BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023J13

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006370478.1|  hypothetical protein POPTR_0001s43080g           64.7    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010040410.1|  PREDICTED: subtilisin-like protease SBT5.3       61.6    5e-10   Eucalyptus grandis [rose gum]
gb|KCW45238.1|  hypothetical protein EUGRSUZ_L01115                   61.6    5e-10   Eucalyptus grandis [rose gum]
ref|XP_011004882.1|  PREDICTED: subtilisin-like protease              64.7    5e-10   Populus euphratica
gb|KDP34877.1|  hypothetical protein JCGZ_09165                       62.8    2e-09   Jatropha curcas
ref|XP_006448798.1|  hypothetical protein CICLE_v10014244mg           62.4    3e-09   Citrus clementina [clementine]
gb|KDO77536.1|  hypothetical protein CISIN_1g003005mg                 62.4    3e-09   Citrus sinensis [apfelsine]
gb|KHN29777.1|  Subtilisin-like protease SDD1                         62.4    3e-09   Glycine soja [wild soybean]
ref|XP_006468393.1|  PREDICTED: subtilisin-like protease-like         62.0    4e-09   Citrus sinensis [apfelsine]
ref|XP_006587105.1|  PREDICTED: subtilisin-like protease SDD1-like    62.0    4e-09   Glycine max [soybeans]
gb|KJB56362.1|  hypothetical protein B456_009G116500                  62.0    4e-09   Gossypium raimondii
ref|XP_004134889.1|  PREDICTED: subtilisin-like protease SDD1-like    62.0    4e-09   
gb|KGN49497.1|  hypothetical protein Csa_6G526310                     61.6    5e-09   Cucumis sativus [cucumbers]
ref|XP_004158698.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  61.6    5e-09   
gb|KHG07654.1|  Subtilisin-like protease                              61.6    6e-09   Gossypium arboreum [tree cotton]
ref|XP_002529888.1|  conserved hypothetical protein                   58.5    8e-09   
ref|XP_006597917.1|  PREDICTED: subtilisin-like protease SDD1-like    60.8    1e-08   Glycine max [soybeans]
gb|KHN09893.1|  Subtilisin-like protease SDD1                         60.8    1e-08   Glycine soja [wild soybean]
ref|XP_010036631.1|  PREDICTED: subtilisin-like protease              60.5    1e-08   Eucalyptus grandis [rose gum]
ref|XP_007138552.1|  hypothetical protein PHAVU_009G218900g           58.5    6e-08   Phaseolus vulgaris [French bean]
ref|XP_011096735.1|  PREDICTED: subtilisin-like protease SBT3.5       58.5    6e-08   Sesamum indicum [beniseed]
ref|XP_008439503.1|  PREDICTED: subtilisin-like protease              58.2    9e-08   Cucumis melo [Oriental melon]
ref|XP_006363641.1|  PREDICTED: subtilisin-like protease-like         57.4    1e-07   Solanum tuberosum [potatoes]
ref|XP_009804189.1|  PREDICTED: subtilisin-like protease SBT5.3       57.0    2e-07   Nicotiana sylvestris
ref|XP_003630005.1|  Serine protease aprX                             57.4    2e-07   Medicago truncatula
ref|XP_008225702.1|  PREDICTED: subtilisin-like protease              57.0    2e-07   Prunus mume [ume]
ref|XP_004504167.1|  PREDICTED: subtilisin-like protease-like iso...  57.0    2e-07   Cicer arietinum [garbanzo]
ref|XP_011040564.1|  PREDICTED: subtilisin-like protease              56.2    3e-07   Populus euphratica
ref|XP_007022969.1|  Subtilase family protein isoform 2               56.2    4e-07   
ref|XP_003532800.2|  PREDICTED: subtilisin-like protease-like iso...  56.2    4e-07   Glycine max [soybeans]
gb|KHN48113.1|  Subtilisin-like protease                              56.2    4e-07   Glycine soja [wild soybean]
ref|XP_010246696.1|  PREDICTED: subtilisin-like protease              56.2    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009602760.1|  PREDICTED: subtilisin-like protease              55.8    5e-07   Nicotiana tomentosiformis
ref|XP_011460437.1|  PREDICTED: subtilisin-like protease              55.8    5e-07   Fragaria vesca subsp. vesca
ref|XP_006398065.1|  hypothetical protein EUTSA_v10000774mg           55.5    8e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010315640.1|  PREDICTED: subtilisin-like protease isoform X2   55.1    8e-07   Solanum lycopersicum
gb|EYU19074.1|  hypothetical protein MIMGU_mgv1a001321mg              55.1    9e-07   Erythranthe guttata [common monkey flower]
ref|XP_004231572.1|  PREDICTED: subtilisin-like protease isoform X1   55.1    9e-07   Solanum lycopersicum
ref|XP_007211343.1|  hypothetical protein PRUPE_ppa001355mg           55.1    9e-07   Prunus persica
ref|XP_004233183.1|  PREDICTED: subtilisin-like protease              54.7    1e-06   Solanum lycopersicum
ref|XP_002865359.1|  subtilase family protein                         54.7    2e-06   
ref|XP_010098500.1|  Subtilisin-like protease                         54.3    2e-06   Morus notabilis
ref|XP_006353035.1|  PREDICTED: subtilisin-like protease-like         54.3    2e-06   Solanum tuberosum [potatoes]
ref|XP_002317684.2|  subtilase family protein                         54.3    2e-06   
ref|XP_008793537.1|  PREDICTED: subtilisin-like protease isoform X1   53.9    2e-06   Phoenix dactylifera
ref|XP_008793538.1|  PREDICTED: subtilisin-like protease isoform X2   53.9    3e-06   Phoenix dactylifera
ref|NP_568634.1|  Subtilase family protein                            53.5    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006580233.1|  PREDICTED: subtilisin-like protease-like iso...  53.5    3e-06   Glycine max [soybeans]
gb|KFK31649.1|  hypothetical protein AALP_AA6G140700                  53.5    3e-06   Arabis alpina [alpine rockcress]
ref|XP_004488203.1|  PREDICTED: subtilisin-like protease SDD1-like    53.5    3e-06   Cicer arietinum [garbanzo]
emb|CAN60894.1|  hypothetical protein VITISV_019993                   53.1    3e-06   Vitis vinifera
ref|XP_003524240.2|  PREDICTED: subtilisin-like protease-like iso...  53.5    4e-06   Glycine max [soybeans]
gb|KHN06514.1|  Subtilisin-like protease                              53.5    4e-06   Glycine soja [wild soybean]
ref|XP_007159607.1|  hypothetical protein PHAVU_002G251500g           52.0    4e-06   Phaseolus vulgaris [French bean]
ref|XP_010655857.1|  PREDICTED: subtilisin-like protease SDD1         53.1    5e-06   Vitis vinifera
ref|XP_009353895.1|  PREDICTED: subtilisin-like protease              52.8    7e-06   Pyrus x bretschneideri [bai li]
ref|XP_008383350.1|  PREDICTED: subtilisin-like protease              52.4    7e-06   Malus domestica [apple tree]
ref|XP_009796976.1|  PREDICTED: subtilisin-like protease              52.4    8e-06   Nicotiana sylvestris
gb|KEH37751.1|  subtilisin-like serine protease                       52.0    1e-05   Medicago truncatula
ref|XP_007159610.1|  hypothetical protein PHAVU_002G251800g           52.0    1e-05   Phaseolus vulgaris [French bean]
ref|XP_009419011.1|  PREDICTED: subtilisin-like protease              52.0    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907007.1|  PREDICTED: subtilisin-like protease              52.0    1e-05   Elaeis guineensis
emb|CDP12620.1|  unnamed protein product                              52.0    1e-05   Coffea canephora [robusta coffee]
emb|CDY49493.1|  BnaC07g18060D                                        52.0    1e-05   Brassica napus [oilseed rape]
ref|XP_009101701.1|  PREDICTED: subtilisin-like protease isoform X2   51.2    2e-05   Brassica rapa
ref|XP_009101698.1|  PREDICTED: subtilisin-like protease isoform X1   51.2    2e-05   Brassica rapa
ref|XP_006281657.1|  hypothetical protein CARUB_v10027793mg           50.8    2e-05   Capsella rubella
ref|XP_010441875.1|  PREDICTED: subtilisin-like protease              50.8    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY49018.1|  BnaAnng10120D                                        50.8    3e-05   Brassica napus [oilseed rape]
ref|XP_010494483.1|  PREDICTED: subtilisin-like protease              50.4    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010680007.1|  PREDICTED: subtilisin-like protease              50.1    4e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008366897.1|  PREDICTED: subtilisin-like protease              49.3    9e-05   
ref|XP_010519036.1|  PREDICTED: subtilisin-like protease              49.3    9e-05   Tarenaya hassleriana [spider flower]
ref|XP_010484839.1|  PREDICTED: subtilisin-like protease              48.5    2e-04   
ref|XP_009351232.1|  PREDICTED: subtilisin-like protease isoform X2   48.5    2e-04   
ref|XP_009351231.1|  PREDICTED: subtilisin-like protease isoform X1   48.5    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_010529345.1|  PREDICTED: subtilisin-like protease              48.1    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_009403397.1|  PREDICTED: subtilisin-like protease              47.4    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283103.1|  hypothetical protein CARUB_v10004119mg           47.0    5e-04   Capsella rubella



>ref|XP_006370478.1| hypothetical protein POPTR_0001s43080g [Populus trichocarpa]
 gb|ERP67047.1| hypothetical protein POPTR_0001s43080g [Populus trichocarpa]
Length=848

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR++TN  G E+Y VGWSAP GV+ KV PTRFC+ SGE   L    +  MN+S+ S G 
Sbjct  760  VQRSVTNIAGGETYKVGWSAPYGVTIKVAPTRFCIASGERQTLSVFFDAKMNSSTASYGR  819

Query  17   IXLFG  3
            I LFG
Sbjct  820  IGLFG  824



>ref|XP_010040410.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=162

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E+Y VGWSAP GVS KV PTRF + +G++  L  S N  +N+SS + G 
Sbjct  75   VQRTVTNIAGNETYSVGWSAPYGVSMKVAPTRFTIANGQTQVLSVSFNATINSSSATFGR  134

Query  17   IXLFG  3
            I LFG
Sbjct  135  IGLFG  139



>gb|KCW45238.1| hypothetical protein EUGRSUZ_L01115 [Eucalyptus grandis]
Length=177

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E+Y VGWSAP GVS KV PTRF + +G++  L  S N  +N+SS + G 
Sbjct  90   VQRTVTNIAGNETYSVGWSAPYGVSMKVAPTRFTIANGQTQVLSVSFNATINSSSATFGR  149

Query  17   IXLFG  3
            I LFG
Sbjct  150  IGLFG  154



>ref|XP_011004882.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=847

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR++TN  G E+Y VGWSAP GV+ KV PTRFC+ SGE   L    +  MN+S+ S G 
Sbjct  759  VQRSVTNIAGYETYRVGWSAPYGVTIKVAPTRFCIASGERQTLSVFFDAKMNSSTASYGR  818

Query  17   IXLFG  3
            I LFG
Sbjct  819  IGLFG  823



>gb|KDP34877.1| hypothetical protein JCGZ_09165 [Jatropha curcas]
Length=843

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G ESY VGWSAP GV+ KV PT F + SGE L L    N  MN++    G 
Sbjct  756  VQRTVTNIAGNESYNVGWSAPYGVAVKVAPTHFTIASGEKLVLNIMLNATMNSTVAGYGR  815

Query  17   IXLFG  3
            I LFG
Sbjct  816  IGLFG  820



>ref|XP_006448798.1| hypothetical protein CICLE_v10014244mg [Citrus clementina]
 gb|ESR62038.1| hypothetical protein CICLE_v10014244mg [Citrus clementina]
Length=858

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTLTN  G E+Y VGWSAP GVS KV PT F + SGE   L    N   + ++ S G 
Sbjct  770  VQRTLTNIAGNETYSVGWSAPYGVSMKVSPTHFSIASGEKQVLNVFFNATTSGTAASFGR  829

Query  17   IXLFG  3
            I LFG
Sbjct  830  IGLFG  834



>gb|KDO77536.1| hypothetical protein CISIN_1g003005mg [Citrus sinensis]
Length=858

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTLTN  G E+Y VGWSAP GVS KV PT F + SGE   L    N   + ++ S G 
Sbjct  770  VQRTLTNIAGNETYSVGWSAPYGVSMKVSPTHFSIASGEKQVLNVFFNATTSGTAASFGR  829

Query  17   IXLFG  3
            I LFG
Sbjct  830  IGLFG  834



>gb|KHN29777.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=849

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N    ESY VGW+AP GVS KV PT FC+GSGE   L    N  +++S  S G 
Sbjct  762  VQRTVQNIAQNESYSVGWTAPNGVSVKVSPTHFCIGSGERQVLSVLLNATLSSSVASFGR  821

Query  17   IXLFG  3
            I LFG
Sbjct  822  IGLFG  826



>ref|XP_006468393.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=858

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTLTN  G E+Y VGWSAP GVS KV PT F + SGE   L    N   + ++ S G 
Sbjct  770  VQRTLTNIAGNETYSVGWSAPFGVSMKVSPTHFSIASGEKQVLNVFFNATTSGTAASFGR  829

Query  17   IXLFG  3
            I LFG
Sbjct  830  IGLFG  834



>ref|XP_006587105.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=849

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N    ESY VGW+AP GVS KV PT FC+GSGE   L    N  +++S  S G 
Sbjct  762  VQRTVQNIAQNESYSVGWTAPNGVSVKVSPTHFCIGSGERQVLSVLLNATLSSSVASFGR  821

Query  17   IXLFG  3
            I LFG
Sbjct  822  IGLFG  826



>gb|KJB56362.1| hypothetical protein B456_009G116500 [Gossypium raimondii]
Length=847

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V+RT+TN  G E+Y VGWSAP GVS KV PTRF +G+GE   L    N  MNNS  S G 
Sbjct  766  VERTVTNIAGNETYKVGWSAPYGVSVKVTPTRFFIGTGEKQILTIMFNATMNNSVASFGR  825

Query  17   IXLFG  3
            I LFG
Sbjct  826  IGLFG  830



>ref|XP_004134889.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=859

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E Y VGWSAP G+S KV P RF +GSGE   L    N  MN+S  S G 
Sbjct  757  VQRTVTNIAGPEFYSVGWSAPYGISLKVSPIRFTIGSGEKQELTIFFNSTMNSSVASFGR  816

Query  17   IXLFG  3
            I LFG
Sbjct  817  IGLFG  821



>gb|KGN49497.1| hypothetical protein Csa_6G526310 [Cucumis sativus]
Length=842

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E Y VGWSAP G+S KV P RF +GSGE   L    N  MN+S  S G 
Sbjct  755  VQRTVTNIAGPEFYSVGWSAPYGISLKVSPIRFTIGSGEKQELTIFFNSTMNSSVASFGR  814

Query  17   IXLFG  3
            I LFG
Sbjct  815  IGLFG  819



>ref|XP_004158698.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1-like 
[Cucumis sativus]
Length=842

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E Y VGWSAP G+S KV P RF +GSGE   L    N  MN+S  S G 
Sbjct  755  VQRTVTNIAGPEFYSVGWSAPYGISLKVSPIRFTIGSGEKQELTIFFNSTMNSSVASFGR  814

Query  17   IXLFG  3
            I LFG
Sbjct  815  IGLFG  819



>gb|KHG07654.1| Subtilisin-like protease [Gossypium arboreum]
Length=847

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V+RT+TN  G E+Y VGWSAP GVS KV PTRF +G+GE   L    N  MNNS  S G 
Sbjct  766  VERTVTNIAGNETYKVGWSAPYGVSVKVTPTRFFIGTGEKQILTIMFNATMNNSVASFGR  825

Query  17   IXLFG  3
            I LFG
Sbjct  826  IGLFG  830



>ref|XP_002529888.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32491.1| conserved hypothetical protein [Ricinus communis]
Length=231

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E+Y VGWSAP GVS KV PT F + SGE   L    N  MN+S  S G 
Sbjct  144  VQRTITNIAGNETYSVGWSAPYGVSVKVAPTHFSICSGEKQVLNIMINATMNSSVTSFGR  203

Query  17   IXLFG  3
            I LFG
Sbjct  204  IGLFG  208



>ref|XP_006597917.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=888

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N    ESY VGW+AP GVS KV PT FC+ SGES  L    N  +N+S  S G 
Sbjct  801  VQRTVQNVAQNESYSVGWTAPYGVSVKVSPTHFCIPSGESQVLSVLLNATLNSSVASFGR  860

Query  17   IXLFG  3
            I LFG
Sbjct  861  IGLFG  865



>gb|KHN09893.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=888

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N    ESY VGW+AP GVS KV PT FC+ SGES  L    N  +N+S  S G 
Sbjct  801  VQRTVQNVAQNESYSVGWTAPYGVSVKVSPTHFCIPSGESQVLSVLLNATLNSSVASFGR  860

Query  17   IXLFG  3
            I LFG
Sbjct  861  IGLFG  865



>ref|XP_010036631.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW48241.1| hypothetical protein EUGRSUZ_K01967 [Eucalyptus grandis]
Length=845

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN  G E+Y VGWSAP GVS KV PTRF + +G+   L  S N  +N+SS + G 
Sbjct  758  VQRTVTNIAGNETYSVGWSAPYGVSMKVAPTRFTIANGQRQVLSVSFNATINSSSATFGR  817

Query  17   IXLFG  3
            I LFG
Sbjct  818  IGLFG  822



>ref|XP_007138552.1| hypothetical protein PHAVU_009G218900g [Phaseolus vulgaris]
 gb|ESW10546.1| hypothetical protein PHAVU_009G218900g [Phaseolus vulgaris]
Length=850

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N    ESY VGW+AP GVS KV PT FC+GSGE   L    N  +N+S  S G 
Sbjct  763  VLRTVQNTAQNESYSVGWTAPYGVSLKVSPTHFCIGSGERQVLSVFLNATVNSSVSSFGR  822

Query  17   IXLFG  3
            I LFG
Sbjct  823  IGLFG  827



>ref|XP_011096735.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=842

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN G  E+Y VGWSAP G S KV PT F + SGE   L    N  MN++  S G 
Sbjct  755  VQRTVTNIGSNETYSVGWSAPYGASVKVTPTHFSIASGEKQVLSVLFNTTMNSTVASFGR  814

Query  17   IXLFG  3
            I LFG
Sbjct  815  IGLFG  819



>ref|XP_008439503.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=842

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V+RT+TN  G E Y VGWSAP G+S KV P RF + SGE   L    N  MN+S  S G 
Sbjct  755  VRRTVTNIAGPEFYSVGWSAPYGISLKVSPVRFTISSGEKQELTIFFNATMNSSVASFGR  814

Query  17   IXLFG  3
            I LFG
Sbjct  815  IGLFG  819



>ref|XP_006363641.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=838

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR LTN  G E+Y+VGWSAP GVS KV P RF V SG+   L    N  MN+++PS G 
Sbjct  751  VQRMLTNIAGNETYIVGWSAPNGVSIKVTPKRFFVASGQQQILNVFLNATMNSTTPSFGR  810

Query  17   IXLFG  3
            I L G
Sbjct  811  IGLVG  815



>ref|XP_009804189.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=443

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR +TN  G E+Y+VGWSAP GVS KV P RF V SG+   L    N  MNNS+ S G 
Sbjct  356  VQRAMTNIAGNETYIVGWSAPYGVSVKVIPKRFFVASGQQQVLNVFFNATMNNSTASFGR  415

Query  17   IXLFG  3
            I L G
Sbjct  416  IGLVG  420



>ref|XP_003630005.1| Serine protease aprX [Medicago truncatula]
 gb|AET04481.1| subtilisin-like serine protease [Medicago truncatula]
Length=851

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTL N    E+Y VGWS+P GVS KV PTRF + +GE   L    N   N+S+ S G 
Sbjct  769  VQRTLQNIAENETYSVGWSSPYGVSVKVSPTRFSLANGERQVLSVIFNATSNSSTASFGR  828

Query  17   IXLFG  3
            I LFG
Sbjct  829  IGLFG  833



>ref|XP_008225702.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=846

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V R++TN GG E+Y VGWSAP GVS KV P  F + SGE   L    N   N+++ S G 
Sbjct  759  VLRSVTNVGGNETYSVGWSAPFGVSVKVSPAHFYIASGEKQVLSVFFNSTANSTTASYGR  818

Query  17   IXLFG  3
            I LFG
Sbjct  819  IGLFG  823



>ref|XP_004504167.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004504168.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=856

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N    E+Y VGWS+P GVS KV PTRF +  GE+  L    N   N+S  S G 
Sbjct  774  VQRTIQNIAESETYSVGWSSPYGVSVKVTPTRFSIDKGETQVLSVIFNATTNSSIASFGR  833

Query  17   IXLFG  3
            I LFG
Sbjct  834  IGLFG  838



>ref|XP_011040564.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=848

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V+R++TN  G E+Y VGWSAP GV+ KV P RF + SGE   L    +  MN+S+ S G 
Sbjct  760  VRRSVTNIAGNETYKVGWSAPYGVTVKVVPARFSIASGERQVLSVFFDAIMNSSTASHGR  819

Query  17   IXLFG  3
            I LFG
Sbjct  820  IGLFG  824



>ref|XP_007022969.1| Subtilase family protein isoform 2 [Theobroma cacao]
 gb|EOY25591.1| Subtilase family protein isoform 2 [Theobroma cacao]
Length=843

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V R++TN  G E+Y VGWSAP GVS KV PT F +G+GE   L    N  MNN S S G 
Sbjct  756  VLRSVTNIAGNETYKVGWSAPYGVSMKVSPTHFFIGTGEKQVLTIIFNATMNNISASFGR  815

Query  17   IXLFG  3
            I LFG
Sbjct  816  IGLFG  820



>ref|XP_003532800.2| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006585227.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=843

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N  G E+Y VGWSAP G S KV P  F + SGE L L    N   N+S+ S G 
Sbjct  762  VQRTIQNIAGNETYNVGWSAPYGTSMKVFPNHFSLASGERLVLSVIFNATSNSSAASYGR  821

Query  17   IXLFG  3
            I L+G
Sbjct  822  IGLYG  826



>gb|KHN48113.1| Subtilisin-like protease [Glycine soja]
Length=843

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N  G E+Y VGWSAP G S KV P  F + SGE L L    N   N+S+ S G 
Sbjct  762  VQRTIQNIAGNETYNVGWSAPYGTSMKVFPNHFSLASGERLVLSVIFNATSNSSAASYGR  821

Query  17   IXLFG  3
            I L+G
Sbjct  822  IGLYG  826



>ref|XP_010246696.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=840

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR +TN  G E+Y VGWSAP GVS  V PTRF +  G+  +L    N  MN+S  S G 
Sbjct  753  VQRVVTNIAGNETYNVGWSAPYGVSVLVSPTRFFIAGGQKQDLTVQFNATMNSSFASFGR  812

Query  17   IXLFG  3
            I LFG
Sbjct  813  IGLFG  817



>ref|XP_009602760.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=853

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTL N  G E+Y VGWSAP GVS  V P RF + SG+   L    N   NN++PS G 
Sbjct  766  VQRTLINIAGNETYAVGWSAPYGVSINVTPARFFIASGQQQVLNFVFNATKNNTAPSYGR  825

Query  17   IXLFG  3
            I LFG
Sbjct  826  IGLFG  830



>ref|XP_011460437.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=845

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N  G ESY VGWSAP GVS KV P+ F + SGE+  L    N   N+++ S G 
Sbjct  757  VLRTVINVAGNESYSVGWSAPFGVSLKVSPSHFYIASGETQVLSVFFNATSNSAAASYGR  816

Query  17   IXLFG  3
            I LFG
Sbjct  817  IGLFG  821



>ref|XP_006398065.1| hypothetical protein EUTSA_v10000774mg [Eutrema salsugineum]
 gb|ESQ39518.1| hypothetical protein EUTSA_v10000774mg [Eutrema salsugineum]
Length=859

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR++ N GG E+Y VGWS P GVS KV PT+F +  G++  L  +     N+SS S G 
Sbjct  776  VQRSMRNIGGNETYNVGWSPPYGVSMKVDPTQFSIAMGDTQVLSVTLKAIKNSSSSSFGR  835

Query  17   IXLFG  3
            I LFG
Sbjct  836  IGLFG  840



>ref|XP_010315640.1| PREDICTED: subtilisin-like protease isoform X2 [Solanum lycopersicum]
Length=773

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR LTN  G E+Y+VGWSAP GVS KV P RF V S +   L    N  MN+++PS G 
Sbjct  686  VQRMLTNIAGNETYIVGWSAPNGVSVKVNPKRFFVASAQQQILNVFLNATMNSTTPSFGR  745

Query  17   IXLFG  3
            I L G
Sbjct  746  IGLVG  750



>gb|EYU19074.1| hypothetical protein MIMGU_mgv1a001321mg [Erythranthe guttata]
Length=840

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR +TN G  E+Y +GWSAP G + +V P+RF + SGE   L    N  MN+S  S G 
Sbjct  753  VQRIVTNVGSNETYTIGWSAPYGATVRVSPSRFSIASGEKQVLTVLLNATMNSSIASYGR  812

Query  17   IXLFG  3
            I +FG
Sbjct  813  IGVFG  817



>ref|XP_004231572.1| PREDICTED: subtilisin-like protease isoform X1 [Solanum lycopersicum]
Length=838

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR LTN  G E+Y+VGWSAP GVS KV P RF V S +   L    N  MN+++PS G 
Sbjct  751  VQRMLTNIAGNETYIVGWSAPNGVSVKVNPKRFFVASAQQQILNVFLNATMNSTTPSFGR  810

Query  17   IXLFG  3
            I L G
Sbjct  811  IGLVG  815



>ref|XP_007211343.1| hypothetical protein PRUPE_ppa001355mg [Prunus persica]
 gb|EMJ12542.1| hypothetical protein PRUPE_ppa001355mg [Prunus persica]
Length=846

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V R++ N GG E+Y VGWSAP GVS KV P  F + SGE   L    N   N+++ S G 
Sbjct  759  VLRSVMNVGGNETYSVGWSAPFGVSVKVSPAHFYIASGEKQVLSVFFNSTANSTTASYGR  818

Query  17   IXLFG  3
            I LFG
Sbjct  819  IGLFG  823



>ref|XP_004233183.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=854

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTL N    E+YVVGWSAP G S KV P RF +  G+   L    N  MNNSSPS G 
Sbjct  767  VQRTLINIAANETYVVGWSAPYGASMKVTPARFFIACGQQQVLSVDFNATMNNSSPSFGR  826

Query  17   IXLFG  3
            I LFG
Sbjct  827  IGLFG  831



>ref|XP_002865359.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41618.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=841

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            QR++ N  G E+Y VGWS P GVS KV PT+F +  GE+  L  +     N+SS S G I
Sbjct  759  QRSMRNIAGNETYNVGWSPPYGVSMKVSPTQFSIAMGETQVLSVTLTATKNSSSSSFGRI  818

Query  14   XLFG  3
             LFG
Sbjct  819  GLFG  822



>ref|XP_010098500.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB75160.1| Subtilisin-like protease [Morus notabilis]
Length=841

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+TN    ++Y VGWSAP GVS KV PT F + SG+   L    N  +NNS  S G 
Sbjct  754  VQRTVTNIAEDDTYSVGWSAPYGVSAKVSPTHFYIASGQKQVLTIVLNAILNNSVASFGR  813

Query  17   IXLFG  3
            I LFG
Sbjct  814  IGLFG  818



>ref|XP_006353035.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=854

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTL N    E+YVVGWSAP G S KV P RF +  G+   L    N  MNNSSPS G 
Sbjct  767  VQRTLINIAANETYVVGWSAPYGASIKVTPARFFIACGQQQVLNVDFNATMNNSSPSFGR  826

Query  17   IXLFG  3
            I LFG
Sbjct  827  IGLFG  831



>ref|XP_002317684.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98296.2| subtilase family protein [Populus trichocarpa]
Length=840

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR++TN  G E+Y VGWSAP GV+ KV P  F + SGE   L    +  MN+S+ S G 
Sbjct  752  VQRSVTNIAGNETYKVGWSAPYGVTVKVVPACFSIASGERQVLSVFFDAIMNSSTASHGR  811

Query  17   IXLFG  3
            I LFG
Sbjct  812  IGLFG  816



>ref|XP_008793537.1| PREDICTED: subtilisin-like protease isoform X1 [Phoenix dactylifera]
Length=837

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            + RT+TN    E+Y V WSAP GVS  V PTRF + SG+  NL    N  MN++S   G 
Sbjct  750  IARTVTNIANDETYSVSWSAPFGVSVSVAPTRFFIASGQKQNLTVVLNATMNSTSAGFGK  809

Query  17   IXLFG  3
            I L+G
Sbjct  810  IGLYG  814



>ref|XP_008793538.1| PREDICTED: subtilisin-like protease isoform X2 [Phoenix dactylifera]
Length=771

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            + RT+TN    E+Y V WSAP GVS  V PTRF + SG+  NL    N  MN++S   G 
Sbjct  684  IARTVTNIANDETYSVSWSAPFGVSVSVAPTRFFIASGQKQNLTVVLNATMNSTSAGFGK  743

Query  17   IXLFG  3
            I L+G
Sbjct  744  IGLYG  748



>ref|NP_568634.1| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB09160.1| serine proteinase [Arabidopsis thaliana]
 gb|AAT41839.1| At5g44530 [Arabidopsis thaliana]
 dbj|BAF02261.1| serine proteinase [Arabidopsis thaliana]
 gb|AED95120.1| Subtilase family protein [Arabidopsis thaliana]
Length=840

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            QR++ N  G E+Y VGWS P GVS KV PT+F +  GE+  L  +  V  N+SS S G I
Sbjct  758  QRSMRNIAGNETYNVGWSPPYGVSMKVSPTQFSIAMGENQVLSVTLTVTKNSSSSSFGRI  817

Query  14   XLFG  3
             LFG
Sbjct  818  GLFG  821



>ref|XP_006580233.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=829

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR + N  G E+Y VGWSAP G S KV P  F + SGE L L    NV  N+S+ S G 
Sbjct  748  VQRIIQNIAGNETYNVGWSAPYGTSMKVSPNYFSLASGERLVLSVIFNVTNNSSAASYGR  807

Query  17   IXLFG  3
            I L+G
Sbjct  808  IGLYG  812



>gb|KFK31649.1| hypothetical protein AALP_AA6G140700 [Arabis alpina]
Length=855

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            +R++ N  G E+Y VGWS P GVS KV PT+F +  GE+  L  + N   N+SS S G I
Sbjct  773  RRSMKNIAGNETYNVGWSPPYGVSMKVSPTQFSIAMGETQTLSVTLNATKNSSSSSFGRI  832

Query  14   XLFG  3
             LFG
Sbjct  833  GLFG  836



>ref|XP_004488203.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=852

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  197  VQRTLTN-XGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXG  21
            VQRT+ N   G E+Y VGWSAP GVS KV PT F + +GE   L    N  +N+S  S G
Sbjct  762  VQRTVQNIAAGNETYSVGWSAPFGVSMKVTPTHFSIANGEKQLLSVILNATINSSVASFG  821

Query  20   XIXLFG  3
             I LFG
Sbjct  822  RIGLFG  827



>emb|CAN60894.1| hypothetical protein VITISV_019993 [Vitis vinifera]
Length=591

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR +TN    E+Y+VGWSAP GVS  V PT F +  GE+  L  + +  MN+++ S G 
Sbjct  504  VQRRVTNVDRNETYIVGWSAPYGVSVNVVPTHFFIACGETQTLTVTLSATMNSTAASFGR  563

Query  17   IXLFG  3
            I L G
Sbjct  564  IGLVG  568



>ref|XP_003524240.2| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=856

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR + N  G E+Y VGWSAP G S KV P  F + SGE L L    NV  N+S+ S G 
Sbjct  775  VQRIIQNIAGNETYNVGWSAPYGTSMKVSPNYFSLASGERLVLSVIFNVTNNSSAASYGR  834

Query  17   IXLFG  3
            I L+G
Sbjct  835  IGLYG  839



>gb|KHN06514.1| Subtilisin-like protease [Glycine soja]
Length=922

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR + N  G E+Y VGWSAP G S KV P  F + SGE L L    NV  N+S+ S G 
Sbjct  841  VQRIIQNIAGNETYNVGWSAPYGTSMKVSPNYFSLASGERLVLSVIFNVTNNSSAASYGR  900

Query  17   IXLFG  3
            I L+G
Sbjct  901  IGLYG  905



>ref|XP_007159607.1| hypothetical protein PHAVU_002G251500g [Phaseolus vulgaris]
 gb|ESW31601.1| hypothetical protein PHAVU_002G251500g [Phaseolus vulgaris]
Length=283

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N  G E+Y VG+SAP G S KV P  F +GSGE   L    N   N+S+ S G 
Sbjct  202  VQRTIQNIAGNETYNVGFSAPYGTSMKVSPNHFSLGSGERQVLSVIFNATSNSSAASYGR  261

Query  17   IXLFG  3
            I L+G
Sbjct  262  IGLYG  266



>ref|XP_010655857.1| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
 emb|CBI39006.3| unnamed protein product [Vitis vinifera]
Length=842

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR +TN    E+Y+VGWSAP GVS  V PT F +  GE+  L  + +  MN+++ S G 
Sbjct  755  VQRRVTNVDSNETYIVGWSAPYGVSVNVVPTHFFIACGETQTLTVTLSATMNSTAASFGR  814

Query  17   IXLFG  3
            I L G
Sbjct  815  IGLVG  819



>ref|XP_009353895.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N    E+Y VGWSAP GVS KV P  F + SGE+  L    N   N+++ S G 
Sbjct  758  VLRTVRNVAANETYSVGWSAPFGVSLKVSPLHFSIASGETQVLSVFVNATSNSTTASYGR  817

Query  17   IXLFG  3
            I LFG
Sbjct  818  IGLFG  822



>ref|XP_008383350.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=846

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N    E+Y VGWSAP GVS KV P  F + SGE+  L    N   N+++ S G 
Sbjct  758  VLRTVRNVAANETYSVGWSAPFGVSLKVSPLHFSIASGETQVLSVFVNATSNSTTASYGR  817

Query  17   IXLFG  3
            I LFG
Sbjct  818  IGLFG  822



>ref|XP_009796976.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=854

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRTL N  G E+Y VGWSAP G S  V P  F + SG+   L    N   NN++PS G 
Sbjct  767  VQRTLINIAGNETYAVGWSAPYGASINVTPAHFFIASGQQQVLNVVFNATKNNTAPSYGR  826

Query  17   IXLFG  3
            I LFG
Sbjct  827  IGLFG  831



>gb|KEH37751.1| subtilisin-like serine protease [Medicago truncatula]
Length=850

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -2

Query  197  VQRTLTN-XGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXG  21
            +QRT+ N  G  E+Y VGWSAP GVS KV PT F + +GE   L    N   NNS  S G
Sbjct  761  LQRTVQNIAGNNETYSVGWSAPFGVSVKVTPTHFSIANGEKQVLSVILNATANNSVASFG  820

Query  20   XIXLFG  3
             I LFG
Sbjct  821  KIGLFG  826



>ref|XP_007159610.1| hypothetical protein PHAVU_002G251800g [Phaseolus vulgaris]
 gb|ESW31604.1| hypothetical protein PHAVU_002G251800g [Phaseolus vulgaris]
Length=852

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQRT+ N  G E+Y VG+SAP G S KV P  F +GSGE   L    N   N+S+ S G 
Sbjct  771  VQRTIQNIAGNETYNVGFSAPYGTSMKVSPNHFSLGSGERQVLSVIFNATSNSSAASYGR  830

Query  17   IXLFG  3
            I L+G
Sbjct  831  IGLYG  835



>ref|XP_009419011.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=841

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            + R +TN    E Y V WSAP GVS  V PTRF + SG+  NL       MN++S S G 
Sbjct  750  IMRRVTNIANDEHYSVSWSAPYGVSVSVSPTRFFIASGQQQNLTIVLGSTMNSTSASFGG  809

Query  17   IXLFG  3
            I L+G
Sbjct  810  IGLYG  814



>ref|XP_010907007.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=837

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+TN    E+Y V WSAP GV   V PTRF + SG+  NL    N  MN++SPS G 
Sbjct  750  VTRTMTNIANDETYSVSWSAPFGVLVSVAPTRFFIASGQKQNLTVVLNATMNSTSPSFGK  809

Query  17   IXLFG  3
            I L+G
Sbjct  810  IGLYG  814



>emb|CDP12620.1| unnamed protein product [Coffea canephora]
Length=851

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR  TN G  E+Y VGW AP GV+ KV PT F + SGE   L  S    +N+++ S G 
Sbjct  759  VQRLATNIGANETYSVGWFAPYGVTLKVSPTHFSLASGERQVLNVSFTAQINSTAASFGR  818

Query  17   IXLFG  3
            I +FG
Sbjct  819  IGIFG  823



>emb|CDY49493.1| BnaC07g18060D [Brassica napus]
Length=862

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            +R++ N  G E+Y VGWS P GVS KV P+ F +G+GE+  L  +     N+SS S G I
Sbjct  780  KRSVRNIAGNETYNVGWSPPYGVSMKVSPSLFSIGTGETQVLSITLEPTKNSSSSSFGRI  839

Query  14   XLFG  3
             LFG
Sbjct  840  GLFG  843



>ref|XP_009101701.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=855

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            +R + N  G E+Y VGWS P GVS KV P +F +G+GE+  L  +     N+SS S G I
Sbjct  773  KRWVRNIAGNETYNVGWSPPYGVSMKVSPAQFSIGTGETQVLSITLEPTKNSSSSSFGRI  832

Query  14   XLFG  3
             LFG
Sbjct  833  GLFG  836



>ref|XP_009101698.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
 ref|XP_009101699.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
 ref|XP_009101700.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=859

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            +R + N  G E+Y VGWS P GVS KV P +F +G+GE+  L  +     N+SS S G I
Sbjct  777  KRWVRNIAGNETYNVGWSPPYGVSMKVSPAQFSIGTGETQVLSITLEPTKNSSSSSFGRI  836

Query  14   XLFG  3
             LFG
Sbjct  837  GLFG  840



>ref|XP_006281657.1| hypothetical protein CARUB_v10027793mg [Capsella rubella]
 gb|EOA14555.1| hypothetical protein CARUB_v10027793mg [Capsella rubella]
Length=845

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            QR++ +  G E+Y VGWS P GVS KV P  F +G GE+  L  + N   N+SS S G I
Sbjct  763  QRSIRSIAGNETYNVGWSPPYGVSMKVSPNMFSIGMGETQLLSVTLNATKNSSSSSFGRI  822

Query  14   XLFG  3
             LFG
Sbjct  823  GLFG  826



>ref|XP_010441875.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010441876.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=845

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            QR++ N  G E+Y VGWS P GVS K+ P  F +G GE+  L  + N   N+SS S G I
Sbjct  763  QRSVRNIAGNETYNVGWSPPYGVSMKISPGLFSIGLGETQVLSITLNATKNSSSSSFGRI  822

Query  14   XLFG  3
             LFG
Sbjct  823  GLFG  826



>emb|CDY49018.1| BnaAnng10120D [Brassica napus]
Length=859

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            +R + N  G E+Y VGWS P GVS KV P +F +G+GE+  L  +     N+SS S G I
Sbjct  777  KRWVRNIAGNETYNVGWSPPYGVSMKVSPAQFSIGTGETQILSITLEPTKNSSSSSFGRI  836

Query  14   XLFG  3
             LFG
Sbjct  837  GLFG  840



>ref|XP_010494483.1| PREDICTED: subtilisin-like protease [Camelina sativa]
 ref|XP_010494484.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=845

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            QR++ N  G E+Y VGWS P GVS KV P  F +G GE+  L  + N   N+SS S G I
Sbjct  763  QRSVRNIAGNETYNVGWSPPYGVSMKVSPGLFSIGLGETQVLIITLNATKNSSSYSFGRI  822

Query  14   XLFG  3
             LFG
Sbjct  823  GLFG  826



>ref|XP_010680007.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=838

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RTL N G  ES+ VGW AP GVS KV P+ F + +GE   L  S N   N+++   G 
Sbjct  756  VNRTLLNVGVNESFRVGWGAPYGVSVKVIPSYFYIAAGEKQVLTVSMNATRNDTTAGYGR  815

Query  17   IXLFG  3
            I LFG
Sbjct  816  IGLFG  820



>ref|XP_008366897.1| PREDICTED: subtilisin-like protease, partial [Malus domestica]
Length=827

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N    E+Y VGWSAP GVS KV P  F + SGE+  L    N   N+++ S G 
Sbjct  739  VLRTVRNIAENETYTVGWSAPFGVSLKVSPLNFSIASGETQILSVFVNATGNSTTASYGS  798

Query  17   IXLFG  3
            + L G
Sbjct  799  VGLLG  803



>ref|XP_010519036.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=832

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V R++TN  G E+Y VG+ AP  VS KV PTRF + +GE+  L        N S  S G 
Sbjct  750  VLRSVTNVAGTETYNVGYMAPDSVSVKVSPTRFSIRNGETRVLRFDFRARKNVSVASFGK  809

Query  17   IXLFG  3
            I LFG
Sbjct  810  IGLFG  814



>ref|XP_010484839.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=835

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  QRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGXI  15
            QR++ N    E+Y VGWS P GVS KV P  F +G GE+  L  + N   N+SS S G I
Sbjct  753  QRSVRNIAENETYNVGWSPPYGVSMKVSPGLFSIGLGETQVLSITLNATKNSSSSSFGRI  812

Query  14   XLFG  3
             LFG
Sbjct  813  GLFG  816



>ref|XP_009351232.1| PREDICTED: subtilisin-like protease isoform X2 [Pyrus x bretschneideri]
Length=814

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N    E+Y VGWSAP GVS +V P  F + SGE+  L    N   N+++ S G 
Sbjct  726  VLRTVRNIAENETYTVGWSAPFGVSLRVSPLNFSIASGETQVLSVFVNATGNSTTASYGS  785

Query  17   IXLFG  3
            + L G
Sbjct  786  VGLLG  790



>ref|XP_009351231.1| PREDICTED: subtilisin-like protease isoform X1 [Pyrus x bretschneideri]
Length=846

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            V RT+ N    E+Y VGWSAP GVS +V P  F + SGE+  L    N   N+++ S G 
Sbjct  758  VLRTVRNIAENETYTVGWSAPFGVSLRVSPLNFSIASGETQVLSVFVNATGNSTTASYGS  817

Query  17   IXLFG  3
            + L G
Sbjct  818  VGLLG  822



>ref|XP_010529345.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=856

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            + R + N    E+Y VGWS P GVS KV PTRF + SG +  L  + +   N+S+ S G 
Sbjct  773  ILRLMANVAVNETYSVGWSPPYGVSMKVSPTRFSIASGGTQLLNVTLDASKNSSNASFGR  832

Query  17   IXLFG  3
            I LFG
Sbjct  833  IGLFG  837



>ref|XP_009403397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=842

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            + RT+TN    E Y V WSAP G S  V P +F V SG+  NL    N  MN+S  S G 
Sbjct  751  IVRTVTNVANDEYYHVSWSAPFGASVSVAPAQFFVASGQQQNLTIVLNATMNSSFASFGS  810

Query  17   IXLFG  3
            I L+G
Sbjct  811  IGLYG  815



>ref|XP_006283103.1| hypothetical protein CARUB_v10004119mg [Capsella rubella]
 gb|EOA16001.1| hypothetical protein CARUB_v10004119mg [Capsella rubella]
Length=854

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VQRTLTNXGGXESYVVGWSAPXGVSXKVXPTRFCVGSGESLNLXXsxnvxmnnsspSXGX  18
            VQR LTN  G E+Y VG   P  V  KV PT+F + SGE+  L        N+S  S G 
Sbjct  770  VQRLLTNIAGNETYNVGLVTPFDVLMKVSPTQFSIASGETQLLSVILTAKKNSSLASFGG  829

Query  17   IXLFG  3
            I LFG
Sbjct  830  IKLFG  834



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561488607120