             +  +     H  +  G ++     V  R++E       C+  +G        +D +L+ 
Sbjct  648  SY--LGHGSHHMLLLSGKTL--GVYVINRMRE-------CVKGNGRVEYRWWDEDGDLSS  696

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE E +G+EIE 
Sbjct  697  LAVNKVVRTEVAEIGSKESLRLEMECMGEEIEL  729



>gb|EPS72229.1| hypothetical protein M569_02537, partial [Genlisea aurea]
Length=151

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPV----SMQRTEEEEREWLFFIQTLLSMAGL-DEV  585
            G++ RTL WD+   +T +  +    PV    + +R  +EE EW  F +TLLS++G+ DE 
Sbjct  68   GTIPRTLCWDELYAETESPHHH---PVGECPATRRRSDEEAEWAVFAKTLLSVSGIQDEG  124

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINL  504
             S+    RW+S +SPLDP LRD Y+++
Sbjct  125  LSNLCGERWYSHESPLDPSLRDSYMDV  151



>ref|XP_006648110.1| PREDICTED: uncharacterized protein LOC102717592 [Oryza brachyantha]
Length=927

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 109/229 (48%), Gaps = 41/229 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+++ L FIQ L+  AG+D  
Sbjct  723  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDQDSLTFIQKLVCSAGIDR-  774

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
                L+S       PL+  L +K+ +  E+      K R+RRS  K +FD VN AL ++ 
Sbjct  775  DGCMLAS-------PLELELLEKFSDYQEEGI----KLRERRSKEKFLFDAVNEALTELT  823

Query  404  TCHKTIA------FSGAHNTIPDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDD  258
               + +A      FS  H    +  S  +AD +W  I+ W     +P        + ++ 
Sbjct  824  WTAELMAYPWRRSFSLEHKDCENDCSNSAADEIWRVIRNWSILDRYPPG------ETIER  877

Query  257  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            N L E ++++E V     +  RLE   +   I   +LE+++ DA V L+
Sbjct  878  NLLVEMILKREVVEAARGDMTRLETFELTTTICAMVLEDLIADAAVDLS  926



>ref|XP_003570390.1| PREDICTED: uncharacterized protein LOC100830114 [Brachypodium 
distachyon]
Length=931

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 111/231 (48%), Gaps = 41/231 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D   +  +       P S++ +      +E+++ L FIQ L+S AG+D  
Sbjct  725  GSFSRSLSWEDPPSEVMS-------PNSLRLSRLFSKADEDQDSLTFIQKLVSFAGMDR-  776

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +   LSS       PLDP L DK  +  + E +   K R+RRS  +L+FD VN AL ++ 
Sbjct  777  EGCILSS-------PLDPKLLDKLSDY-QGEGI---KLRERRSKERLLFDAVNEALAELT  825

Query  404  TCHKTIAFS------GAHNTIPDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDD  258
               +  A+        A     D     +AD +W  I+ W     +P        + ++ 
Sbjct  826  RTTELAAYPWGRACCSARKDCEDDFCNSAADEIWRVIRNWSILEKYPPG------EIIER  879

Query  257  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            N L + ++++E V     +  RLE   +   +   +LE+++++A+V L + 
Sbjct  880  NLLVDMILKREVVETAIADTTRLETFELNMMVCEVILEDLLEEALVDLTNN  930



>ref|NP_001048512.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAD22010.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10426.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAG94939.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58041.1| hypothetical protein OsJ_08870 [Oryza sativa Japonica Group]
Length=934

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 111/229 (48%), Gaps = 41/229 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+++ L FIQ L+  AG+D  
Sbjct  730  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDQDSLTFIQKLVCSAGIDR-  781

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +   LS        PL+  L +K+ +  E+ T    K R+RRS  K +FD VN AL ++ 
Sbjct  782  EGCMLSG-------PLELYLLEKFSDYQEEGT----KLRERRSKEKFLFDAVNEALTELT  830

Query  404  TCHKTIAFSGAHNT------IPDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDD  258
               + +A+    ++        +  S  +AD +W  I+ W     +P        + ++ 
Sbjct  831  WTAELMAYPLGRSSSLERKDCENAFSNSAADEIWRVIRNWSILDKYPPG------ETIER  884

Query  257  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  111
            N L E ++++E +     +  RLE   +   +   +LE+++ DAVV L+
Sbjct  885  NLLVEMILKREVLEAASSDTTRLETFELTSMVCTMVLEDLIADAVVDLS  933



>emb|CDY50812.1| BnaCnng19760D [Brassica napus]
Length=750

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 101/213 (47%), Gaps = 38/213 (18%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQS----  579
            S+ R  S++DS V    SS       +   T +EE +    I TLLS A LDE       
Sbjct  534  SIGRNFSFNDSTVARCHSSKR----STTTSTRDEEEDLRLLINTLLSSAHLDEEPDSSSI  589

Query  578  -DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDT  402
             D+L S+WHS +SPLDP LR+ Y +  E++ +         + +KLVFD VN  L+++  
Sbjct  590  IDNLLSKWHSVESPLDPSLRESYADSTEQQKLGS-------NVKKLVFDLVNTLLLELTP  642

Query  401  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-------DDNNLT-  246
             +      G+H+ +      +    +  R++E       CL  +G        +D +L+ 
Sbjct  643  SYHG---HGSHHMLLLSGKTLGV-YLINRMRE-------CLKGNGRVEYRWWDEDRDLSS  691

Query  245  ---ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
                ++VR E    G  E LRLE E +G+EIE 
Sbjct  692  LAVNKVVRTEVAEIGSKESLRLEMECMGEEIEL  724



>ref|XP_004954364.1| PREDICTED: uncharacterized protein LOC101771268 isoform X1 [Setaria 
italica]
 ref|XP_004954365.1| PREDICTED: uncharacterized protein LOC101771268 isoform X2 [Setaria 
italica]
 ref|XP_004954366.1| PREDICTED: uncharacterized protein LOC101771268 isoform X3 [Setaria 
italica]
 ref|XP_004954367.1| PREDICTED: uncharacterized protein LOC101771268 isoform X4 [Setaria 
italica]
 ref|XP_004954368.1| PREDICTED: uncharacterized protein LOC101771268 isoform X5 [Setaria 
italica]
Length=915

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 108/231 (47%), Gaps = 41/231 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+ + L FIQ L+   G+D  
Sbjct  710  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDLDSLTFIQKLVHSCGMDR-  761

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +   L+        PLDP L  K+ +  E       K  +RRS ++L+FD VN AL ++ 
Sbjct  762  EGCILAE-------PLDPKLLAKFSDYQEDGM----KSGKRRSKQRLLFDAVNEALAELT  810

Query  404  TCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDD  258
            +  +  A+      S  H    +GSS    + +W  I+ W     +P        + ++ 
Sbjct  811  SMAELAAYPWGRSCSLEHRDCKNGSSNSVDEEIWRVIRNWSILEKYPPG------EAIER  864

Query  257  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            N L E ++++E       +  RLE   +G  +   +LE++V++ ++ L + 
Sbjct  865  NLLLEMILKREVAEAASADTARLEIFKLGAAVCSMVLEDLVEETLLDLTNN  915



>gb|EMS54382.1| hypothetical protein TRIUR3_15055 [Triticum urartu]
Length=1009

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 111/228 (49%), Gaps = 34/228 (15%)
 Frame = -1

Query  749   GSVARTLSWDDSCVDT-ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDS  573
             GS +R+LSW+D   +  + +S  L     +    +++++ L  IQ L+S AG+D  +S  
Sbjct  802   GSFSRSLSWEDPPSEVMSPNSLRL---ARLFSKADDDQDSLTIIQKLVSSAGMDR-KSCV  857

Query  572   LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHK  393
             L+S       PLDP L +K  +        E K R++RS  +L+FD VN AL ++    +
Sbjct  858   LAS-------PLDPRLLEKLSD----HQAEEIKSREKRSKERLLFDAVNEALTELTWTTE  906

Query  392   TIAF-------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDDNNL  249
               A+       S   +   D S   +AD +W  I+ W     +P        + ++ N L
Sbjct  907   LSAYPWGRTFCSQRKDCDDDSSCNSAADEIWRVIRNWSILDKYPPG------EVIERNLL  960

Query  248   TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
              E ++++E V     +  RLE   +   +   +LE+++++A+V L ++
Sbjct  961   LEMILKREVVETATADTTRLETFEVCAMVCTVVLEDLLEEALVDLTNS  1008



>gb|EMS57338.1| hypothetical protein TRIUR3_10172 [Triticum urartu]
Length=816

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 10/97 (10%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GSVARTLSWD+S  +   +      P S +  +  E+E   F++ +LS AGL    + ++
Sbjct  718  GSVARTLSWDESSSEEEAA------PCSSKDDDSHEQERYEFVEKILSSAGLCAEATGNV  771

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  459
             +RWHS DSPL P + D+++    +  V +AK R+RR
Sbjct  772  FARWHSLDSPLAPTVPDQFL----ERKVEDAKCRERR  804



>ref|XP_006403169.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
 gb|ESQ44622.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
Length=845

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 99/210 (47%), Gaps = 32/210 (15%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS+ R  S++DS V    SS       S   T +EE +    I TLLS A LDE    S 
Sbjct  630  GSIGRNFSFEDSTVARCYSSKR-----SPTFTRDEEEDLRLLINTLLSAADLDEESESSS  684

Query  569  SS-------RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  411
            SS       +W+S +SPLDP LRD Y N         + +R   + +KLVFD VN+ L++
Sbjct  685  SSILDSLLSKWYSVESPLDPSLRDSYAN---------SHQRLGSNVKKLVFDLVNSLLLE  735

Query  410  IDTCH-----KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  246
            +   +       +A SG    +   + +       GR+++ +    G LS   V+     
Sbjct  736  LTPSYLGPRSSPMALSGKTLRVYIVNRMQECLTGKGRVEDRWWDEDGDLSSLAVN-----  790

Query  245  ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
             ++VR E  G G  E L  E +S+G+E+E 
Sbjct  791  -KVVRIEVAGIGSPESLGFEKDSMGEELEL  819



>ref|XP_008646430.1| PREDICTED: uncharacterized protein LOC103627892 isoform X2 [Zea 
mays]
Length=936

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 111/231 (48%), Gaps = 42/231 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+ + L FIQ L+   G    
Sbjct  729  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDLDSLTFIQKLVHSRGTGR-  780

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +S  L+        PLDP L +K I+  E++ +   KRR ++   +L+FD VN ALI++ 
Sbjct  781  ESCILAD-------PLDPSLLEK-ISDYEEDGIKFGKRRPKQ---RLLFDAVNEALIELA  829

Query  404  TCHKTIAF------SGAHNTIPDGSSIIS-ADRVWGRIKEW-----FPSAAGCLSDDGVD  261
            +  +  A+      S  H    +GSS  S A+ +W  I+ W     +P        + ++
Sbjct  830  SMAELAAYPWGRSCSSEHGDCKNGSSSNSAAEEIWRVIRNWSILEKYPPG------EAIE  883

Query  260  DNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             N L E ++++E       +  RLE   +   +   +L+ +V++ VV L +
Sbjct  884  RNLLLEMILKREVAEAASADTTRLETFDLNTTVCAMVLDGLVEETVVDLTN  934



>ref|XP_008646424.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646425.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646426.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646428.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646429.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
Length=937

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 111/231 (48%), Gaps = 42/231 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+ + L FIQ L+   G    
Sbjct  730  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDLDSLTFIQKLVHSRGTGR-  781

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +S  L+        PLDP L +K I+  E++ +   KRR ++   +L+FD VN ALI++ 
Sbjct  782  ESCILAD-------PLDPSLLEK-ISDYEEDGIKFGKRRPKQ---RLLFDAVNEALIELA  830

Query  404  TCHKTIAF------SGAHNTIPDGSSIIS-ADRVWGRIKEW-----FPSAAGCLSDDGVD  261
            +  +  A+      S  H    +GSS  S A+ +W  I+ W     +P        + ++
Sbjct  831  SMAELAAYPWGRSCSSEHGDCKNGSSSNSAAEEIWRVIRNWSILEKYPPG------EAIE  884

Query  260  DNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             N L E ++++E       +  RLE   +   +   +L+ +V++ VV L +
Sbjct  885  RNLLLEMILKREVAEAASADTTRLETFDLNTTVCAMVLDGLVEETVVDLTN  935



>ref|XP_011101154.1| PREDICTED: uncharacterized protein LOC105179248 isoform X1 [Sesamum 
indicum]
Length=647

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 91/178 (51%), Gaps = 18/178 (10%)
 Frame = -1

Query  638  EWLFFIQTLLSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQR  462
            E+  +IQ +L   G+ D+V   +L  +WH+P  PLDP +   Y+ L        A    R
Sbjct  466  EYKPYIQRILKRTGIIDKVTPLTLG-KWHTPSHPLDPSIF-YYLELFHPSAATLAV-LSR  522

Query  461  RSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGC  282
            R  RKL+F  V+  L +I   H  + F    + I D  S+  AD +  +I E FP AA C
Sbjct  523  RCNRKLIFQLVDELLAEILRPH--LDFKPWVSPITDHLSL--ADELCKKI-ESFP-AANC  576

Query  281  LSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD--AVVGL  114
               + +D       ++ ++    G + +L  E ES+  EIEG+++E +V++  A+VG+
Sbjct  577  QVLEDIDS------LIEKDLGKSGLNWFLEEEGESLVCEIEGEIMESLVRETVAMVGV  628



>ref|XP_008646431.1| PREDICTED: uncharacterized protein LOC103627892 isoform X3 [Zea 
mays]
 gb|AFW74025.1| hypothetical protein ZEAMMB73_702258 [Zea mays]
Length=932

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 111/231 (48%), Gaps = 42/231 (18%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-----EEEREWLFFIQTLLSMAGLDEV  585
            GS +R+LSW+D  ++  +       P S++ +      +E+ + L FIQ L+   G    
Sbjct  725  GSFSRSLSWEDPPLEVMS-------PNSLRLSRLFSKADEDLDSLTFIQKLVHSRGTGR-  776

Query  584  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  405
            +S  L+        PLDP L +K I+  E++ +   KRR ++   +L+FD VN ALI++ 
Sbjct  777  ESCILAD-------PLDPSLLEK-ISDYEEDGIKFGKRRPKQ---RLLFDAVNEALIELA  825

Query  404  TCHKTIAF------SGAHNTIPDGSSIIS-ADRVWGRIKEW-----FPSAAGCLSDDGVD  261
            +  +  A+      S  H    +GSS  S A+ +W  I+ W     +P        + ++
Sbjct  826  SMAELAAYPWGRSCSSEHGDCKNGSSSNSAAEEIWRVIRNWSILEKYPPG------EAIE  879

Query  260  DNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  108
             N L E ++++E       +  RLE   +   +   +L+ +V++ VV L +
Sbjct  880  RNLLLEMILKREVAEAASADTTRLETFDLNTTVCAMVLDGLVEETVVDLTN  930



>ref|XP_011101155.1| PREDICTED: uncharacterized protein LOC105179248 isoform X2 [Sesamum 
indicum]
Length=645

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 91/178 (51%), Gaps = 18/178 (10%)
 Frame = -1

Query  638  EWLFFIQTLLSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQR  462
            E+  +IQ +L   G+ D+V   +L  +WH+P  PLDP +   Y+ L        A    R
Sbjct  464  EYKPYIQRILKRTGIIDKVTPLTLG-KWHTPSHPLDPSIF-YYLELFHPSAATLAV-LSR  520

Query  461  RSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGC  282
            R  RKL+F  V+  L +I   H  + F    + I D  S+  AD +  +I E FP AA C
Sbjct  521  RCNRKLIFQLVDELLAEILRPH--LDFKPWVSPITDHLSL--ADELCKKI-ESFP-AANC  574

Query  281  LSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD--AVVGL  114
               + +D       ++ ++    G + +L  E ES+  EIEG+++E +V++  A+VG+
Sbjct  575  QVLEDIDS------LIEKDLGKSGLNWFLEEEGESLVCEIEGEIMESLVRETVAMVGV  626



>ref|XP_010317454.1| PREDICTED: uncharacterized protein LOC101266997 [Solanum lycopersicum]
 ref|XP_010317455.1| PREDICTED: uncharacterized protein LOC101266997 [Solanum lycopersicum]
Length=719

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 86/166 (52%), Gaps = 22/166 (13%)
 Frame = -1

Query  626  FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRK  447
            +IQ +L   GLD+    SL+ +W+SP  PLDP +   Y+ L    T H +     RS RK
Sbjct  572  YIQRILKRTGLDKSSPISLA-KWYSPSHPLDPSIF-HYLELFN-STTHNS---TLRSNRK  625

Query  446  LVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  267
            L+F  V+  L+DI   +  +     H ++ +G  +I  D +  +I++ FPS A C   + 
Sbjct  626  LIFHLVDELLVDILIKNNNL----KHRSM-NGEGLI--DALCSKIQD-FPS-ANCQVLED  676

Query  266  VDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD  129
            +D   L ER ++      G   +   E ESI  EIE +++EE++ D
Sbjct  677  IDA--LIERDMK-----IGGSVFFEEEVESIVCEIEREIMEEVLHD  715



>emb|CDX94731.1| BnaC07g17400D [Brassica napus]
Length=794

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 99/215 (46%), Gaps = 46/215 (21%)
 Frame = -1

Query  746  SVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLS  567
            S+ R  S+DDS V    SS       ++   EEEE +    +  LLS A LDE      S
Sbjct  582  SIGRIFSFDDSTVSRCYSSKR----STLSTREEEEEDLRLLVNALLSAADLDEESESLSS  637

Query  566  S---RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  396
                +WHS +SPLDP LR  Y N  E +       R   + ++LVFD VN  L+++    
Sbjct  638  YLLSKWHSVESPLDPSLRGIYANSAEHQ-------RLGTNVKQLVFDLVNTLLLEL----  686

Query  395  KTIAFSGAHNTIPDGSSIISADRVWG----RIKEWFPSAAGCLSDDGV-------DDNNL  249
             T ++ G     P G  I+S   +      R++E       CL  +G        +D +L
Sbjct  687  -TPSYLG-----PRGLKILSGKTLGAYAINRMQE-------CLKGNGRVEDRWWDEDGDL  733

Query  248  T----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  156
            +     R+VR E    G  E LRLE +S+G+E+E 
Sbjct  734  SSLAVNRVVRMEVAEIGSPESLRLEMDSMGEEVEL  768



>emb|CDY57257.1| BnaC08g47610D [Brassica napus]
Length=512

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 101/195 (52%), Gaps = 32/195 (16%)
 Frame = -1

Query  683  LNPPVSMQRTEEEEREWLF-FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYIN  507
            ++P + +   E+E+ +  F +++ +L ++G   ++++    +W+S + PLDP L  + +N
Sbjct  343  ISPGLGLNSLEKEDEDVYFCYVKKVLKLSGF--LENEYKEVKWYSEEQPLDPSLLYE-LN  399

Query  506  LNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-DTCH----KTIAFSGAHNTIPDGSSI  342
            + E+E V+          ++L+FD VN A+ +  +  H    KT++F+      P G   
Sbjct  400  IQEQEEVN----------KELLFDLVNEAITETRNQSHIYFPKTLSFA-----YPKGKRF  444

Query  341  ISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEI  162
            +  D VW R+ EW  S  G  + D   D +L + + R    G GW   LR E+E +  E+
Sbjct  445  L--DEVWRRV-EW--SLLGLGAQDS--DRSLDDIVGRDFTKGDGWMN-LRGESEWLTLEL  496

Query  161  EGKLLEEIVQDAVVG  117
            E  + +E++ + + G
Sbjct  497  EDLIFDEVLDEMLCG  511



>ref|XP_006362707.1| PREDICTED: protein LONGIFOLIA 1-like [Solanum tuberosum]
Length=679

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 22/168 (13%)
 Frame = -1

Query  626  FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRK  447
            +IQ +L   GLD+    SL+ +W+SP  PLDP +   Y+ L    T H    +     RK
Sbjct  534  YIQRILKRTGLDKTTPISLA-KWYSPSHPLDPSIF-HYLELFN-STTHNLTLK---CNRK  587

Query  446  LVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  267
            L+F  V+  L+DI    K   F   H ++ DG  +I  D +  RI+  FPSA  C   + 
Sbjct  588  LIFHLVDELLVDI--LMKNNNF--KHRSM-DGEELI--DTLCSRIRS-FPSA-NCQVLED  638

Query  266  VDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            +D        +  + +  G   +   + ESI  EIE +++EE+V D V
Sbjct  639  ID-------ALIDKDMEIGASVFFEEQVESIVCEIEREIMEEVVHDTV  679



>ref|XP_006307114.1| hypothetical protein CARUB_v10008702mg, partial [Capsella rubella]
 gb|EOA40012.1| hypothetical protein CARUB_v10008702mg, partial [Capsella rubella]
Length=574

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 89/178 (50%), Gaps = 25/178 (14%)
 Frame = -1

Query  653  EEEEREWLFFIQTLLSMAG-LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEA  477
            EE+E  +  +++ +L ++G LD   +D    +WH+ + PL+P L      + E E   EA
Sbjct  418  EEDEDAYFCYVKKVLEVSGFLDNKDNDE---KWHAEEQPLNPSL------VYELEIQEEA  468

Query  476  KRRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFP  297
                  + R+L+FD VN A+++       I F     T P G   +  D VWGR+ EW  
Sbjct  469  V----VNNRELLFDLVNEAIVETHN-ESHIYFP---KTFPYGKRYL--DEVWGRV-EWNL  517

Query  296  SAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            S  G  + D   D+ +   ++++   G GW   LR E+E +  E+E  + ++++ + +
Sbjct  518  SGVGAENKDRSLDDIVGRDLLKK---GDGWMN-LRRESEWLTLELEDLIFDDVLDELL  571



>emb|CDX95141.1| BnaC05g05300D [Brassica napus]
Length=539

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 93/204 (46%), Gaps = 33/204 (16%)
 Frame = -1

Query  716  SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPL  537
            S +D       L+        EE+E  +  +++ +L ++G  E   +  S  WHS + PL
Sbjct  360  SSLDNTAQGLGLSSLEIYNHVEEDEDAYFCYVKKVLQLSGFLENVHNGES--WHSEEQPL  417

Query  536  DP-LLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-DTCH----KTIAFSG  375
            +P LL + YI   EKE            +++L+FD VN A+ +  +  H    KT +F+ 
Sbjct  418  NPSLLYEVYIQ-EEKEV-----------SKELLFDLVNEAIAETRNQSHIYFPKTFSFA-  464

Query  374  AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYL  195
                 P     +  D VWGR+ EW  S  G  +     D +L + + R    G GW   L
Sbjct  465  ----YPIEKRFL--DEVWGRV-EWSLSGLGAEN----RDRSLDDIVGRDLTKGDGWMN-L  512

Query  194  RLEAESIGKEIEGKLLEEIVQDAV  123
            R E E +  EIE  + +E++ + +
Sbjct  513  RGETEWLTLEIEDLIFDEVLDEMI  536



>ref|XP_006307115.1| hypothetical protein CARUB_v10008702mg [Capsella rubella]
 gb|EOA40013.1| hypothetical protein CARUB_v10008702mg [Capsella rubella]
Length=557

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 89/178 (50%), Gaps = 25/178 (14%)
 Frame = -1

Query  653  EEEEREWLFFIQTLLSMAG-LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEA  477
            EE+E  +  +++ +L ++G LD   +D    +WH+ + PL+P L      + E E   EA
Sbjct  401  EEDEDAYFCYVKKVLEVSGFLDNKDNDE---KWHAEEQPLNPSL------VYELEIQEEA  451

Query  476  KRRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFP  297
                  + R+L+FD VN A+++       I F     T P G   +  D VWGR+ EW  
Sbjct  452  V----VNNRELLFDLVNEAIVETHN-ESHIYFP---KTFPYGKRYL--DEVWGRV-EWNL  500

Query  296  SAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
            S  G  + D   D+ +   ++++   G GW   LR E+E +  E+E  + ++++ + +
Sbjct  501  SGVGAENKDRSLDDIVGRDLLKK---GDGWMN-LRRESEWLTLELEDLIFDDVLDELL  554



>ref|NP_172241.2| GTPase OBGM [Arabidopsis thaliana]
 sp|F4HSD5.1|TRM32_ARATH RecName: Full=Protein TRM32; AltName: Full=TON1-RECRUITING MOTIF 
protein 32 [Arabidopsis thaliana]
 gb|AEE28150.1| GTP-binding protein Obg/CgtA [Arabidopsis thaliana]
Length=552

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 92/177 (52%), Gaps = 23/177 (13%)
 Frame = -1

Query  653  EEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAK  474
            EE+E  +  +++ +L ++G  E + +    +W+S + PL+P L  + +++ E+ETV++  
Sbjct  396  EEDEDAYFCYVKKVLKVSGFLENKDNE--EKWYSEEQPLNPSLLYE-LDIQEEETVND--  450

Query  473  RRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  294
                   ++L+FD VN A+++    H  I F     T P G   +  D VWGR+ EW  S
Sbjct  451  -------KELLFDLVNEAIVETQN-HSQIYFP---KTFPYGKRYL--DEVWGRV-EWSLS  496

Query  293  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
              G  + D   D+ +   ++ +     GW   L+ E+E +  E+E  + ++++ + +
Sbjct  497  GLGAENRDRSLDDIVGRDLLTK---SDGWMN-LQGESEWLTLELEDLIFDDVLDELL  549



>dbj|BAD42902.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=552

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 92/177 (52%), Gaps = 23/177 (13%)
 Frame = -1

Query  653  EEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAK  474
            EE+E  +  +++ +L ++G  E + +    +W+S + PL+P L  + +++ E+ETV++  
Sbjct  396  EEDEDAYFCYVKKVLKVSGFLENKDNE--EKWYSEEQPLNPSLLYE-LDIQEEETVND--  450

Query  473  RRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  294
                   ++L+FD VN A+++    H  I F     T P G   +  D VWGR+ EW  S
Sbjct  451  -------KELLFDLVNEAIVETQN-HSQIYFP---KTFPYGKRYL--DEVWGRV-EWSLS  496

Query  293  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  123
              G  + D   D+ +   ++ +     GW   L+ E+E +  E+E  + ++++ + +
Sbjct  497  GLGAENRDRSLDDIVGRDLLTK---SDGWMN-LQGESEWLTLELEDLIFDDVLDELL  549



>gb|AAF75096.1|AC007583_32 It is a member of GTP1/OBG family PF|01018 [Arabidopsis thaliana]
Length=1029

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 68/128 (53%), Gaps = 19/128 (15%)
 Frame = -1

Query  653  EEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAK  474
            EE+E  +  +++ +L ++G  E + +    +W+S + PL+P L  + +++ E+ETV++  
Sbjct  396  EEDEDAYFCYVKKVLKVSGFLENKDNE--EKWYSEEQPLNPSLLYE-LDIQEEETVND--  450

Query  473  RRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  294
                   ++L+FD VN A+++    H  I F     T P G   +  D VWGR+ EW  S
Sbjct  451  -------KELLFDLVNEAIVETQN-HSQIYFP---KTFPYGKRYL--DEVWGRV-EWSLS  496

Query  293  AAGCLSDD  270
              G  + D
Sbjct  497  GLGAENRD  504



>gb|EMT03099.1| hypothetical protein F775_52439 [Aegilops tauschii]
Length=939

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 112/227 (49%), Gaps = 32/227 (14%)
 Frame = -1

Query  749  GSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSL  570
            GS +R+LSW++   +   S  SL       + ++++ + L  IQ ++S AG+D  ++  L
Sbjct  732  GSFSRSLSWEEPPSEV-MSPNSLRLARLFSKADDDQ-DSLTIIQKIVSSAGMDR-KNCVL  788

Query  569  SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKT  390
            +S       PLD  L +K   L++ + V E K R+RRS  +L+FD VN AL ++    + 
Sbjct  789  AS-------PLDLKLLEK---LSDHQAV-EIKSRERRSKERLLFDAVNVALTELTWTAEL  837

Query  389  IAF-------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSAAGCLSDDGVDDNNLT  246
             A+       S   +   D S   +AD +W  I+ W     +P        + ++ N L 
Sbjct  838  SAYPWGRTCCSQRKDQDDDSSCNSAADEIWRVIRNWSILDKYPPG------EVIERNLLL  891

Query  245  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  105
            E ++++E V     +  RLE       +   +LE+++++A+V L ++
Sbjct  892  EMILKREVVETATADTTRLETFEGCAMVCTVVLEDLLEEALVDLTNS  938



>ref|XP_011094798.1| PREDICTED: uncharacterized protein LOC105174401 isoform X1 [Sesamum 
indicum]
Length=974

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 94/204 (46%), Gaps = 49/204 (24%)
 Frame = -1

Query  683  LNPPVSMQRTEEEEREW-LFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYIN  507
            L+P  S +    E++ W + +   +L  +GL+E + + L + WHSP  PLDP L D   N
Sbjct  801  LSPITSEENYPPEDKGWEISYALDVLIESGLEESELNMLRTTWHSPHCPLDPKLFD---N  857

Query  506  LNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADR  327
            L +K   +       RS R+L+F+ +N+A+++I        F    +  P          
Sbjct  858  LEKK---YSDDTSGLRSERRLLFERINSAILEI--------FQEHVDMCP----------  896

Query  326  VWGRIK------EWFPSAAGC-------LSDDGVDDNNLTERMVRQE---AVGKGWHEYL  195
             W R K      EW     G        L    + +++++ER+V +E   + GKG     
Sbjct  897  -WVRPKLAGLNLEWEKDGGGVRDAALEKLISQELSNDDISERVVDREMWWSDGKG-----  950

Query  194  RLEAESIGKEIEGKLLEEIVQDAV  123
              E E IG EIE  L+++++ + V
Sbjct  951  --EIEVIGNEIEKLLIDDMITEVV  972



>ref|XP_009118948.1| PREDICTED: protein TRM32-like [Brassica rapa]
Length=539

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 89/188 (47%), Gaps = 33/188 (18%)
 Frame = -1

Query  668  SMQRTEEEEREWLF-FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE  492
            S    EEE+ +  F +++ +L ++G   +++     +W+S + PL+P L           
Sbjct  376  SYNHEEEEDGDANFCYVKKVLQLSGF--LENVYHGEKWYSEEQPLNPSL-----------  422

Query  491  TVHEAKRRQRRSTRKLVFDCVNAALIDI-DTCH----KTIAFSGAHNTIPDGSSIISADR  327
             ++E   ++   +++L+FD VN A+ +  +  H    KT  FS      P+    +  D 
Sbjct  423  -LYEVDMKEEEVSKELLFDLVNEAIAETHNQSHIYFPKTFTFS-----YPNEKRFL--DE  474

Query  326  VWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLL  147
            VWGR+ EW  S  G     G  D +L + + R    G GW   LR E E +  EIE  + 
Sbjct  475  VWGRV-EWSLSGLGA----GNRDRSLDDIVGRDLTKGDGWMN-LRGETEWLTLEIEDLIF  528

Query  146  EEIVQDAV  123
            +E++ + +
Sbjct  529  DEVLDEMI  536



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630