BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023G17

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           328   9e-107   Solanum lycopersicum
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           327   1e-106   Nicotiana tomentosiformis
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           327   2e-106   Nicotiana sylvestris
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      323   6e-105   Solanum tuberosum [potatoes]
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           319   2e-103   Sesamum indicum [beniseed]
emb|CDP09891.1|  unnamed protein product                                318   6e-103   Coffea canephora [robusta coffee]
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                317   2e-102   Erythranthe guttata [common monkey flower]
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             306   2e-98    Eutrema salsugineum [saltwater cress]
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      306   3e-98    Solanum tuberosum [potatoes]
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             305   4e-98    Capsella rubella
emb|CDY67756.1|  BnaA03g56770D                                          305   5e-98    Brassica napus [oilseed rape]
emb|CDX95646.1|  BnaC03g25270D                                          305   5e-98    
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           305   6e-98    Brassica rapa
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    305   7e-98    Arabis alpina [alpine rockcress]
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    305   1e-97    Arabidopsis lyrata subsp. lyrata
gb|EYU31982.1|  hypothetical protein MIMGU_mgv1a012102mg                298   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           304   2e-97    Solanum lycopersicum
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       303   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             302   5e-97    
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           302   8e-97    Cucumis melo [Oriental melon]
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           302   9e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      302   1e-96    
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      302   1e-96    
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      301   1e-96    
emb|CDO97699.1|  unnamed protein product                                301   2e-96    Coffea canephora [robusta coffee]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      300   3e-96    Solanum tuberosum [potatoes]
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      300   4e-96    Camelina sativa [gold-of-pleasure]
gb|KJB25649.1|  hypothetical protein B456_004G202200                    300   4e-96    Gossypium raimondii
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             300   5e-96    Citrus clementina [clementine]
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      300   7e-96    Sesamum indicum [beniseed]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           300   8e-96    Nicotiana tomentosiformis
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           299   9e-96    
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         299   9e-96    Jatropha curcas
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      299   1e-95    Nicotiana sylvestris
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      299   1e-95    Eucalyptus grandis [rose gum]
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      299   1e-95    Solanum lycopersicum
emb|CAN73016.1|  hypothetical protein VITISV_004388                     299   1e-95    Vitis vinifera
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    299   2e-95    Tarenaya hassleriana [spider flower]
gb|KHN25558.1|  UDP-glucuronate 4-epimerase 3                           293   2e-95    Glycine soja [wild soybean]
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      299   2e-95    Morus notabilis
dbj|BAF00333.1|  putative nucleotide sugar epimerase                    293   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      298   3e-95    Solanum lycopersicum
gb|KGN57287.1|  hypothetical protein Csa_3G176330                       292   4e-95    Cucumis sativus [cucumbers]
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      298   4e-95    Nicotiana sylvestris
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           297   6e-95    Tarenaya hassleriana [spider flower]
gb|KJB09908.1|  hypothetical protein B456_001G174300                    297   8e-95    Gossypium raimondii
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           297   9e-95    Nicotiana tomentosiformis
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           297   9e-95    Prunus mume [ume]
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       296   2e-94    Gossypium hirsutum [American cotton]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     295   3e-94    Populus trichocarpa [western balsam poplar]
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           295   3e-94    Populus euphratica
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      295   3e-94    Nicotiana tomentosiformis
gb|KJB72008.1|  hypothetical protein B456_011G153500                    296   3e-94    Gossypium raimondii
gb|KJB41101.1|  hypothetical protein B456_007G090500                    295   4e-94    Gossypium raimondii
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      295   4e-94    Vitis vinifera
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    295   5e-94    Arabis alpina [alpine rockcress]
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      293   5e-94    Tarenaya hassleriana [spider flower]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           294   5e-94    Medicago truncatula
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             295   5e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      295   6e-94    Vitis vinifera
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    295   6e-94    
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         294   9e-94    Jatropha curcas
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    294   1e-93    Arabis alpina [alpine rockcress]
emb|CDY63064.1|  BnaAnng18570D                                          294   1e-93    Brassica napus [oilseed rape]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      294   1e-93    Morus notabilis
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    295   1e-93    Theobroma cacao [chocolate]
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      295   1e-93    Populus euphratica
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      294   2e-93    Populus euphratica
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      293   2e-93    Sesamum indicum [beniseed]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           293   2e-93    Brassica rapa
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630          293   3e-93    Amborella trichopoda
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      294   3e-93    Populus euphratica
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    292   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           293   3e-93    Eucalyptus grandis [rose gum]
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             292   4e-93    Capsella rubella
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           293   4e-93    Fragaria vesca subsp. vesca
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       293   4e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    292   4e-93    
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             293   4e-93    Prunus persica
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           293   5e-93    Nelumbo nucifera [Indian lotus]
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      292   5e-93    Sesamum indicum [beniseed]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      292   5e-93    Nelumbo nucifera [Indian lotus]
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           292   6e-93    Fragaria vesca subsp. vesca
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           292   6e-93    Tarenaya hassleriana [spider flower]
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      291   7e-93    
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      292   8e-93    Glycine max [soybeans]
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           291   8e-93    Camelina sativa [gold-of-pleasure]
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      291   9e-93    Cucumis sativus [cucumbers]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      292   9e-93    Nelumbo nucifera [Indian lotus]
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                292   1e-92    Erythranthe guttata [common monkey flower]
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      291   1e-92    Prunus mume [ume]
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              290   1e-92    
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      291   1e-92    Glycine max [soybeans]
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              291   2e-92    Ricinus communis
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             290   3e-92    Citrus clementina [clementine]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      290   3e-92    Cicer arietinum [garbanzo]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      291   3e-92    Cucumis sativus [cucumbers]
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     291   3e-92    Populus trichocarpa [western balsam poplar]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           290   3e-92    
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           290   3e-92    
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           291   4e-92    Cucumis melo [Oriental melon]
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      289   4e-92    Nicotiana sylvestris
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       290   4e-92    Gossypium hirsutum [American cotton]
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             289   5e-92    Prunus persica
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        290   5e-92    Medicago truncatula
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      290   5e-92    Camelina sativa [gold-of-pleasure]
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       290   5e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         290   6e-92    Jatropha curcas
gb|KJB43946.1|  hypothetical protein B456_007G225300                    290   6e-92    Gossypium raimondii
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           290   7e-92    Eucalyptus grandis [rose gum]
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           290   8e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      289   8e-92    Cicer arietinum [garbanzo]
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      289   8e-92    Citrus sinensis [apfelsine]
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      289   8e-92    Solanum tuberosum [potatoes]
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           290   8e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           289   1e-91    Pyrus x bretschneideri [bai li]
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           289   1e-91    
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      288   1e-91    Populus euphratica
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             288   2e-91    Phaseolus vulgaris [French bean]
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       289   2e-91    Gossypium hirsutum [American cotton]
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      288   2e-91    Populus euphratica
ref|XP_009114689.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      283   2e-91    Brassica rapa
gb|KJB24820.1|  hypothetical protein B456_004G162700                    288   2e-91    Gossypium raimondii
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    288   3e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           289   3e-91    Malus domestica [apple tree]
emb|CDX97356.1|  BnaA02g21470D                                          288   3e-91    
gb|EPS72617.1|  hypothetical protein M569_02133                         288   3e-91    Genlisea aurea
ref|XP_010662214.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           284   5e-91    Vitis vinifera
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    287   6e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    287   6e-91    
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             287   6e-91    
gb|AAK93670.1|  putative nucleotide sugar epimerase                     287   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      286   7e-91    Nicotiana tomentosiformis
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   286   7e-91    Citrus sinensis [apfelsine]
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       287   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      286   8e-91    Brassica rapa
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      286   9e-91    Cucumis melo [Oriental melon]
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             286   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           287   1e-90    Pyrus x bretschneideri [bai li]
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      286   2e-90    Cicer arietinum [garbanzo]
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      286   2e-90    Camelina sativa [gold-of-pleasure]
dbj|BAE71216.1|  putative NAD dependent epimerase                       286   2e-90    Trifolium pratense [peavine clover]
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             286   2e-90    Capsella rubella
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           286   2e-90    Fragaria vesca subsp. vesca
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    285   2e-90    Camelina sativa [gold-of-pleasure]
emb|CDY04398.1|  BnaC02g28500D                                          285   2e-90    
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           285   3e-90    Medicago truncatula
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    286   3e-90    Arabis alpina [alpine rockcress]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             286   3e-90    Capsella rubella
emb|CDX77481.1|  BnaA07g06190D                                          286   3e-90    
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      286   3e-90    Morus notabilis
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       286   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      286   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           286   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           286   3e-90    Brassica rapa
gb|AAN60250.1|  unknown                                                 286   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             286   4e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      285   4e-90    Brassica rapa
emb|CDX85133.1|  BnaC07g07730D                                          285   5e-90    
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    284   6e-90    Glycine max [soybeans]
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      284   7e-90    
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             284   7e-90    Eutrema salsugineum [saltwater cress]
gb|KDP22397.1|  hypothetical protein JCGZ_26228                         283   8e-90    Jatropha curcas
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           285   8e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             285   1e-89    
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           285   1e-89    Sesamum indicum [beniseed]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             285   1e-89    Citrus clementina [clementine]
emb|CDY53207.1|  BnaC03g74010D                                          284   1e-89    Brassica napus [oilseed rape]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      285   1e-89    Citrus sinensis [apfelsine]
emb|CDX92990.1|  BnaA03g37120D                                          284   1e-89    
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           284   1e-89    Vitis vinifera
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      281   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      284   2e-89    Nelumbo nucifera [Indian lotus]
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      283   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      283   2e-89    Glycine max [soybeans]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             284   2e-89    Prunus persica
emb|CAN60968.1|  hypothetical protein VITISV_008097                     283   2e-89    Vitis vinifera
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      281   2e-89    Pyrus x bretschneideri [bai li]
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      282   2e-89    Vitis vinifera
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      283   2e-89    Vitis vinifera
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    283   3e-89    
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             282   3e-89    Phaseolus vulgaris [French bean]
emb|CAN83418.1|  hypothetical protein VITISV_041351                     283   4e-89    Vitis vinifera
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    282   4e-89    Arabis alpina [alpine rockcress]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  283   4e-89    Medicago truncatula
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      281   4e-89    Solanum lycopersicum
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    282   4e-89    
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           282   5e-89    Eucalyptus grandis [rose gum]
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             283   5e-89    Eutrema salsugineum [saltwater cress]
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             281   7e-89    Citrus clementina [clementine]
emb|CDY18087.1|  BnaA01g23480D                                          282   7e-89    Brassica napus [oilseed rape]
emb|CDY64583.1|  BnaCnng44170D                                          282   8e-89    Brassica napus [oilseed rape]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           282   8e-89    Brassica rapa
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      281   9e-89    Citrus sinensis [apfelsine]
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      281   9e-89    Glycine max [soybeans]
emb|CDX86716.1|  BnaA09g21060D                                          281   1e-88    
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      280   1e-88    Solanum tuberosum [potatoes]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    282   1e-88    Tarenaya hassleriana [spider flower]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      281   2e-88    Glycine max [soybeans]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           281   2e-88    Elaeis guineensis
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           281   2e-88    Tarenaya hassleriana [spider flower]
gb|AFK49564.1|  unknown                                                 281   2e-88    Medicago truncatula
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    280   2e-88    Malus domestica [apple tree]
emb|CDP21869.1|  unnamed protein product                                281   2e-88    Coffea canephora [robusta coffee]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           280   3e-88    Elaeis guineensis
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      281   4e-88    Phoenix dactylifera
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      280   5e-88    Phoenix dactylifera
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      280   5e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16292.1|  unknown                                                 279   6e-88    Picea sitchensis
gb|KHN17533.1|  UDP-glucuronate 4-epimerase 1                           273   7e-88    Glycine soja [wild soybean]
gb|ABK25339.1|  unknown                                                 278   1e-87    Picea sitchensis
emb|CDX94504.1|  BnaC09g23320D                                          278   1e-87    
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             278   1e-87    Phaseolus vulgaris [French bean]
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      278   2e-87    Cucumis sativus [cucumbers]
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      278   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      278   2e-87    Nicotiana tomentosiformis
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      279   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60141.1|  hypothetical protein M569_14661                         278   2e-87    Genlisea aurea
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      278   3e-87    Setaria italica
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      277   4e-87    Cicer arietinum [garbanzo]
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      278   4e-87    Nicotiana sylvestris
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           277   5e-87    Cucumis melo [Oriental melon]
ref|NP_001105911.1|  LOC732831                                          277   5e-87    Zea mays [maize]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      277   6e-87    Solanum tuberosum [potatoes]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    277   6e-87    Zea mays [maize]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           277   8e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          276   9e-87    Sorghum bicolor [broomcorn]
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              276   1e-86    Selaginella moellendorffii
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             276   1e-86    
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      276   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      276   1e-86    Nicotiana sylvestris
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           276   2e-86    Fragaria vesca subsp. vesca
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      275   2e-86    Populus euphratica
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           276   2e-86    Eucalyptus grandis [rose gum]
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           276   2e-86    
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    276   2e-86    Elaeis guineensis
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      276   2e-86    Nicotiana tomentosiformis
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           275   2e-86    Phoenix dactylifera
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      275   3e-86    Solanum tuberosum [potatoes]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           275   3e-86    Solanum lycopersicum
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      275   4e-86    
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           271   4e-86    Glycine soja [wild soybean]
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             273   4e-86    Populus trichocarpa [western balsam poplar]
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                274   5e-86    Erythranthe guttata [common monkey flower]
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           274   5e-86    Pyrus x bretschneideri [bai li]
ref|XP_001761086.1|  predicted protein                                  275   5e-86    
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           275   5e-86    Brachypodium distachyon [annual false brome]
dbj|BAH20281.1|  AT4G30440                                              268   5e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110          274   5e-86    Amborella trichopoda
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      274   5e-86    Cucumis sativus [cucumbers]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      274   6e-86    Oryza brachyantha
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      275   6e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      274   6e-86    
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           274   6e-86    Malus domestica [apple tree]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   275   6e-86    Citrus sinensis [apfelsine]
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      274   7e-86    Solanum lycopersicum
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             274   7e-86    Citrus clementina [clementine]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       274   8e-86    Phaseolus vulgaris [French bean]
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           274   8e-86    Sesamum indicum [beniseed]
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           274   8e-86    Cucumis melo [Oriental melon]
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      273   9e-86    Glycine max [soybeans]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      275   9e-86    Glycine max [soybeans]
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        273   1e-85    Medicago truncatula
ref|XP_001761984.1|  predicted protein                                  274   1e-85    
gb|KJB76605.1|  hypothetical protein B456_012G096800                    273   1e-85    Gossypium raimondii
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              273   1e-85    Ricinus communis
ref|XP_001751991.1|  predicted protein                                  274   1e-85    
ref|NP_001142515.1|  hypothetical protein                               274   1e-85    Zea mays [maize]
gb|KDP38751.1|  hypothetical protein JCGZ_04104                         273   1e-85    Jatropha curcas
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           273   1e-85    Sesamum indicum [beniseed]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           273   2e-85    Nelumbo nucifera [Indian lotus]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             273   2e-85    Phaseolus vulgaris [French bean]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           273   2e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      273   2e-85    Solanum tuberosum [potatoes]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             273   2e-85    Prunus persica
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           272   3e-85    Prunus mume [ume]
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       272   3e-85    Gossypium hirsutum [American cotton]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          273   3e-85    Sorghum bicolor [broomcorn]
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    271   3e-85    
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160          272   3e-85    
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      272   4e-85    
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                272   4e-85    
dbj|BAJ85817.1|  predicted protein                                      272   4e-85    
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    271   5e-85    
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      271   5e-85    
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             272   6e-85    
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              272   6e-85    
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    271   7e-85    
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    270   7e-85    
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      272   7e-85    
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          271   8e-85    
ref|XP_001759693.1|  predicted protein                                  271   8e-85    
ref|NP_001048359.1|  Os02g0791500                                       271   9e-85    
ref|XP_001777338.1|  predicted protein                                  271   9e-85    
gb|KJB27035.1|  hypothetical protein B456_004G273500                    271   1e-84    
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                           267   1e-84    
emb|CDP21367.1|  unnamed protein product                                270   2e-84    
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           270   2e-84    
ref|XP_001769370.1|  predicted protein                                  271   2e-84    
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      270   2e-84    
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             270   2e-84    
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   270   2e-84    
ref|NP_001057015.1|  Os06g0187200                                       266   3e-84    
dbj|BAK06545.1|  predicted protein                                      270   3e-84    
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       270   3e-84    
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           269   4e-84    
ref|XP_001754001.1|  predicted protein                                  270   4e-84    
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      269   4e-84    
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      269   4e-84    
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           269   5e-84    
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      269   5e-84    
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           270   5e-84    
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      269   7e-84    
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           269   7e-84    
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      269   7e-84    
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             269   7e-84    
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             269   7e-84    
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   7e-84    
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   8e-84    
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     268   8e-84    
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   9e-84    
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      268   9e-84    
emb|CDY70926.1|  BnaCnng70410D                                          268   1e-83    
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    269   1e-83    
ref|XP_001781238.1|  predicted protein                                  268   1e-83    
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      268   1e-83    
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                           269   2e-83    
emb|CDX72242.1|  BnaC07g42640D                                          268   2e-83    
emb|CDY39205.1|  BnaA03g50170D                                          268   2e-83    
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           268   2e-83    
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      268   2e-83    
gb|KGN65261.1|  hypothetical protein Csa_1G277970                       267   2e-83    
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      268   3e-83    
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          266   4e-83    
ref|XP_001767292.1|  predicted protein                                  267   5e-83    
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    267   5e-83    
gb|EAY99954.1|  hypothetical protein OsI_21957                          267   5e-83    
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           266   5e-83    
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      267   9e-83    
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      266   1e-82    
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      266   1e-82    
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      267   1e-82    
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      267   1e-82    
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    265   1e-82    
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      266   1e-82    
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      266   1e-82    
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      265   1e-82    
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    265   1e-82    
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      267   1e-82    
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    265   1e-82    
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           265   2e-82    
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          266   3e-82    
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    264   3e-82    
dbj|BAJ88176.1|  predicted protein                                      266   3e-82    
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    264   3e-82    
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    264   3e-82    
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      266   7e-82    
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      265   8e-82    
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         265   1e-81    
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      264   4e-81    
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      262   6e-81    
ref|NP_001049561.1|  Os03g0249500                                       261   2e-80    
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           259   2e-80    
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      260   4e-80    
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           257   1e-78    
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              252   5e-78    
gb|EPS64795.1|  hypothetical protein M569_09984                         251   5e-78    
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              251   1e-77    
ref|XP_006660306.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      246   5e-77    
gb|EEC83913.1|  hypothetical protein OsI_29968                          245   7e-77    
gb|EYU31498.1|  hypothetical protein MIMGU_mgv1a008581mg                246   5e-76    
ref|XP_010092236.1|  UDP-glucuronate 4-epimerase 3                      241   1e-75    
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      248   2e-75    
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           248   3e-75    
ref|NP_001062295.1|  Os08g0526100                                       248   4e-75    
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      248   4e-75    
dbj|BAJ86203.1|  predicted protein                                      247   7e-75    
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          246   9e-75    
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          246   1e-74    
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      246   3e-74    
gb|EEC83914.1|  hypothetical protein OsI_29969                          247   4e-74    
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    245   4e-74    
ref|NP_001147328.1|  protein capI                                       245   5e-74    
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      244   7e-74    
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      243   1e-73    
gb|EEC84839.1|  hypothetical protein OsI_31939                          243   3e-73    
ref|NP_001063595.1|  Os09g0504000                                       243   3e-73    
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          246   3e-73    
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           241   5e-73    
gb|EMS47781.1|  UDP-glucuronate 4-epimerase 6                           236   5e-72    
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      237   4e-71    
dbj|BAJ99315.1|  predicted protein                                      232   3e-69    
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           235   2e-68    
gb|KJB23560.1|  hypothetical protein B456_004G105200                    224   8e-68    
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      225   2e-67    
ref|XP_001416501.1|  predicted protein                                  222   1e-66    
gb|KJB27036.1|  hypothetical protein B456_004G273500                    222   3e-66    
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          222   5e-66    
emb|CEG01274.1|  Nucleotide sugar epimerase                             222   5e-66    
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      222   3e-65    
gb|EPS73152.1|  hypothetical protein M569_01604                         216   5e-64    
ref|XP_001422311.1|  predicted protein                                  214   1e-63    
ref|XP_007512695.1|  predicted protein                                  216   1e-62    
ref|XP_002504144.1|  predicted protein                                  213   2e-62    
gb|AEW07796.1|  hypothetical protein 0_11781_01                         204   4e-62    
gb|AFG68265.1|  hypothetical protein 0_11781_01                         203   6e-62    
gb|AFG68267.1|  hypothetical protein 0_11781_01                         203   7e-62    
ref|XP_003060215.1|  protein arginine methyltransferase                 205   4e-60    
dbj|GAK46187.1|  NAD-dependent epimerase/dehydratase                    197   2e-57    
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase                197   6e-57    
emb|CAN83831.1|  hypothetical protein VITISV_003974                     187   2e-55    
ref|XP_002511693.1|  UDP-glucuronate 5-epimerase, putative              186   3e-55    
emb|CAN73017.1|  hypothetical protein VITISV_004389                     185   5e-55    
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase                191   1e-54    
gb|EMS48913.1|  UDP-glucuronate 4-epimerase 2                           189   2e-54    
emb|CAJ91140.1|  nucleotide sugar epimerase-like protein                182   1e-53    
ref|WP_042229845.1|  capsular biosynthesis protein CpsI                 186   4e-53    
gb|AFK41785.1|  unknown                                                 180   5e-53    
ref|WP_011737215.1|  NAD-dependent epimerase/dehydratase                185   1e-52    
ref|WP_042406657.1|  capsular biosynthesis protein CpsI                 184   2e-52    
ref|WP_008276964.1|  UDP-N-acetylglucosamine 4-epimerase                180   2e-52    
ref|WP_038151637.1|  protein CapI                                       184   5e-52    
ref|WP_025027145.1|  capsular biosynthesis protein CpsI                 183   7e-52    
ref|WP_036176406.1|  protein CapI                                       182   1e-51    
ref|WP_026304200.1|  hypothetical protein                               181   2e-51    
ref|WP_029077107.1|  hypothetical protein                               181   3e-51    
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      182   3e-51    
ref|WP_013417882.1|  NAD-dependent epimerase/dehydratase                181   3e-51    
ref|WP_041058900.1|  capsular biosynthesis protein CpsI                 181   5e-51    
ref|WP_043765848.1|  hypothetical protein                               181   6e-51    
ref|WP_026686095.1|  hypothetical protein                               180   9e-51    
ref|WP_011370930.1|  NAD-dependent epimerase                            180   1e-50    
ref|WP_025039310.1|  capsular biosynthesis protein CpsI                 179   2e-50    
gb|AEW08457.1|  hypothetical protein 2_10352_02                         174   2e-50    
ref|WP_026896012.1|  capsular biosynthesis protein CpsI                 179   2e-50    
ref|WP_004462894.1|  MULTISPECIES: nucleotide sugar epimerase           179   2e-50    
gb|AEW08456.1|  hypothetical protein 2_10352_02                         174   2e-50    
ref|WP_038286766.1|  capsular biosynthesis protein CpsI [               179   2e-50    
ref|WP_028487120.1|  hypothetical protein                               179   2e-50    
ref|WP_009546855.1|  MULTISPECIES: NAD-dependent epimerase              178   3e-50    
ref|WP_027359810.1|  capsular biosynthesis protein CpsI                 179   3e-50    
ref|WP_015509399.1|  hypothetical protein                               178   4e-50    
ref|WP_003512346.1|  NAD-dependent epimerase                            178   6e-50    
ref|WP_042239280.1|  hypothetical protein                               177   7e-50    
gb|KIC75589.1|  UDP-glucuronate 4-epimerase 4                           177   7e-50    
ref|WP_040206766.1|  MULTISPECIES: capsular biosynthesis protein ...    177   8e-50    
ref|WP_039386438.1|  hypothetical protein                               177   8e-50    
ref|WP_018152621.1|  hypothetical protein                               177   9e-50    
ref|WP_040484163.1|  capsular biosynthesis protein CpsI                 177   9e-50    
gb|ERT06558.1|  polysaccharide biosynthesis family protein              177   1e-49    
ref|WP_013948461.1|  MULTISPECIES: hypothetical protein                 177   1e-49    
ref|WP_016423516.1|  hypothetical protein                               177   2e-49    
ref|WP_019674725.1|  hypothetical protein                               177   2e-49    
ref|WP_042230493.1|  capsular biosynthesis protein CpsI                 177   2e-49    
ref|WP_028790520.1|  capsular biosynthesis protein CpsI                 176   2e-49    
ref|WP_026848679.1|  capsular biosynthesis protein CpsI                 176   2e-49    
ref|WP_043570024.1|  protein CapI                                       176   2e-49    
ref|WP_013146568.1|  NAD-dependent epimerase                            176   3e-49    
ref|WP_037240224.1|  UDP-glucuronate 5-epimerase                        176   3e-49    
ref|WP_038266527.1|  capsular biosynthesis protein CpsI [               176   3e-49    
ref|WP_041967185.1|  capsular biosynthesis protein CpsI                 176   3e-49    
ref|WP_029733863.1|  hypothetical protein                               176   3e-49    
gb|AJP47376.1|  protein CapI                                            176   3e-49    
ref|WP_039727982.1|  MULTISPECIES: capsular biosynthesis protein ...    176   3e-49    
ref|WP_034774286.1|  capsular biosynthesis protein CpsI                 176   4e-49    
ref|WP_004507614.1|  3-beta hydroxysteroid dehydrogenase/isomeras...    176   4e-49    
ref|WP_034770144.1|  capsular biosynthesis protein CpsI                 176   4e-49    
ref|WP_027965279.1|  capsular biosynthesis protein CpsI                 176   5e-49    
ref|WP_014426618.1|  NAD-dependent epimerase/dehydratase family p...    176   5e-49    
ref|WP_020746300.1|  capsular polysaccharide biosynthesis protein I     176   5e-49    
ref|WP_015067637.1|  capsular polysaccharide biosynthesis protein I     176   5e-49    
ref|WP_043815253.1|  protein CapI                                       175   6e-49    
ref|WP_024026939.1|  NAD-dependent epimerase/dehydratase                175   6e-49    
ref|WP_011289653.1|  NAD-dependent epimerase/dehydratase                175   6e-49    
ref|WP_012110833.1|  NAD-dependent epimerase/dehydratase                175   6e-49    
ref|WP_018473113.1|  hypothetical protein                               176   6e-49    
ref|WP_041274008.1|  capsular biosynthesis protein CpsI                 175   6e-49    
ref|WP_019380776.1|  hypothetical protein                               175   7e-49    
ref|WP_009517846.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...    175   7e-49    
ref|WP_022979921.1|  NAD dependent epimerase/dehydratase                175   7e-49    
gb|ACN16058.1|  CapD1                                                   176   8e-49    
ref|WP_015010717.1|  NAD-dependent epimerase                            175   8e-49    
ref|WP_025869741.1|  hypothetical protein                               175   9e-49    
ref|WP_009857338.1|  NAD-dependent epimerase/dehydratase                175   9e-49    
ref|WP_002708148.1|  NAD-dependent epimerase                            175   1e-48    
ref|WP_036582992.1|  hypothetical protein                               175   1e-48    
ref|WP_011462980.1|  NAD-dependent epimerase/dehydratase                174   1e-48    
ref|WP_011745567.1|  NAD-dependent epimerase/dehydratase                175   1e-48    
ref|WP_041065612.1|  hypothetical protein                               174   1e-48    
ref|WP_009787825.1|  NAD-dependent epimerase                            174   1e-48    
ref|WP_020743961.1|  capsular polysaccharide biosynthesis protein I     174   1e-48    
ref|WP_024016638.1|  capsular polysaccharide biosynthesis protein I     174   1e-48    
ref|WP_015222004.1|  NAD-dependent epimerase/dehydratase                174   1e-48    
emb|CAJ74935.1|  strongly similar to UDP-glucuronate 5'-epimerase       174   1e-48    
ref|WP_035516218.1|  hypothetical protein                               174   1e-48    
ref|WP_008516476.1|  NAD-dependent epimerase                            174   1e-48    
ref|WP_026033188.1|  MULTISPECIES: UDP-glucuronate 5-epimerase          174   1e-48    
ref|WP_026609545.1|  capsular biosynthesis protein CpsI                 174   2e-48    
ref|WP_035344828.1|  capsular biosynthesis protein CpsI                 174   2e-48    
ref|WP_026435389.1|  hypothetical protein                               174   2e-48    



>ref|XP_004245716.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum lycopersicum]
Length=445

 Score =   328 bits (841),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  241  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKIFETSD  SVARDFTY+DDVVKGCL ALDTAKKSTGSGGKKKGAAQLR
Sbjct  301  FTKDILRGKEIKIFETSDQGSVARDFTYVDDVVKGCLGALDTAKKSTGSGGKKKGAAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNTKPVPVG+LVS LEKLLKVKAKKKV+ MPRNGDVPFTHANITLA  ELGYKPTT
Sbjct  361  IFNLGNTKPVPVGRLVSILEKLLKVKAKKKVIQMPRNGDVPFTHANITLAHTELGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFVKWY++YYGSKK+S+W
Sbjct  421  DLEMGLKKFVKWYVSYYGSKKKSSW  445



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHI+GLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  241  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIHGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKIFETSDH SVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  301  FTKDILRGKEIKIFETSDHGSVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKKGAAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNTKPVPVG+LVS LEKLLKVKAKKKVL MPRNGDVPFTHANITLA+ ELGYKPTT
Sbjct  361  IYNLGNTKPVPVGRLVSILEKLLKVKAKKKVLQMPRNGDVPFTHANITLAQKELGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFVKWY+NYYGSKK+SAW
Sbjct  421  DLEIGLKKFVKWYVNYYGSKKKSAW  445



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHI+GLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  241  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIHGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKIFETSDH SVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  301  FTKDILRGKEIKIFETSDHGSVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKKGAAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNTKPVPVG+LVS LEKLLKVKAKKKVL MPRNGDVPFTHANITLA+ ELGYKPTT
Sbjct  361  IYNLGNTKPVPVGRLVSILEKLLKVKAKKKVLQMPRNGDVPFTHANITLAQKELGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFVKWY+NYYGSKK+SAW
Sbjct  421  DLEIGLKKFVKWYVNYYGSKKKSAW  445



>ref|XP_006363737.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Solanum tuberosum]
Length=446

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 195/206 (95%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  241  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKIFETSDH SVARDFTY+DDVV GCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  301  FTKDILRGKEIKIFETSDHGSVARDFTYVDDVVMGCLAALDTAKKSTGSGGKKKGAAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNTKPVPVG+LVS LEKLLKVKAKKKV+ MPRNGDVPFTHANITLA  ELGYKPTT
Sbjct  361  IYNLGNTKPVPVGRLVSILEKLLKVKAKKKVIQMPRNGDVPFTHANITLAHTELGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGS-KKRSAW  144
            DLE GLKKFVKWY++YYGS KK+S+W
Sbjct  421  DLEMGLKKFVKWYVSYYGSKKKKSSW  446



>ref|XP_011081125.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Sesamum indicum]
Length=439

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAY+ 
Sbjct  235  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYYF  294

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKIFE +DH +VARDFTYIDDVVKGCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  295  FTKDILRGKEIKIFEGADHATVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKKGAAQLR  354

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LEKLLK+KAKKK L MPRNGDV FTHANI+LAR ELGYKPTT
Sbjct  355  IYNLGNTSPVPVGKLVSILEKLLKIKAKKKFLPMPRNGDVLFTHANISLARKELGYKPTT  414

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFVKWYL+YYG+KK+SAW
Sbjct  415  DLEMGLKKFVKWYLSYYGAKKKSAW  439



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   318 bits (816),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAY+ 
Sbjct  250  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYYF  309

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKI+E  DH +VARDFTYIDDVVKGCLAALDTAKKSTGSGGKK+GAAQ R
Sbjct  310  FTKDILRGKEIKIYEGVDHGTVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKRGAAQFR  369

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVP+G+LVS LEKLL+VKAKKKV+ MPRNGDVPFTHANI+LA  ELGYKPTT
Sbjct  370  IYNLGNTTPVPIGRLVSILEKLLRVKAKKKVIQMPRNGDVPFTHANISLAHKELGYKPTT  429

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFVKWY+ YYGSKK+SAW
Sbjct  430  DLEAGLKKFVKWYVGYYGSKKKSAW  454



>gb|EYU30447.1| hypothetical protein MIMGU_mgv1a006641mg [Erythranthe guttata]
Length=437

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAY+ 
Sbjct  233  KVPFSEKDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYYF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGKEIKIFE +DH +VARDFTYIDDVVKGCL+ALDTAKKSTGSGGKK G AQLR
Sbjct  293  FTKDILRGKEIKIFEGADHATVARDFTYIDDVVKGCLSALDTAKKSTGSGGKKAGPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV KLVS LEKLLKVKAKKK+L MPRNGDV FTHANITLAR ELGYKPTT
Sbjct  353  VYNLGNTSPVPVSKLVSILEKLLKVKAKKKLLPMPRNGDVVFTHANITLARKELGYKPTT  412

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGLKKFVKWY++YYGSKK+SAW
Sbjct  413  DLETGLKKFVKWYISYYGSKKKSAW  437



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKK+G AQLR
Sbjct  290  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+ LKVKAK+ V+ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  350  VFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQHELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY  +K++A
Sbjct  410  DLQTGLKKFVRWYLSYYSGEKKAA  433



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKGAAQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ +PRNGDVPFTHANI+ A  ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYLNYYG+ K+SA
Sbjct  411  DLQTGLKKFVRWYLNYYGNGKKSA  434



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLA+LDTA+KSTG+GGKK+G AQLR
Sbjct  291  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+ LKVKAKK ++ MPRNGDVP+THANI+LA+ ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVSILERQLKVKAKKNLIKMPRNGDVPYTHANISLAQRELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY  +K++A
Sbjct  411  DLQTGLKKFVRWYLSYYSGQKKAA  434



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCL ALDTA+KSTG+GGKK+G AQLR
Sbjct  290  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+ LKVKAKK V+ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  350  VFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K++A
Sbjct  410  DLQTGLKKFVRWYLSYYSGGKKAA  433



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCL ALDTA+KSTG+GGKK+G AQLR
Sbjct  290  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+ LKVKAK+ V+ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  350  VFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K++A
Sbjct  410  DLQTGLKKFVRWYLSYYSGGKKAA  433



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score =   305 bits (781),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCL ALDTA+KSTG+GGKK+G AQLR
Sbjct  290  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+ LKVKAKK V+ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  350  VFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K++A
Sbjct  410  DLQTGLKKFVRWYLSYYSGGKKAA  433



>gb|KFK37325.1| hypothetical protein AALP_AA4G242100 [Arabis alpina]
Length=435

 Score =   305 bits (781),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLAALDT++KSTGSGGKKKG AQLR
Sbjct  290  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTSEKSTGSGGKKKGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LEK LKVKAKKK++ MPRNGDVP+THANI+LAR ELGYKPTT
Sbjct  350  VFNLGNTSPVPVSDLVRILEKHLKVKAKKKMIKMPRNGDVPYTHANISLARSELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K+SA
Sbjct  410  DLQTGLKKFVRWYLSYYSGGKKSA  433



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKK+G AQLR
Sbjct  292  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+ LKVKAKK ++ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  352  VFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY  +K++A
Sbjct  412  DLQTGLKKFVRWYLSYYSGEKKAA  435



>gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata]
Length=261

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHI+GLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  57   KVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIHGLSLTGLRFFTVYGPWGRPDMAYFF  116

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKGAAQLR
Sbjct  117  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGAAQLR  176

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  177  VFNLGNTSPVPVSDLVSILERLLKVKAKRLIMKLPRNGDVQFTHANISLAQRELGYKPTT  236

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG++K+S+
Sbjct  237  DLQTGLKKFVRWYLSYYGNEKKSS  260



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKGAAQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+LLKVKAK+ V+ +PRNGDVPFTHANI+ A  ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVGILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYLNYYG+ K+SA
Sbjct  411  DLQTGLKKFVRWYLNYYGNGKKSA  434



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKK+G AQLR
Sbjct  292  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+ LKVKAKK ++ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  352  VFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K++A
Sbjct  412  DLQTGLKKFVRWYLSYYSGDKKAA  435



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  220  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  279

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE SDH SVARDFTYIDDVVKGC+AALDTAKKSTGSGGKKKG AQLR
Sbjct  280  FTKDILKGKTITIFEASDHGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPAQLR  339

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LV+ LEKLLKVKAK+KVL MPRNGDV FTHANI+LA  EL YKP T
Sbjct  340  IFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELRYKPGT  399

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFV+WYL+YY GS K+S+W
Sbjct  400  DLETGLKKFVRWYLSYYPGSGKKSSW  425



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   302 bits (773),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE +DH +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  288  FTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLKVKAK+ ++ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  348  VFNLGNTSPVPVSDLVSILEKLLKVKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYLNYY   K++A
Sbjct  408  DLQTGLKKFVRWYLNYYSQGKKAA  431



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  237  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  296

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLA+LDTA+KSTG+GGKK+G AQLR
Sbjct  297  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLR  356

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+ LKVKAKK V+ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  357  VFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  416

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYL+YY S   S
Sbjct  417  DLQTGLKKFVRWYLSYYSSSGHS  439



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  235  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  294

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLA+LDTA+KSTG+GGKK+G AQLR
Sbjct  295  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLR  354

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+ LKVKAKK V+ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  355  VFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTT  414

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYL+YY S   S
Sbjct  415  DLQTGLKKFVRWYLSYYSSSGHS  437



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE +DH +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLK+KAK+ ++ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  354  VFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WY+NYY   K++A
Sbjct  414  DLQTGLKKFVRWYMNYYSQGKKAA  437



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE +DH +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  288  FTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLK+KAK+ ++ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  348  VFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WY+NYY   K++A
Sbjct  408  DLQTGLKKFVRWYMNYYSQGKKAA  431



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD PASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSEKDRTDNPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I+IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  293  FTKDILKGKAIQIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  353  VYNLGNTSPVPVSDLVSILERLLKVKAKRTIMKLPRNGDVQFTHANISLAQRELGYKPTT  412

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+ K+S+
Sbjct  413  DLQTGLKKFVRWYLSYYGNGKKSS  436



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLKVKAK+ ++ +PRNGDV FTHANI+LA+ E GYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+ K+SA
Sbjct  411  DLQTGLKKFVRWYLSYYGNGKKSA  434



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  236  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE+++H +VARDFTYIDD+VKGCLA+LDTA+KSTG+GGKK+G A LR
Sbjct  296  FTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAMLR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+ LKVKAKK ++ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  356  VFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTT  415

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYL+YY S  +S
Sbjct  416  DLQTGLKKFVRWYLSYYSSSGQS  438



>gb|KJB25649.1| hypothetical protein B456_004G202200 [Gossypium raimondii]
Length=433

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDI++GK I ++E+ D  SVARDFTYIDD+VKGCL ALDTAKKSTGSGGKK+  AQLR
Sbjct  288  FTKDIMKGKTITVYESPDKGSVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKREPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LVS LEK+LKVKAKKKV+ +PRNGDV FTHANITLA  ELGYKPTT
Sbjct  348  IFNLGNTSPVPVSRLVSILEKILKVKAKKKVVPLPRNGDVEFTHANITLAMTELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLE GLKKFV+WYL++Y GSKK+S+W
Sbjct  408  DLEAGLKKFVRWYLSFYSGSKKKSSW  433



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  235  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  294

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL  K I IFE+ DH +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKK+G AQLR
Sbjct  295  FTRDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGRAQLR  354

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  355  VFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYKPTT  414

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K++A
Sbjct  415  DLQTGLKKFVRWYLSYYAGGKKAA  438



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  288  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLK KAK+ V+ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  348  VYNLGNTSPVPVSDLVSILERLLKTKAKRLVMKLPRNGDVQFTHANISLAQRELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYLNYY + K+SA
Sbjct  408  DLQTGLKKFVRWYLNYYVNGKKSA  431



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTY+DD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYVDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ +PRNGDV FTHANI+ A+ ELGYKP+T
Sbjct  351  VFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYKPST  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYLNYYG+ K+SA
Sbjct  411  DLQTGLKKFVRWYLNYYGNGKKSA  434



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  229  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I+IFE  +H +VARDFTYIDD+VKGC+AALDTA+KSTGSGGKKKG AQLR
Sbjct  289  FTKDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  349  VFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYKPTT  408

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WY+ YY + ++SA
Sbjct  409  DLQTGLKKFVRWYIKYYSAGEKSA  432



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 188/207 (91%), Gaps = 2/207 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GKEI +FET+D  SVARDFTYIDD+V GCLAALDTAKKSTGSGGKK+G AQ R
Sbjct  290  FTKDILKGKEIGVFETADGRSVARDFTYIDDIVNGCLAALDTAKKSTGSGGKKRGPAQFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LV  LE LL+VKAKKKVL +PRNGDV FTHANI+LA+ +LGYKPTT
Sbjct  350  VFNLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPRNGDVEFTHANISLAQKDLGYKPTT  409

Query  218  DLETGLKKFVKWYLNYY-GSKKR-SAW  144
            DLETGLKKFV+WYL+YY GSKK+ S+W
Sbjct  410  DLETGLKKFVRWYLSYYSGSKKKTSSW  436



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDT +KSTGSGGKKKG AQLR
Sbjct  292  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTGEKSTGSGGKKKGPAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  352  VFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYL+YYG  K+S
Sbjct  412  DLQTGLKKFVRWYLSYYGDGKKS  434



>ref|XP_010055537.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Eucalyptus grandis]
 gb|KCW72021.1| hypothetical protein EUGRSUZ_E00471 [Eucalyptus grandis]
Length=436

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GKEI I+E  DH SVARDFT+IDD+VKGC++ALDTAKKSTGSGGKKKG+AQ R
Sbjct  292  FTEDILKGKEITIYEGPDHISVARDFTFIDDIVKGCVSALDTAKKSTGSGGKKKGSAQFR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV KLV  LEKLLKVKA+KK L +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  352  IFNLGNTSPVPVTKLVKILEKLLKVKARKKFLPLPRNGDVKFTHANISLAQRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGLKKFVKWY++Y    KRS+W
Sbjct  412  DLETGLKKFVKWYISYNKGSKRSSW  436



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+L+GK I IFE +DH +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  291  FTRDMLKGKSISIFEGADHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ V+ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVTILERLLKVKAKRAVMKLPRNGDVQFTHANISLAQRELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG  K+SA
Sbjct  411  DLQTGLKKFVRWYLSYYGEGKKSA  434



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  223  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  282

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I+IFE  +H +VARDFTYIDD+VKGC+AALDTA+KSTGSGGKKKG AQLR
Sbjct  283  FTKDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  342

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  343  VFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYKPTT  402

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WY+ YY + ++SA
Sbjct  403  DLQTGLKKFVRWYIKYYSAGEKSA  426



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+GAAQLR
Sbjct  291  FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGAAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LVS LE+ LKVKAK+ ++ +PRNGDV FTHANI+LA+GELGYKPTT
Sbjct  351  VFNLGNTSPVPVSELVSILERHLKVKAKRNIMKLPRNGDVQFTHANISLAQGELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL TGLKKFVKWYL YY   K++A
Sbjct  411  DLHTGLKKFVKWYLGYYNVGKKAA  434



>gb|KHN25558.1| UDP-glucuronate 4-epimerase 3 [Glycine soja]
Length=261

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  57   KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  116

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+L+GK I IFE ++H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  117  FTRDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  176

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  177  IFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYKPTT  236

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL++GLKKFV+WYLNYY   K++
Sbjct  237  DLQSGLKKFVRWYLNYYSGGKKA  259



>ref|XP_010108144.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXC17876.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=444

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  240  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  299

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            F+K+IL+ K+I IFE  +H +VARDFTYIDD++KGCLAALDTAKKSTGSGGKK+G AQLR
Sbjct  300  FSKNILKRKQITIFEAPNHGTVARDFTYIDDILKGCLAALDTAKKSTGSGGKKRGNAQLR  359

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LV  LEKLLKVKAK KVL +PRNGDV FTHANI+LA  ELGYKPTT
Sbjct  360  VFNLGNTSPVPVTQLVRILEKLLKVKAKTKVLPLPRNGDVKFTHANISLAYRELGYKPTT  419

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGLKKFV+WYLNYY + K+S+W
Sbjct  420  DLETGLKKFVRWYLNYYQNSKKSSW  444



>dbj|BAF00333.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=292

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 184/206 (89%), Gaps = 2/206 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  85   KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  144

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  145  FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  204

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDVPFTHANI+ A+ E GYKP+T
Sbjct  205  VFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPST  264

Query  218  DLETGLKKFVKWYLNYY--GSKKRSA  147
            DL+TGLKKFV+WYL YY  G KK +A
Sbjct  265  DLQTGLKKFVRWYLGYYKQGGKKVAA  290



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEWDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLKVKAK+ ++ +PRNGDV FTHANI+LA+ E GYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+ K+SA
Sbjct  411  DLQTGLKKFVRWYLSYYGNGKKSA  434



>gb|KGN57287.1| hypothetical protein Csa_3G176330 [Cucumis sativus]
Length=262

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  57   RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  116

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I++FE +D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGG+KKG AQLR
Sbjct  117  FTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  176

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PV V +LV  LEKLL +KAK+ VL MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  177  VFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTT  236

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGLK+FV WY  YY +  +
Sbjct  237  DLKTGLKEFVDWYRLYYSNSSK  258



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGC+ ALDTAKKSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCVGALDTAKKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLKVKAK+ V+ +PRNGDV FTHANI+ A  ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+ K+SA
Sbjct  411  DLQTGLKKFVRWYLSYYGNGKKSA  434



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD+PASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDRPASLYAATKKAGEGIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCLAALDTA+KSTG GGKKKG AQ R
Sbjct  292  FTKDILKGKTINVFESPDKGSVARDFTYIDDIVKGCLAALDTAQKSTGGGGKKKGPAQFR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV +LVS LEKLLKVKAKKK+  +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  352  IYNLGNTSPVPVTRLVSILEKLLKVKAKKKITPLPRNGDVEFTHANISLAQAELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWYLN+Y GSKK+S+W
Sbjct  412  DLETGLKKFVKWYLNFYTGSKKKSSW  437



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   297 bits (760),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  293  FTRDILKGKSISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKV AK+ ++ +PRNGDV FTHANI+LA+ ELGYKP+T
Sbjct  353  VFNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYKPST  412

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K++A
Sbjct  413  DLQTGLKKFVRWYLSYYSGGKKAA  436



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LEKLLKVKAK+ V+ +PRNGDV FTHANI+ A  ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+ K+S 
Sbjct  411  DLQTGLKKFVRWYLSYYGNGKKSV  434



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  229  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE  D  SVARDFTYIDDVVKGC+AALDTAKKSTGSGGKKKG AQLR
Sbjct  289  FTKDILKGKPITIFEAPDRGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPAQLR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LV+ LEKLLKVKAK+KVL MPRNGDV FTHANI+LA  EL YKP T
Sbjct  349  IFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELKYKPGT  408

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFV+WYL+YY GS K+S+W
Sbjct  409  DLETGLKKFVRWYLSYYPGSGKKSSW  434



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  241  ENPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSG KKKGAAQLR
Sbjct  301  FTKDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGEKKKGAAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK V+ MPRNGDVPFTHAN+TLA  + GYKPTT
Sbjct  361  VYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL TGL+KFVKWY++YYG + ++
Sbjct  421  DLSTGLRKFVKWYISYYGIQSKT  443



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I IFE ++H +VARDFTYIDD+VKGCL +LDTA+KSTGSGGKKKG AQLR
Sbjct  287  FTKDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+K++ +PRNGDVP+THANI+ A+ E GYKPTT
Sbjct  347  VFNLGNTSPVPVTDLVSILERLLKVKAKRKIMKLPRNGDVPYTHANISYAQKEFGYKPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+KK  A
Sbjct  407  DLQTGLKKFVRWYLSYYGNKKAVA  430



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I IFE ++H +VARDFTYIDD+VKGCL +LDTA+KSTGSGGKKKG AQLR
Sbjct  287  FTKDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDVP+THANI+ A+ E GYKPTT
Sbjct  347  VFNLGNTSPVPVTDLVSILERLLKVKAKRNIMKLPRNGDVPYTHANISYAQKEFGYKPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG+KK  A
Sbjct  407  DLQTGLKKFVRWYLSYYGNKKAVA  430



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  292  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  352  VFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGLKKFV+WYL+YYG + +
Sbjct  412  DLHTGLKKFVRWYLSYYGDETK  433



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  241  ENPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKGAAQLR
Sbjct  301  FTKDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGAAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK V+ MPRNGDVPFTHAN+TLA  + GYKPTT
Sbjct  361  VYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL TGL+KFVKWY++YYG + ++ 
Sbjct  421  DLSTGLRKFVKWYISYYGIQSKTG  444



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  293  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLKV AK+ ++ +PRNGDV FTHANI+LA+ ELGYKP+T
Sbjct  353  VYNLGNTSPVPVSDLVSILERLLKVNAKRDIMKLPRNGDVQFTHANISLAQRELGYKPST  412

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL YY   K++A
Sbjct  413  DLQTGLKKFVRWYLGYYNGGKKAA  436



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEE+AH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  229  KVPFSERDRTDQPASLYAATKKAGEEMAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+ K I IFE  +H +VARDFTYIDD+VKGC+AALDTA+KSTGSGGKKKG AQLR
Sbjct  289  FTRDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+K++ MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  349  VFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTT  408

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFVKWYLNYY + K++A
Sbjct  409  DLQTGLKKFVKWYLNYYSAGKKTA  432



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  292  FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAKK ++ +PRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  352  VFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL YY   K+ A
Sbjct  412  DLQTGLKKFVRWYLGYYKGGKKVA  435



>ref|XP_010540291.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Tarenaya hassleriana]
Length=393

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 185/205 (90%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH Y+HIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  189  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYSHIYGLSLTGLRFFTVYGPWGRPDMAYFF  248

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  249  FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  308

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LVS LE+ LKVKAK+ V+ +PRNGDV FTHANI++A+ ELGYKPTT
Sbjct  309  VFNLGNTSPVPVSELVSILERHLKVKAKRNVMKLPRNGDVQFTHANISMAQRELGYKPTT  368

Query  218  DLETGLKKFVKWYLNYY-GSKKRSA  147
            DL+TGLKKFV+WY+ YY G KK SA
Sbjct  369  DLQTGLKKFVRWYMGYYNGGKKASA  393



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  217  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  276

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDILRGK I IFE  +H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  277  FTKDILRGKSITIFEGPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGTAQLR  336

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ MPRNGDV FTHANI+ A+ E GYKPTT
Sbjct  337  VFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYKPTT  396

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WY+NYY + K++
Sbjct  397  DLQTGLKKFVRWYVNYYSAGKKA  419



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTV+GPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVFGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE ++H +VARDFTYIDD+VKGCL +LDTA+KSTGSGGKKKG AQLR
Sbjct  291  FTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ +PRNGDVP+THANI+ A+ E GYKPTT
Sbjct  351  VFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG KK  A
Sbjct  411  DLQTGLKKFVRWYLSYYGDKKAVA  434



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  223  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  282

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+ K I IFE  +  +VARDFTYIDD+VKGC+AALDTA+KSTGSGGKKKG AQLR
Sbjct  283  FTRDILKEKSIPIFEAPNRGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLR  342

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV  LVS LE+LLKVKAK+K++ MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  343  IFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTT  402

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DL+TGLKKFV+WYL YY + ++SAW
Sbjct  403  DLQTGLKKFVRWYLKYYSAGEKSAW  427



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  293  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLKV AK+ ++ +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  353  VYNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTT  412

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYL+YY   K++
Sbjct  413  DLQTGLKKFVRWYLSYYSGGKKA  435



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 183/206 (89%), Gaps = 2/206 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE + H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  290  FTRDILKGKSIPIFEAASHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLK KAK+ ++ +PRNGDV FTHANI+LA+ ELGYKP+T
Sbjct  350  VFNLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPST  409

Query  218  DLETGLKKFVKWYLNYY--GSKKRSA  147
            DL+TGLKKFV+WYL+YY  G KK  A
Sbjct  410  DLQTGLKKFVRWYLSYYRVGGKKADA  435



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  288  FTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAKK ++ +PRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  348  VFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  408  DLQTGLKKFARWYLGYYSGGKKAA  431



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  226  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I +F+ ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  286  FTRDILKGKAISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ MPRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  346  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  406  DLQTGLKKFARWYLGYYNGGKKAA  429



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  241  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  301  FTRDILKGKAISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  361  VFNLGNTSPVPVSDLVSILERLLKVKAKRHIMKLPRNGDVQFTHANISWAQRELGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYL+YY   K++
Sbjct  421  DLQTGLKKFVRWYLSYYSGGKKA  443



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGL++TGLRFFTVYGPWGRPDMAYF 
Sbjct  240  ENPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  299

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDDVVKGCL ALDTA KSTGSGGKKKG AQLR
Sbjct  300  FTKDILQGKSIDIYQTQDQKEVARDFTYIDDVVKGCLGALDTAGKSTGSGGKKKGPAQLR  359

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK V+ MPRNGDVPFTHAN+TLA  + GYKPTT
Sbjct  360  VYNLGNTSPVPVGRLVSILEGLLNTKAKKHVITMPRNGDVPFTHANVTLAYKDFGYKPTT  419

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY++Y+G ++R
Sbjct  420  DLATGLRKFVKWYVSYFGIQRR  441



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  239  QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGS GKKKG AQLR
Sbjct  299  FTKDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSSGKKKGPAQLR  358

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVGKLVS LE LL  KA+K V+ MPRNGDVP+THAN+TLA  + GYKPTT
Sbjct  359  VYNLGNTSPVPVGKLVSILEGLLSTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYKPTT  418

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY++YYG + R
Sbjct  419  DLATGLRKFVKWYVDYYGIQTR  440



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE ++H +VARDFTYIDD+VKGCL +LDTA+KSTGSGGKKK  AQLR
Sbjct  291  FTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKRPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ V+ +PRNGDVP+THANI+ A+ E GYK TT
Sbjct  351  VFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYKATT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YYG KK  A
Sbjct  411  DLQTGLKKFVRWYLSYYGDKKAVA  434



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  290  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LEKLLKVKAK+ V+ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  350  VYNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL YY   K+SA
Sbjct  410  DLKTGLKKFVEWYLGYYVEGKKSA  433



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  226  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I +F+ ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  286  FTRDILKGKPISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ MPRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  346  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  406  DLQTGLKKFARWYLGYYNGGKKAA  429



>ref|XP_006837081.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  229  EVPFSESDRTDRPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE  +H +VARDFTYIDD+VKGCL +LDTA+KSTG+GGKK+G AQLR
Sbjct  289  FTKDILQGKTIPIFEGPNHGTVARDFTYIDDIVKGCLGSLDTAEKSTGTGGKKRGPAQLR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV  LVS LE+LLKVKAKK ++ MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  349  IFNLGNTSPVPVKDLVSILERLLKVKAKKTIIKMPRNGDVPFTHANISLAQRELGYKPTT  408

Query  218  DLETGLKKFVKWYLNYY  168
            DL+TGLKKFVKWYL YY
Sbjct  409  DLQTGLKKFVKWYLGYY  425



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  239  QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  299  FTKDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  358

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG LVS LE LL  KAKK V+ MPRNGDVP+THAN+TLA  + GYKPTT
Sbjct  359  VYNLGNTSPVPVGNLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYKPTT  418

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+NYYG + R
Sbjct  419  DLATGLRKFVKWYVNYYGIQTR  440



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 2/206 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAG+EIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  212  KVPFSEKDRTDQPASLYAATKKAGZEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  271

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  272  FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  331

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDVPFTHANI+ A+ E GYKP+T
Sbjct  332  VFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPST  391

Query  218  DLETGLKKFVKWYLNYY--GSKKRSA  147
            DL+TGLKKFV+WYL YY  G KK +A
Sbjct  392  DLQTGLKKFVRWYLGYYKQGGKKVAA  417



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+V+GCLAALDTA+KSTGSGGKKKG AQLR
Sbjct  292  FTRDILKGKSISIFEAANHGTVARDFTYIDDIVRGCLAALDTAEKSTGSGGKKKGPAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLK+KAK+ +L +PRNGDV +THANI+LA+ ELGYKPTT
Sbjct  352  VYNLGNTSPVPVSDLVSILERLLKLKAKRNILRLPRNGDVQYTHANISLAQRELGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL++GLKKFV+WYL +Y   K+S
Sbjct  412  DLQSGLKKFVRWYLRFYADGKKS  434



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  222  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  281

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  282  FTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  341

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+  + +PRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  342  VFNLGNTSPVPVTDLVTILERLLKVKAKRNTMKLPRNGDVPFTHANISSAQRELGYKPTT  401

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  402  DLQTGLKKFARWYLGYYNGGKKAA  425



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 183/207 (88%), Gaps = 2/207 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE   H SVARDFTYIDD+VKGC+A+LDTAKKSTGSGGKKKG AQLR
Sbjct  291  FTKDILKGKPITIFEAPGHGSVARDFTYIDDIVKGCVASLDTAKKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            + NLGNT PVPV  LVS LEK LKVKAK+KVL MPRNGDV FTHANI+LA  EL YKPTT
Sbjct  351  VINLGNTSPVPVSNLVSILEKHLKVKAKRKVLPMPRNGDVRFTHANISLAHKELRYKPTT  410

Query  218  DLETGLKKFVKWYLNYY-GSKKR-SAW  144
            DLETGLKKFVKWYL +Y GSKK+ SAW
Sbjct  411  DLETGLKKFVKWYLTHYSGSKKKISAW  437



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 184/206 (89%), Gaps = 2/206 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  287  FTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDVPFTHANI+ A+ E GYKP+T
Sbjct  347  VFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPST  406

Query  218  DLETGLKKFVKWYLNYY--GSKKRSA  147
            DL+TGLKKFV+WYL YY  G KK +A
Sbjct  407  DLQTGLKKFVRWYLGYYKQGGKKVAA  432



>ref|XP_007039971.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOY24472.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=431

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DI++GK I ++E+ D  SVARDFTYIDDVVKGCL ALDTAKKSTGSGGKK+G AQ R
Sbjct  287  FTRDIMKGKTITLYESPDKGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKRGPAQFR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LVS LEK+LKVKAKKKV+ +PRNGDV FTHANI+LA  ELGYKPTT
Sbjct  347  IFNLGNTSPVPVSRLVSILEKILKVKAKKKVVPLPRNGDVEFTHANISLAVRELGYKPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFV+WYL +Y   K+S+W
Sbjct  407  DLEAGLKKFVRWYLGFYLGSKKSSW  431



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLA+LDTA+KSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVTILERLLKVKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WY++YY   K+++
Sbjct  411  DLQTGLKKFVRWYVSYYSGGKKAS  434



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSEEDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK+I+IFE  +H +VARDFTYIDD+VKGCLAALDTA+KSTG GGKKKG AQLR
Sbjct  293  FTRDILKGKQIQIFEAPNHGTVARDFTYIDDIVKGCLAALDTAEKSTGRGGKKKGPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LVS LE+LLKVKA + +L MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  353  VFNLGNTSPVPVTELVSILERLLKVKANRLMLKMPRNGDVQFTHANISLAQRELGYKPTT  412

Query  218  DLETGLKKFVKWYL  177
            DL+TGLKKFV+WYL
Sbjct  413  DLQTGLKKFVRWYL  426



>ref|XP_011076316.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=421

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 180/205 (88%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PF+EKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  217  KVPFAEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  276

Query  578  FTKDILRGKEIKIFETSDHH-SVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQL  402
            FTKDIL+GK I IFE  D H SVARDFTYIDD+VKGC+AA+DTA+KSTGSGGKK G AQL
Sbjct  277  FTKDILKGKPIPIFEAPDDHGSVARDFTYIDDIVKGCVAAIDTAEKSTGSGGKKTGTAQL  336

Query  401  RIFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPT  222
            R+FNLGNT PVPV KLVS LE LLK KAKK VL MPRNGDV FTHANI+ A+ EL YKP 
Sbjct  337  RVFNLGNTSPVPVTKLVSILENLLKKKAKKNVLPMPRNGDVLFTHANISYAKKELHYKPE  396

Query  221  TDLETGLKKFVKWYLNYYGSKKRSA  147
            TDL+TGLKKFV WYL+YYGS K+S+
Sbjct  397  TDLQTGLKKFVDWYLDYYGSDKKSS  421



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+G +I IFE  +H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG+AQLR
Sbjct  293  FTKDILKGNQIPIFEAPNHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGSAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LVS LEKLLKVKA + +L MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  353  VFNLGNTSPVPVTQLVSILEKLLKVKANRLMLKMPRNGDVQFTHANISLAQKELGYKPTT  412

Query  218  DLETGLKKFVKWYL  177
            DL+TGLKKFV+WYL
Sbjct  413  DLQTGLKKFVRWYL  426



>ref|XP_004306933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLA+LDTA+KSTGSGGKKKG AQLR
Sbjct  290  FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ +L +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  350  VFNLGNTSPVPVSDLVTILERLLKVKAKRSILKLPRNGDVQFTHANISSAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL YY   K++A
Sbjct  410  DLQTGLKKFVRWYLTYYNGGKKAA  433



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  229  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGS GKKKG AQLR
Sbjct  289  FTRDILQGKTIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSRGKKKGPAQLR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+LLKVKAK+ ++ MPRNGDVPFTHANI+ A+ ELGYKP+T
Sbjct  349  VFNLGNTSPVPVSDLVGILERLLKVKAKRNIMKMPRNGDVPFTHANISSAQHELGYKPST  408

Query  218  DLETGLKKFVKWYLNYY  168
            DL+TGLKKFV+WY++YY
Sbjct  409  DLQTGLKKFVRWYVSYY  425



>ref|XP_004171294.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   291 bits (745),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  203  RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  262

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I++FE +D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGG+KKG AQLR
Sbjct  263  FTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  322

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PV V +LV  LEKLL +KAK+ VL MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  323  VFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTT  382

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGLK+FV WY  YY +  +
Sbjct  383  DLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+L+GK I IFE ++H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  294  FTRDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  354  IFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQMELGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL++GLKKFV+WYLNYY   K++
Sbjct  414  DLQSGLKKFVRWYLNYYSGGKKA  436



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  224  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+VKGCL ALDTA+KSTG+GGKK+GAAQLR
Sbjct  284  FTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAAQLR  343

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLK+KAK+ ++ +PRNGDVPFTHANI+ A+ ELGYKPTT
Sbjct  344  VFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTT  403

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  404  DLQTGLKKFARWYLGYYNGGKKAA  427



>ref|XP_004148129.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  203  RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  262

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I++FE +D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGG+KKG AQLR
Sbjct  263  FTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  322

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PV V +LV  LEKLL +KAK+ VL MPRNGDVPFTHANI+LA+ ELGYKPTT
Sbjct  323  VFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTT  382

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGLK+FV WY  YY +  +
Sbjct  383  DLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  236  QNPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  296  FTKDILQGKPITIYQTQDDREVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV VGKLVS LE LL V AKK +L MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  356  IYNLGNTSPVSVGKLVSILEGLLNVNAKKNILKMPRNGDVPFTHANVSLAYRDFGYKPTT  415

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL TGL+KFVKWY++YYG + R+
Sbjct  416  DLATGLRKFVKWYVSYYGIQSRA  438



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEE AH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSEKDRTDQPASLYAATKKAGEEFAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGVAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LEKLLKVKAK+ V+ +PRNGDV FTHANI+LA  E+GYKP+T
Sbjct  354  VFNLGNTSPVPVSDLVGILEKLLKVKAKRLVMKLPRNGDVQFTHANISLAEREIGYKPST  413

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY + K++A
Sbjct  414  DLQTGLKKFVQWYLSYYENGKKAA  437



>ref|XP_008234372.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Prunus mume]
Length=409

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DR DQPASLYAATKKAGEEIAH YNHI+GLSITGLRFFTVYGPWGRPDM YFS
Sbjct  206  KVPFSEEDRADQPASLYAATKKAGEEIAHAYNHIHGLSITGLRFFTVYGPWGRPDMMYFS  265

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK++LRGK I +FE  DH SVARDFTYIDDVVKGCLAALDTA+KSTGSGG+ +G AQLR
Sbjct  266  FTKNMLRGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPAQLR  325

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV ++VS +E+LL+VKAKK V+ MPRNGDV FTHANI+LAR ELGY PTT
Sbjct  326  VFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYMPTT  385

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGL+KF+ WYL+YY   KR
Sbjct  386  DLKTGLRKFLNWYLDYYSESKR  407



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  186  EVPFSEIDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  245

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I I++T D   VARDFTYIDDVVKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  246  FTKDILQGKQIDIYQTQDQKQVARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPAQLR  305

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVGKLVS LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  306  VYNLGNTSPVPVGKLVSILENLLNTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYKPTT  365

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY+ YYG + +
Sbjct  366  DLSSGLRKFVKWYVGYYGIQTK  387



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+L+GK I IFE ++H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  294  FTRDLLKGKPIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  354  VFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL++GLKKFV+WYLNYY   K++
Sbjct  414  DLQSGLKKFVRWYLNYYSGGKKA  436



>ref|XP_002509598.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50985.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=437

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GKEI IF+T+D  SVARDFTYIDD+VKGCLAALDTAKKSTGSGGKKKGAAQ R
Sbjct  290  FTKDILKGKEIGIFQTADGRSVARDFTYIDDIVKGCLAALDTAKKSTGSGGKKKGAAQFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LV  LE LLKVKAKKKVL +PRNGDV FTHANI+ A+ ELGY+PTT
Sbjct  350  LFNLGNTSPVPVSRLVGILESLLKVKAKKKVLPLPRNGDVEFTHANISFAQRELGYRPTT  409

Query  218  DLETGLKKFVKWYLNYY  168
            DL TGLKKFV+WYLN+Y
Sbjct  410  DLGTGLKKFVRWYLNHY  426



>ref|XP_006440401.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
 gb|ESR53641.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
Length=427

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  218  KVPFSEKDRTDQPASLYAATKKAGEAIAHAYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  277

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DI+RGK I ++E  D  SVARDFTYIDD+VKGCLAALDTAKKSTGSGGKKKG A+ R
Sbjct  278  FTRDIIRGKRITVYEAPDGASVARDFTYIDDIVKGCLAALDTAKKSTGSGGKKKGPAEFR  337

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LVS LEK+LKVKA+ KVL +PRNGDV FTHANI+LA+ ELGY PTT
Sbjct  338  IFNLGNTTPVPVSRLVSLLEKILKVKAETKVLPLPRNGDVQFTHANISLAQRELGYMPTT  397

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DLETGLKKFV+WYL+YY S   S
Sbjct  398  DLETGLKKFVRWYLSYYNSASAS  420



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  236  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  296  FTRDILKGKTIPIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPAQLR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE+LLK KAK+ V+ +PRNGDV FTHANI+ A+ ELGYKP T
Sbjct  356  VFNLGNTSPVPVSDLVSILERLLKTKAKRNVMKLPRNGDVQFTHANISYAQTELGYKPVT  415

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+TGLKKFV+WYLNYY   K++
Sbjct  416  DLQTGLKKFVRWYLNYYSGGKKA  438



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  245  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  304

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I I++T D   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  305  FTKDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  364

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LE LL  KAKK ++ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  365  IYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYKPTT  424

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  425  DLPTGLRKFVKWYVGYYGIQSR  446



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  240  QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  299

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  300  FTKDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  359

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE LL  KAKK V+ MPRNGDVP+THAN+TLA  + GYKP+T
Sbjct  360  VYNLGNTSPVPVANLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYKPST  419

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+NYYG + R
Sbjct  420  DLATGLRKFVKWYVNYYGIQTR  441



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK   IFE ++H +VARDFTYIDD+VKGCLA+LDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTRDILKGKTXPIFEGANHRTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+K+  +PRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  354  VFNLGNTSPVPVTDLVTILERLLKVKAKRKITKLPRNGDVQFTHANISLAQRELGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K+++
Sbjct  414  DLQTGLKKFVRWYLSYYSGGKKAS  437



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLA+LDTA+KSTGSGGKKKG AQLR
Sbjct  288  FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  348  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K+++
Sbjct  408  DLQTGLKKFVRWYLSYYSGGKKAS  431



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  245  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  304

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I I++T D   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  305  FTKDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  364

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LE LL  KAKK ++ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  365  IYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYKPTT  424

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  425  DLPTGLRKFVKWYVGYYGIQSR  446



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  202  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE S++ SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  262  FTKDILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNAQLR  321

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKAKK VL +PRNGDV FTHANI+ A  E GYKPTT
Sbjct  322  VFNLGNTSPVPVTKLVSILEKLLKVKAKKNVLPLPRNGDVMFTHANISYAHKEFGYKPTT  381

Query  218  DLETGLKKFVKWYLNYY--GSKKRSAW  144
            +L+ GL+KFV WYL+YY    KK+S W
Sbjct  382  NLQMGLQKFVNWYLDYYSVSEKKKSFW  408



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+ K I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTG+GGKKKG AQLR
Sbjct  291  FTRDILKRKPIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGTGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLKVK K+ ++ +PRNGDV FTHAN++LA+ ELGYKPTT
Sbjct  351  VYNLGNTSPVPVSTLVSILERLLKVKVKRNIMKLPRNGDVQFTHANVSLAQRELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFVKWY ++Y   K++A
Sbjct  411  DLQTGLKKFVKWYTSFYSGGKKAA  434



>ref|XP_007221187.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
 gb|EMJ22386.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
Length=410

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DR DQPASLYAATKKAGEEIAH Y+HIYGLSITGLRFFTVYGPWGRPDM YFS
Sbjct  206  KVPFSEEDRADQPASLYAATKKAGEEIAHAYHHIYGLSITGLRFFTVYGPWGRPDMVYFS  265

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK++L GK I +FE  DH SVARDFTYIDDVVKGCLAALDTA+KSTGSGG+ +G AQLR
Sbjct  266  FTKNMLSGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPAQLR  325

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV ++VS +E+LL+VKAKK V+ MPRNGDV FTHANI+LAR ELGY PTT
Sbjct  326  VFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYMPTT  385

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGL+KF+ WYL+YY   KR +
Sbjct  386  DLKTGLRKFLNWYLDYYSESKRES  409



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  236  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  296  FTRDILKGKTIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+LLK KAK+ ++ +PRNGDV FTHANI+ A+ ELGYKP T
Sbjct  356  VFNLGNTSPVPVSDLVGILERLLKTKAKRNIMKLPRNGDVQFTHANISYAQRELGYKPVT  415

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL+ GLKKFV+WYLNYY S K++
Sbjct  416  DLQAGLKKFVRWYLNYYSSGKKA  438



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  224  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+VKGCL ALDTA+KSTG+GGKK+GAAQLR
Sbjct  284  FTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAAQLR  343

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLK+KAK+ ++ +PRNGDVPFTHANI+ A+ ELGYKPT 
Sbjct  344  VFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTI  403

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  404  DLQTGLKKFARWYLGYYNGGKKAA  427



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  226  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  286  FTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  346  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKF +WYL YY   K++A
Sbjct  406  DLQTGLKKFARWYLGYYNGGKKAA  429



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   290 bits (743),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  242  QVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  301

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I +++T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  302  FTKDILHGKPIDVYQTQDEKQVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  361

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVGKLV+ LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  362  VYNLGNTSPVPVGKLVAILESLLNTKAKKHIIKMPRNGDVPYTHANVSLAYKDFGYKPTT  421

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY++YYG + R
Sbjct  422  DLSSGLRKFVKWYVSYYGIQTR  443



>gb|KJB43946.1| hypothetical protein B456_007G225300 [Gossypium raimondii]
Length=432

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = -3

Query  749  FSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTK  570
            FSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF FTK
Sbjct  231  FSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFFFTK  290

Query  569  DILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIFN  390
            DI++GK I ++E+ D  SVARDFTYIDD+VKGCL ALDTAKKSTGSGGKK+G AQLRIFN
Sbjct  291  DIMKGKTITVYESPDKGSVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKRGPAQLRIFN  350

Query  389  LGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDLE  210
            LGNT PVPV  LVS LEK+LKVKAKKKV+ +PRNGDV FTHANITLA  ELGYKP TDLE
Sbjct  351  LGNTSPVPVSTLVSILEKILKVKAKKKVMPLPRNGDVEFTHANITLAMTELGYKPATDLE  410

Query  209  TGLKKFVKWYLNYY-GSKKRSA  147
             GLKKFV+WY ++Y GSKK+S+
Sbjct  411  AGLKKFVRWYFSFYSGSKKKSS  432



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTD+PASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  237  ENPFSELHRTDRPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  296

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I ++ T D H VARDFTYIDDVV+GCL ALDTA+KSTGSGG+KK  AQLR
Sbjct  297  FTKDILQGKPIDVYRTHDQHEVARDFTYIDDVVRGCLGALDTAQKSTGSGGRKKAPAQLR  356

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LV  LE LL  KAK+ V+ MPRNGDVPFTHAN+TLA  + GYKPTT
Sbjct  357  VYNLGNTSPVPVGRLVGILESLLGTKAKRHVITMPRNGDVPFTHANVTLAGRDFGYKPTT  416

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL TGL+KFVKWY++YYG + RS
Sbjct  417  DLATGLRKFVKWYVSYYGVEPRS  439



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 181/208 (87%), Gaps = 3/208 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  244  KVPFSEKDRTDEPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  303

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+L+GKEI +FE  +H +VARDFTYIDD+VKGCL ALDTAKKSTG+GGKKKG AQ R
Sbjct  304  FTKDMLKGKEITVFEGPNHSTVARDFTYIDDIVKGCLGALDTAKKSTGTGGKKKGPAQFR  363

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V +LVS LEKLLKVK+ KKVL +PRNGDV FTHANITLA+ EL YKPTT
Sbjct  364  IFNLGNTSPVSVNQLVSILEKLLKVKSNKKVLPLPRNGDVQFTHANITLAQRELRYKPTT  423

Query  218  DLETGLKKFVKWYLNYYGSKKR---SAW  144
            DL+TGLKKFV+WYL+YY   KR   S W
Sbjct  424  DLQTGLKKFVRWYLSYYSGTKRKTTSVW  451



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   289 bits (739),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  223  KVPFSEKDKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  282

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+G  I IFE  +H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  283  FTKDILKGNSISIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  342

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LVS LE+LLKVKAK+ V+ MPRNGDV FTHANI+ A+ E GYKPTT
Sbjct  343  VFNLGNTSPVPVTELVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYKPTT  402

Query  218  DLETGLKKFVKWYLNYY  168
            DLETGLK FV+WYLNYY
Sbjct  403  DLETGLKNFVRWYLNYY  419



>ref|XP_006477270.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Citrus sinensis]
 gb|KDO63776.1| hypothetical protein CISIN_1g042406mg [Citrus sinensis]
Length=424

 Score =   289 bits (739),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  215  KVPFSEKDRTDQPASLYAATKKAGEAIAHAYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  274

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DI+RGK I ++E  D  SVARDFTYIDD+VKGCLA LDTAKKSTGSGGKKKG A+ R
Sbjct  275  FTRDIIRGKRITVYEAPDGASVARDFTYIDDIVKGCLAGLDTAKKSTGSGGKKKGPAEFR  334

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LVS LEK+LKVKA+ KVL +PRNGDV FTHANI+LA+ ELGY PTT
Sbjct  335  IFNLGNTTPVPVSRLVSLLEKILKVKAETKVLPLPRNGDVQFTHANISLAQRELGYMPTT  394

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DLETGLKKFV+WYL+YY S   S
Sbjct  395  DLETGLKKFVRWYLSYYNSASAS  417



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   289 bits (740),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  291  FTRDILKGKSISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  351  VFNLGNTSPVPVSDLVTILERLLKVKAKRALMKLPRNGDVQFTHANISFAQRELGYKPTT  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
             L+TGLKKFV+WYL+YY   K+SA
Sbjct  411  YLQTGLKKFVRWYLSYYVDGKKSA  434



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   290 bits (741),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 180/205 (88%), Gaps = 2/205 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+T LRFFTVYGPWGRPDMAYF 
Sbjct  245  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  304

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  305  FTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPAQLR  364

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LVS LE LLKVKAK+ V+ +PRNGDV +THANI+ A+ ELGYKPTT
Sbjct  365  VFNLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPRNGDVQYTHANISYAKRELGYKPTT  424

Query  218  DLETGLKKFVKWYLNYY--GSKKRS  150
            DL+ GLKKFV+WYLNYY  G KK S
Sbjct  425  DLQGGLKKFVRWYLNYYKPGGKKSS  449



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLA+LDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTRDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  354  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K+++
Sbjct  414  DLQTGLKKFVRWYLSYYSGGKKAS  437



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLA+LDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTRDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  354  VFNLGNTSPVPVMDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFV+WYL+YY   K+++
Sbjct  414  DLQTGLKKFVRWYLSYYSGGKKAS  437



>ref|XP_011033905.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Populus euphratica]
Length=436

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE +AH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  RVPFSEKDRTDQPASLYAATKKAGEALAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GKEI ++ET+D  SVARDFTYIDD+VKGCLAALDTA+ STGSGGKK+G AQLR
Sbjct  291  FTKNILKGKEIGVYETADGKSVARDFTYIDDIVKGCLAALDTARNSTGSGGKKRGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKAKKKVL +PRNGDV FTHANI+ A+ ELGY PTT
Sbjct  351  VFNLGNTSPVPVSKLVSILEKLLKVKAKKKVLPLPRNGDVEFTHANISSAQRELGYMPTT  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLE GLKKFV+WY +Y+ GSKK+ +W
Sbjct  411  DLEMGLKKFVRWYTDYFSGSKKKKSW  436



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSERDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+V+GCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  288  FTRDILKGKVIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV  LE+LLK+KAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  348  VFNLGNTSPVPVSDLVGILERLLKIKAKRNIMKLPRNGDVQFTHANISYAQRELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL +GLKKFV+WYLNYY   K++
Sbjct  408  DLHSGLKKFVRWYLNYYSGGKKA  430



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTD+PASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  240  ENPFSERDRTDRPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  299

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I+ T D  +VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  300  FTKDILQGKPIDIYRTQDQKAVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  359

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK V+ +PRNGDVP+THAN+TLA  + GYKPTT
Sbjct  360  VYNLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPRNGDVPYTHANVTLAYKDFGYKPTT  419

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY+NY+G + +
Sbjct  420  DLSSGLRKFVKWYVNYFGIESK  441



>ref|XP_011014804.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Populus euphratica]
Length=436

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE +AH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  RVPFSEKDRTDQPASLYAATKKAGEALAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GKEI ++ET+D  SVARDFTYIDD+VKGCLAALDTA+ STGSGGKK+G AQLR
Sbjct  291  FTKNILKGKEIGVYETADGKSVARDFTYIDDIVKGCLAALDTARNSTGSGGKKRGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKAKKKVL +PRNGDV FTHANI+ A+ ELGY PTT
Sbjct  351  VFNLGNTSPVPVSKLVSILEKLLKVKAKKKVLPLPRNGDVEFTHANISSAQRELGYMPTT  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLE GLKKFV+WY +Y+ GSKK+ +W
Sbjct  411  DLEMGLKKFVRWYTDYFSGSKKKKSW  436



>ref|XP_009114689.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=297

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD PASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  92   KVPFSEKDRTDHPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  151

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  152  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  211

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV  LEKLLK+KAKKKV+ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  212  IYNLGNTSPVPVTKLVKILEKLLKMKAKKKVMPLPRNGDVEFTHANITLAQTEIGYKPAV  271

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  272  DLETGLKKFVKWYMGFYSGSKKKSSW  297



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+T LRFFTVYGPWGRPDMAYF 
Sbjct  229  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCLAALDTA+KSTGSGGKKKG AQ R
Sbjct  289  FTRDILKGKTISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQFR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLKV AK+ V+ +P+NGDV FTHANI+LA+ ELGYKP+T
Sbjct  349  VYNLGNTSPVPVSDLVSILERLLKVDAKRNVMKLPQNGDVRFTHANISLAQRELGYKPST  408

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TG+KKFV+WYL+YY    ++A
Sbjct  409  DLQTGMKKFVRWYLSYYSGGNKAA  432



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  225  RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  284

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE  +H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  285  FTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  344

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  345  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  404

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            +L+TGLKKF +WYL YY   K++A
Sbjct  405  NLQTGLKKFARWYLGYYNGGKKAA  428



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = -3

Query  752  PFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  573
            PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF FT
Sbjct  247  PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  572  KDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIF  393
            KDIL+GK I +F+T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLRI+
Sbjct  307  KDILQGKPINVFKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  392  NLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDL  213
            NLGNT PVPVGKLVS LE LL  KAKK V+ MPRNGDVP+THAN+TLA  + GYKPTTDL
Sbjct  367  NLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  426

Query  212  ETGLKKFVKWYLNYYGSKKR  153
             +GL+KFVKWY++YYG + R
Sbjct  427  ASGLRKFVKWYVSYYGIESR  446



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  224  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+V+GCL ALDTA+KSTGSGGKKKG A  R
Sbjct  284  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPAMFR  343

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAK+K++ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  344  IYNLGNTSPVPVTKLVTILEKLLKMKAKRKIMPLPRNGDVEFTHANITLAQTEIGYKPEV  403

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLE GLKKFVKWY+ +Y GSKK+S+W
Sbjct  404  DLEAGLKKFVKWYMGFYTGSKKKSSW  429



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE S+H +VARDFT+IDD+VKGC++ALDTA+KSTGSGGKKKG AQLR
Sbjct  288  FTRDILKGKPIPIFEASNHGTVARDFTFIDDIVKGCVSALDTAEKSTGSGGKKKGPAQLR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LV+ LEKLLK KA + V+ +PRNGDV FTHANI+LA+ EL YKPTT
Sbjct  348  VYNLGNTSPVPVSDLVTILEKLLKKKANRMVMKLPRNGDVQFTHANISLAQRELDYKPTT  407

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFV+WYL+YY 
Sbjct  408  DLQTGLKKFVRWYLDYYA  425



>ref|XP_010662214.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Vitis vinifera]
Length=341

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD+PASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  136  KVPFSEKDRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  195

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL GK I IFE  DH SVARDFTYIDD+VKGCLA+LDTAKKSTG+GGKKKGAAQ R
Sbjct  196  FTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAAQFR  255

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V KLVS LEKLLKVKAK++VL MPRNGDV +THANI+LA+ ELGYKPTT
Sbjct  256  IFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYKPTT  315

Query  218  DLETGLKKFVKWYLNY  171
            DLE+GLKKFV+WY+ Y
Sbjct  316  DLESGLKKFVRWYITY  331



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IF+ ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+GAAQLR
Sbjct  287  FTRDILKGKAISIFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LVS LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A  E GYKP+T
Sbjct  347  VFNLGNTSPVPVTELVSILERLLKVKAKRNMMKLPRNGDVAFTHANISWAEREFGYKPST  406

Query  218  DLETGLKKFVKWYLNYY  168
            DL+TGLKKFV+WYL YY
Sbjct  407  DLQTGLKKFVRWYLGYY  423



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  291  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAKKK++ +PRNGDV FTHANITLA+ ELGYKP  
Sbjct  351  IYNLGNTSPVPVTKLVTILEKLLKMKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPAV  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  411  DLETGLKKFVKWYMGFYTGSKKKSSW  436



>ref|XP_002303529.2| hypothetical protein POPTR_0003s11410g [Populus trichocarpa]
 gb|EEE78508.2| hypothetical protein POPTR_0003s11410g [Populus trichocarpa]
Length=434

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 184/204 (90%), Gaps = 1/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE +AH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  231  RVPFSEKDRTDQPASLYAATKKAGEALAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GKEI ++ET+D  SVARDFTYIDD+VKGCLAALDTAK STGSGGKK+G AQLR
Sbjct  291  FTKNILKGKEIGVYETADGKSVARDFTYIDDIVKGCLAALDTAKNSTGSGGKKRGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKAKKKVL +PRNGDV FTHANI+ A+ ELGY PTT
Sbjct  351  LFNLGNTSPVPVSKLVSILEKLLKVKAKKKVLPLPRNGDVEFTHANISSAQRELGYMPTT  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRS  150
            DLETGLKKFV+WY  Y+ GSKK+S
Sbjct  411  DLETGLKKFVRWYTGYFSGSKKKS  434



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  291  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAKKK++ +PRNGDV FTHANITLA+ ELGYKP  
Sbjct  351  IYNLGNTSPVPVTKLVTILEKLLKMKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPAV  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  411  DLETGLKKFVKWYMGFYTGSKKKSSW  436



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 182/207 (88%), Gaps = 2/207 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  202  KAPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GK I +FE S++ SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  262  FTKNILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNAQLR  321

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKA+K VL +PRNGDV FTHANI+ A+ E GYKP+T
Sbjct  322  VFNLGNTSPVPVTKLVSLLEKLLKVKARKNVLPLPRNGDVMFTHANISYAQKEFGYKPST  381

Query  218  DLETGLKKFVKWYLNYY--GSKKRSAW  144
            DL+ G++KF+ WYL+YY    KK+S W
Sbjct  382  DLQMGIQKFLNWYLDYYSISEKKKSFW  408



>gb|KDO65412.1| hypothetical protein CISIN_1g015113mg [Citrus sinensis]
Length=413

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQP+SLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDM YF 
Sbjct  208  KIPFSEKDRTDQPSSLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMVYFF  267

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+ K + IFE  +H +VARDFTYIDD+VKGCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  268  FTKNILKRKPVMIFEGPNHATVARDFTYIDDIVKGCLAALDTAKKSTGSGGKKKGAAQLR  327

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGN  P PVGKLVS LEKLLKVKAKK VL MP NGDV FTHAN++LAR ELGYKPTT
Sbjct  328  VFNLGNKSPEPVGKLVSILEKLLKVKAKKIVLPMPANGDVLFTHANVSLARRELGYKPTT  387

Query  218  DLETGLKKFVKWYLNYYG-SKKRSA  147
            +L+TGLKKFV+WYL+YY  S K+SA
Sbjct  388  NLQTGLKKFVRWYLDYYSDSGKKSA  412



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  291  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAKKK++ +PRNGDV FTHANITLA+ ELGYKP  
Sbjct  351  IYNLGNTSPVPVTKLVTILEKLLKMKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPAV  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  411  DLETGLKKFVKWYMGFYTGSKKKSSW  436



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score =   286 bits (733),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD TDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  224  KVPFSEKDPTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+V+GCL ALDTA+KSTGSGGKKKG A  R
Sbjct  284  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPAMFR  343

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAK+K++ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  344  IYNLGNTSPVPVTKLVTILEKLLKMKAKRKIMPLPRNGDVEFTHANITLAQTEIGYKPEV  403

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  404  DLETGLKKFVKWYMGFYTGSKKKSSW  429



>ref|XP_008439108.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis melo]
Length=408

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  203  RVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  262

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+ K I++FE +D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGG+KKG AQLR
Sbjct  263  FTKDILKRKTIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLR  322

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PV V +LV  LEKLL +KAK+ VL MP NGDVPFTHANI+LA+ ELGYKPTT
Sbjct  323  VFNLGNTSPVTVSELVDNLEKLLNMKAKRLVLPMPMNGDVPFTHANISLAQKELGYKPTT  382

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGLK+FV WY  YY + ++
Sbjct  383  DLKTGLKEFVDWYRLYYSNSRK  404



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  290  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAKKK++ +PRNGDV FTHANITLA+ E+GYKP+ 
Sbjct  350  IYNLGNTSPVPVTKLVTILEKLLKMKAKKKIMPLPRNGDVEFTHANITLAQAEIGYKPSV  409

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  410  DLETGLKKFVKWYMGFYTGSKKKSSW  435



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = -3

Query  752  PFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  573
            PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF FT
Sbjct  247  PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  306

Query  572  KDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIF  393
            KDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLRI+
Sbjct  307  KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAQKSTGSGGKKKGPAQLRIY  366

Query  392  NLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDL  213
            NLGNT PVPVGKLVS LE LL  KAKK V+ MPRNGDVP+THAN+TLA  + GYKPTTDL
Sbjct  367  NLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  426

Query  212  ETGLKKFVKWYLNYYGSKKR  153
             +GL+KFVKWY++YYG + R
Sbjct  427  ASGLRKFVKWYVSYYGIESR  446



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK + +++T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  294  FTKDILHGKTVDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LE LL  KAKK ++ MPRNGDVP+THAN+TLA  + GYKPTT
Sbjct  354  IYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTLAYKDFGYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  414  DLATGLRKFVKWYVRYYGIQSR  435



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG+A  R
Sbjct  293  FTKDILKGKTITVFESPDEGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGSAMFR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK KAKKK++ +PRNGDV FTHANITLA+ ELGYKPT 
Sbjct  353  IYNLGNTSPVPVTKLVTILEKLLKTKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPTV  412

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGLKKFVKWY+ +Y +KK+S+W
Sbjct  413  DLETGLKKFVKWYMGFY-TKKKSSW  436



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  ENPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I +++T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTKDILHGKTIDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLV+ LE LL  KAKK V+ MPRNGDVP+THAN+TLA  + GYKP T
Sbjct  354  IYNLGNTSPVPVGKLVTILENLLTTKAKKHVIKMPRNGDVPYTHANVTLAYRDFGYKPVT  413

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  414  DLSTGLRKFVKWYVRYYGIQPR  435



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 182/207 (88%), Gaps = 2/207 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  292  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK KAKKK++ +PRNGDV FTHANITLA+ ELGYKPT 
Sbjct  352  IYNLGNTSPVPVTKLVTILEKLLKTKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPTV  411

Query  218  DLETGLKKFVKWYLNYY--GSKKRSAW  144
            DLETGLKKFVKWY+ +Y   SKK+S+W
Sbjct  412  DLETGLKKFVKWYMGFYTGSSKKKSSW  438



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  243  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  302

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  303  FTKDILQGKTIDVYKTVDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  362

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVG+LVS LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  363  IYNLGNTSPVPVGRLVSILEALLNSKAKKHVIKMPRNGDVPYTHANVSLALHDFGYKPTT  422

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY++YYG + R
Sbjct  423  DLASGLRKFVKWYVSYYGIESR  444



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG+A  R
Sbjct  292  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGSAMFR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK KAKKK++ +PRNGDV FTHANITLA+ ELGYKPT 
Sbjct  352  IYNLGNTSPVPVTKLVTILEKLLKTKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPTV  411

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGLKKFVKWY+ +Y +KK+S+W
Sbjct  412  DLETGLKKFVKWYMGFY-TKKKSSW  435



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  224  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  283

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+V+GCL ALDTA+KSTGSGGKKKG A  R
Sbjct  284  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPAMFR  343

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAK+K++ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  344  IYNLGNTSPVPVSKLVTILEKLLKMKAKRKIMPLPRNGDVEFTHANITLAQTEIGYKPEV  403

Query  218  DLETGLKKFVKWYLNYY-GSKKRSA  147
            DLETGLKKFVKWY+ ++ GSKK+S+
Sbjct  404  DLETGLKKFVKWYMGFHTGSKKKSS  428



>gb|KEH31675.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=436

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLSIT LRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSITALRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I +FE+ D  SVARDFTYIDDVVKGCL ALDTAKKSTGSGGKKKG+AQ R
Sbjct  288  FTKDILKGKQITVFESPDGGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKKGSAQFR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLV+ LEKLLKV AKK+VL MPRNGDV FTHANI+LA+ E GYKPT 
Sbjct  348  VFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNGDVKFTHANISLAQREFGYKPTI  407

Query  218  DLETGLKKFVKWYLNYY  168
            DLETGL+KFVKWYL +Y
Sbjct  408  DLETGLRKFVKWYLEFY  424



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  245  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  304

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T+D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  305  FTKDILHGKSIDIYRTADNKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  364

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KA+K ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  365  VYNLGNTSPVPVGRLVSILEGLLGTKARKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  424

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  425  DLAAGLRKFVKWYVSYYGVQPR  446



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  249  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  308

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  309  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLR  368

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  369  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  428

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  429  DLAAGLRKFVKWYVGYYGIQPR  450



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  240  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  299

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  300  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  359

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  360  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTT  419

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  420  DLAAGLRKFVKWYVSYYGIQPR  441



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = -3

Query  752  PFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  573
            PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF FT
Sbjct  242  PFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  301

Query  572  KDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIF  393
            KDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKK+G AQLRI+
Sbjct  302  KDILQGKTIDVYKTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  361

Query  392  NLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDL  213
            NLGNT PVPVGKLV  LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTTDL
Sbjct  362  NLGNTSPVPVGKLVGILESLLTTKAKKHVIRMPRNGDVPYTHANVSLANRDFGYKPTTDL  421

Query  212  ETGLKKFVKWYLNYYGSKKR  153
             TGL+KFV+WY++YYG + R
Sbjct  422  STGLRKFVRWYVSYYGIQTR  441



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  247  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  307  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  367  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  426

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  427  DLAAGLRKFVKWYVGYYGIQPR  448



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  249  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  308

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  309  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLR  368

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  369  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  428

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  429  DLAAGLRKFVKWYVGYYGIQPR  450



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  249  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  308

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  309  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLR  368

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  369  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  428

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  429  DLAAGLRKFVKWYVGYYGIQPR  450



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  241  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  301  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  361  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  421  DLAAGLRKFVKWYVSYYGIQPR  442



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  247  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  307  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  367  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  426

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  427  DLAAGLRKFVKWYVGYYGIQPR  448



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  248  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  307

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  308  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLR  367

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  368  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  427

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  428  DLAAGLRKFVKWYVGYYGIQPR  449



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  243  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  302

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  303  FTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  362

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  363  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPFTHANVSLAYRDFGYKPTT  422

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  423  DLATGLRKFVKWYVGYYGIQPR  444



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  243  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  302

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  303  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  362

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  363  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTT  422

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  423  DLAAGLRKFVKWYVSYYGIQPR  444



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            ++PFSE  RTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  206  ESPFSELHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  265

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTG GGKK GAAQLR
Sbjct  266  FTKSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAAQLR  325

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVGKLVS LE LL+VKAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  326  VYNLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYKPTT  385

Query  218  DLETGLKKFVKWYLNYYGSK  159
            DL TGL+KFV+WY+ YYG +
Sbjct  386  DLATGLRKFVQWYVGYYGVR  405



>ref|XP_004515772.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Cicer arietinum]
Length=438

 Score =   284 bits (727),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 180/208 (87%), Gaps = 3/208 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSIT LRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITALRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  +V+RDFTYIDD+VKGCL ALDTAKKSTGSGGKKKG+AQ R
Sbjct  291  FTKDILKGKTITVFESPDGGTVSRDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGSAQFR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKV AKKKVL MPRNGDV FTHANI+LA  +LGY+PT 
Sbjct  351  VFNLGNTSPVPVSDLVAILERLLKVTAKKKVLPMPRNGDVKFTHANISLAHKDLGYRPTI  410

Query  218  DLETGLKKFVKWYLNYYGSK---KRSAW  144
            DLETGL+KFVKWYL +Y S    K+ AW
Sbjct  411  DLETGLRKFVKWYLEFYSSGSNYKKVAW  438



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   284 bits (727),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  233  KVPFSEKDATDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK I IFE ++H +VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+  AQLR
Sbjct  293  FTRDILKGKPISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRRPAQLR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV  LV+ LE+LLKVKAK+ ++ +PRNGDV FTHANI+ A+ ELGYKPTT
Sbjct  353  VFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTT  412

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL++GLKKF +WYL YY   K++
Sbjct  413  DLQSGLKKFARWYLGYYNGGKKA  435



>gb|KDP22397.1| hypothetical protein JCGZ_26228 [Jatropha curcas]
Length=414

 Score =   283 bits (725),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD+P+SLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  209  KVPFSEKDRTDRPSSLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  268

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+ K I IFE  D  SVARDFTYIDD+VKGCL ALDTAKKSTGSGG KKG AQLR
Sbjct  269  FTKDILKRKPITIFEGPDRFSVARDFTYIDDIVKGCLGALDTAKKSTGSGGVKKGPAQLR  328

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLV+ LEKLLKVKAKK VL MP NGDV FTHANI+LA+ ELGYKPTT
Sbjct  329  VFNLGNTSPVPVSKLVNILEKLLKVKAKKVVLPMPANGDVLFTHANISLAQKELGYKPTT  388

Query  218  DLETGLKKFVKWYLNYY  168
            DL+TGLKKFV+WYL+YY
Sbjct  389  DLQTGLKKFVRWYLDYY  405



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  752  PFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  573
            PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF FT
Sbjct  239  PFSETDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT  298

Query  572  KDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIF  393
            KDIL+GK I I++T D   V RDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR++
Sbjct  299  KDILQGKPISIYKTHDGEEVQRDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  358

Query  392  NLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDL  213
            NLGNT PVPV +LVS LE LL VKAKK ++ MPRNGDVP+THAN+TLAR +  YKPTTDL
Sbjct  359  NLGNTSPVPVARLVSILEGLLNVKAKKHLITMPRNGDVPYTHANVTLARKDFAYKPTTDL  418

Query  212  ETGLKKFVKWYLNYYG  165
             TGL+KFVKWY+ YYG
Sbjct  419  ATGLRKFVKWYVGYYG  434



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  239  QVPFSELDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  299  FTKDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  358

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVGKLVS LE LL+ KA+K V+ MPRNGDVP+THAN+TLA  + GYKPTT
Sbjct  359  VYNLGNTSPVPVGKLVSILEGLLRTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYKPTT  418

Query  218  DLETGLKKFVKWYLNYY  168
            DL TGL+KFVKWY+  +
Sbjct  419  DLATGLRKFVKWYIKLW  435



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  243  QVPFSEIDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  302

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I ++ T +   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+  AQLR
Sbjct  303  FTKDILQGKGINVYVTQEDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRAPAQLR  362

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV VGKLV  LE LL VKAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  363  VYNLGNTAPVTVGKLVGILESLLNVKAKKHVIKMPRNGDVPFTHANVSLAYRDFGYKPTT  422

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DL  GL+KFVKWY++YYG + R+
Sbjct  423  DLAAGLRKFVKWYVSYYGIESRA  445



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGL++TGLRFFTVYGPWGRPDMAYF 
Sbjct  254  QVPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  313

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGC+ ALDTA KSTGS GKK+G AQLR
Sbjct  314  FTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSRGKKRGPAQLR  373

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  374  VYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTT  433

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  434  DLAAGLRKFVKWYVSYYGIQPR  455



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  242  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  301

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSG KK+G AQLR
Sbjct  302  FTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGRKKRGPAQLR  361

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  362  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTT  421

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  422  DLATGLRKFVKWYVGYYGIQPR  443



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGL++TGLRFFTVYGPWGRPDMAYF 
Sbjct  254  QVPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  313

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGC+ ALDTA KSTGSGGKK+G AQLR
Sbjct  314  FTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSGGKKRGPAQLR  373

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  374  VYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTT  433

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  434  DLAAGLRKFVKWYVSYYGIQPR  455



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  243  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  302

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  303  FTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  362

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  363  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTT  422

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  423  DLATGLRKFVKWYVGYYGIQPR  444



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  294  FTKDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVG+LV  LE LL VKAKK V+ MPRNGDVP+THAN++LA  + GYKP+T
Sbjct  354  IYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPST  413

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL++FVKWY++YYG + R
Sbjct  414  DLATGLRRFVKWYVSYYGIQTR  435



>ref|XP_009372935.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Pyrus 
x bretschneideri]
Length=370

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDM Y+S
Sbjct  165  KVPFSETHRTDQPASLYAATKKAGEEIAHAYNHIYGLSITGLRFFTVYGPWGRPDMMYYS  224

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+LRGK I +FE   H SVARDFTYIDDVVKG LAA+D A+KSTGSGGK +  AQLR
Sbjct  225  FTRDMLRGKPIAVFEGPGHKSVARDFTYIDDVVKGLLAAVDAAEKSTGSGGKVERPAQLR  284

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV ++V  LE+LL VKAKK V+ MPRNGDV FTHAN++LAR ELGY PTT
Sbjct  285  VFNLGNTSPVPVNEVVGILERLLGVKAKKVVVPMPRNGDVLFTHANVSLARRELGYVPTT  344

Query  218  DLETGLKKFVKWYLNYYG-SKKRSAW  144
            DL+TGL+KFV WYL+YY  S  +SAW
Sbjct  345  DLKTGLRKFVDWYLDYYSESNWKSAW  370



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  752  PFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  573
            PFSE  RTDQPASLYAATKKAGEEIAH YNHI+GLSITGLRFFTVYGPWGRPDMAYF FT
Sbjct  239  PFSESHRTDQPASLYAATKKAGEEIAHTYNHIHGLSITGLRFFTVYGPWGRPDMAYFFFT  298

Query  572  KDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIF  393
            KDIL+GK I I+ T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKK+G AQLRI+
Sbjct  299  KDILQGKPITIYRTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  358

Query  392  NLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDL  213
            NLGNT PV VGKLVS LE  L +KAKK V+ MPRNGDVPFTHAN++LA  + GYKPTTDL
Sbjct  359  NLGNTSPVSVGKLVSILEGHLSMKAKKNVVKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  418

Query  212  ETGLKKFVKWYLNYYG  165
             TGL+KFVKWY+ YYG
Sbjct  419  STGLRKFVKWYVGYYG  434



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI HIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  228  KVPFSESDRTDRPASLYAATKKAGEEITHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   D   +ARDFTYIDD+VKGC+AALDTA+ STG G +K+  AQ R
Sbjct  288  FTRNILQGKPITVYRGRDGTDLARDFTYIDDIVKGCVAALDTAEASTGIGKQKRRPAQYR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LV  LE+ LKVKA+K ++ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  348  IYNLGNTSPVTVPALVRILERYLKVKARKNMVEMPGNGDVPFTHANISLARAELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +LETGLKKFVKWYL+YYG  +R+
Sbjct  408  NLETGLKKFVKWYLSYYGYSRRA  430



>ref|XP_003549880.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Glycine max]
Length=430

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 183/205 (89%), Gaps = 2/205 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  228  KVPFSEKDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I IFE+ D  +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKKKG AQ R
Sbjct  288  FTKDILKGKQITIFESLDGGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQFR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LV+ LEKLLKVKAKKKVL MP NGDV FTHANI+LA  +LGY+PTT
Sbjct  348  VFNLGNTSPVPVSELVAILEKLLKVKAKKKVLPMPTNGDVKFTHANISLAHRDLGYRPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGL+KFVKWYL +Y   K+S+W
Sbjct  408  DLETGLRKFVKWYLEFY--SKKSSW  430



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGL++TGLRFFTVYGPWGRPDMAYF 
Sbjct  241  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLALTGLRFFTVYGPWGRPDMAYFF  300

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  301  FTKDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  360

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  361  IYNLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYKPTT  420

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY++YYG   R
Sbjct  421  DLASGLRKFVKWYVSYYGIDTR  442



>emb|CAN60968.1| hypothetical protein VITISV_008097 [Vitis vinifera]
Length=435

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD+PASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL GK I IFE  DH SVARDFTYIDD+VKGCLA+LDTAKKSTG+GGKKKGAAQ R
Sbjct  290  FTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAAQFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V KLVS LEKLLKVKAK++VL MPRNGDV +THANI+LA+ ELGYKPTT
Sbjct  350  IFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNY  171
            DLE+GLKKFV+WY+ Y
Sbjct  410  DLESGLKKFVRWYITY  425



>ref|XP_009370520.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Pyrus 
x bretschneideri]
Length=370

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDM Y+S
Sbjct  165  KVPFSETHRTDQPASLYAATKKAGEEIAHAYNHIYGLSITGLRFFTVYGPWGRPDMMYYS  224

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+LRGK I +FE   H SVARDFTYIDDVVKG LAA+DTA+KSTGSGGK +  AQLR
Sbjct  225  FTRDMLRGKPIVVFEGPGHRSVARDFTYIDDVVKGLLAAVDTAEKSTGSGGKVERPAQLR  284

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV ++V  LE+LL VKAKK V+ MPRNGDV FTHAN++LAR ELGY PTT
Sbjct  285  VFNLGNTSPVPVNEVVGILERLLGVKAKKVVVPMPRNGDVLFTHANVSLARRELGYVPTT  344

Query  218  DLETGLKKFVKWYLNYYG-SKKRSAW  144
            DL+TGL+KFV WYL+YY  S  +SAW
Sbjct  345  DLKTGLRKFVDWYLDYYSESNWKSAW  370



>ref|XP_002266529.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Vitis vinifera]
Length=408

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  206  KVPFSETDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  265

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+G  I+IFE      VARDFTYIDD+VKGCLAALDTA+KSTGSGGKK   AQLR
Sbjct  266  FTKDILQGNSIRIFEGGKGGVVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKMRPAQLR  325

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV VG LVS LE+LLKVKA++    MPRNGDV +THANI+LA  ELGYKPTT
Sbjct  326  VYNLGNTSPVEVGSLVSILERLLKVKARRVATPMPRNGDVMYTHANISLAEKELGYKPTT  385

Query  218  DLETGLKKFVKWYLNYY  168
            DL +GL+KFVKWYL YY
Sbjct  386  DLRSGLEKFVKWYLTYY  402



>ref|XP_003635586.2| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=435

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD+PASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDRPASLYAATKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL GK I IFE  DH SVARDFTYIDD+VKGCLA+LDTAKKSTG+GGKKKGAAQ R
Sbjct  290  FTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAAQFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V KLVS LEKLLKVKAK++VL MPRNGDV +THANI+LA+ ELGYKPTT
Sbjct  350  IFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYKPTT  409

Query  218  DLETGLKKFVKWYLNY  171
            DLE+GLKKFV+WY+ Y
Sbjct  410  DLESGLKKFVRWYITY  425



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD PASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEKDRTDHPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  290  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV  LEKLLK+KAKKKV+ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  350  IYNLGNTSPVPVTKLVKILEKLLKMKAKKKVMPLPRNGDVEFTHANITLAQTEIGYKPAV  409

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  410  DLETGLKKFVKWYMGFYSGSKKKSSW  435



>ref|XP_007155583.1| hypothetical protein PHAVU_003G214400g [Phaseolus vulgaris]
 gb|ESW27577.1| hypothetical protein PHAVU_003G214400g [Phaseolus vulgaris]
Length=429

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 184/205 (90%), Gaps = 2/205 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAA+KKAGEEIAH YNHIYGL+ITGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAASKKAGEEIAHSYNHIYGLAITGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I IFE+ D  +VARDFTYIDD+VKGCL ALDT+KKSTGSGGKKKG AQLR
Sbjct  287  FTKDILKGKQITIFESPDGGTVARDFTYIDDIVKGCLGALDTSKKSTGSGGKKKGPAQLR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LV+ LEKLLKVKAKKK+L MP NGDV FTHANI+LA  +LGY+PTT
Sbjct  347  VFNLGNTSPVPVSELVAILEKLLKVKAKKKMLPMPTNGDVKFTHANISLAHRDLGYRPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGL+KFVKWYL +Y   K+S+W
Sbjct  407  DLETGLRKFVKWYLEFY--SKKSSW  429



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDDVVKGCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  294  FTKDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVG+LV  LE LL VKAKK V+ MPRNGDVP+THAN++LA  + GYKP+T
Sbjct  354  IYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPST  413

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL++FVKWY++YYG + R
Sbjct  414  DLATGLRRFVKWYVSYYGIQTR  435



>gb|KFK31963.1| hypothetical protein AALP_AA6G182500 [Arabis alpina]
Length=429

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 180/205 (88%), Gaps = 2/205 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA KSTGSGGKKKG A  R
Sbjct  287  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAGKSTGSGGKKKGPAMFR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV+ LEKLLK+KAKKKV+ +PRNGDV FTHANITLA+ ELGYKP+ 
Sbjct  347  IYNLGNTSPVPVTKLVTILEKLLKMKAKKKVMPLPRNGDVEFTHANITLAQAELGYKPSV  406

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLE GLKKFVKWY+ +Y  KK+S+W
Sbjct  407  DLEAGLKKFVKWYMGFY--KKKSSW  429



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  234  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I +++T +   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTKDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LE LL  KAKK ++ MPRNGDVP+THAN+T+A  +  YKPTT
Sbjct  354  IYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  414  DLATGLRKFVKWYVRYYGIQSR  435



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  202  KVPFSEKDQTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GK I +F+ S++ SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKK  AQLR
Sbjct  262  FTKNILKGKPISVFQGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKKNAQLR  321

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKAK+ VL +P NGDV FTHANI+ A  E GYKPTT
Sbjct  322  VFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPTNGDVMFTHANISYAHKEFGYKPTT  381

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGL KFV WYL+YY   ++
Sbjct  382  DLQTGLHKFVNWYLDYYSVSEK  403



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD PASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDHPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  291  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV  LEKLLK+KAKKKV+ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  351  IYNLGNTSPVPVTKLVKILEKLLKMKAKKKVMPLPRNGDVEFTHANITLAQTEIGYKPAV  410

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y GSKK+S+W
Sbjct  411  DLETGLKKFVKWYMGFYSGSKKKSSW  436



>ref|XP_010053408.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW77692.1| hypothetical protein EUGRSUZ_D01992 [Eucalyptus grandis]
Length=437

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAY+ 
Sbjct  233  KVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYYF  292

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+ IL+ K+I+IFE   H SV+RDFTYIDDVV+GCLAALDTAKKSTGSGG KKG+AQ R
Sbjct  293  FTQHILQRKQIEIFEGPQHSSVSRDFTYIDDVVEGCLAALDTAKKSTGSGGTKKGSAQFR  352

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV KLVS LEKLLKVKAKKK+L MPRNGDV FTHANI+LA+ ELGYKPTT
Sbjct  353  VYNLGNTSPVPVTKLVSILEKLLKVKAKKKLLPMPRNGDVKFTHANISLAQRELGYKPTT  412

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DLETGLKKFVKWYL+Y+   ++
Sbjct  413  DLETGLKKFVKWYLDYHSDLRK  434



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  248  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  307

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G A LR
Sbjct  308  FTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAMLR  367

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  368  VYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTT  427

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  428  DLAAGLRKFVKWYVGYYGIQPR  449



>ref|XP_006421730.1| hypothetical protein CICLE_v10005072mg [Citrus clementina]
 gb|ESR34970.1| hypothetical protein CICLE_v10005072mg [Citrus clementina]
Length=413

 Score =   281 bits (719),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 181/205 (88%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQP+SLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDM YF 
Sbjct  208  KIPFSEKDRTDQPSSLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMVYFF  267

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+ K + IFE  +H +VARDFTYIDD+VKGCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  268  FTKNILKRKPVMIFEGPNHATVARDFTYIDDIVKGCLAALDTAKKSTGSGGKKKGAAQLR  327

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGN  P  VGKLVS LEKLLKVKAKK VL MP NGDV FTHAN++LAR ELGYKP T
Sbjct  328  VFNLGNKSPESVGKLVSILEKLLKVKAKKIVLPMPANGDVLFTHANVSLARRELGYKPAT  387

Query  218  DLETGLKKFVKWYLNYYG-SKKRSA  147
            +L+TGLKKFV+WYL+YY  S K+SA
Sbjct  388  NLQTGLKKFVQWYLDYYSDSGKKSA  412



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  247  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  307  FTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  367  VYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  426

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  427  DLAAGLRKFVKWYVGYYGIQPR  448



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  247  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  307  FTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  367  VYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  426

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  427  DLAAGLRKFVKWYVGYYGIQPR  448



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  247  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK IL GK I I+ T D+  VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  307  FTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LVS LE LL  KAKK ++ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  367  VYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTT  426

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  427  DLAAGLRKFVKWYVGYYGIQPR  448



>ref|XP_006490076.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Citrus sinensis]
Length=413

 Score =   281 bits (718),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 181/205 (88%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQP+SLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDM YF 
Sbjct  208  KIPFSEKDRTDQPSSLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMVYFF  267

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+ K + IFE   H +VARDFTYIDD+VKGCLAALDTAKKSTGSGGKKKGAAQLR
Sbjct  268  FTKNILKRKPVMIFEGPSHATVARDFTYIDDIVKGCLAALDTAKKSTGSGGKKKGAAQLR  327

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGN  P  VGKLVS LEKLLKVKAKK VL MP NGDV FTHAN++LA+ ELGYKPTT
Sbjct  328  VFNLGNKSPESVGKLVSILEKLLKVKAKKIVLPMPANGDVLFTHANVSLAQRELGYKPTT  387

Query  218  DLETGLKKFVKWYLNYYG-SKKRSA  147
            +L+TGLKKFV+WYL+YY  S K+SA
Sbjct  388  NLQTGLKKFVRWYLDYYSDSGKKSA  412



>ref|XP_003525759.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Glycine max]
Length=429

 Score =   281 bits (719),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 183/205 (89%), Gaps = 2/205 (1%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  227  KVPFSEKDRTDQPASLYAATKKAGEEIAHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK+I IFE+ D  +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKKKG AQ R
Sbjct  287  FTKDILKGKQIAIFESPDGGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQFR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV +LV+ LEKLLKVKAKKKVL MP NGDV FTHANI+LA  +LGY+PTT
Sbjct  347  VFNLGNTSPVPVTELVAILEKLLKVKAKKKVLPMPTNGDVKFTHANISLAHRDLGYRPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGL+KFVKWYL +Y   K+++W
Sbjct  407  DLETGLRKFVKWYLEFY--SKKTSW  429



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 180/205 (88%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD PASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  231  KVPFSEKDRTDHPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  291  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV  LEKLLK+KAKKKV+ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  351  IYNLGNTSPVPVTKLVKILEKLLKMKAKKKVMPLPRNGDVEFTHANITLAQSEIGYKPAV  410

Query  218  DLETGLKKFVKWYLNYYGSKKRSAW  144
            DLETGLKKFVKWY+ +Y SKK+S+W
Sbjct  411  DLETGLKKFVKWYMGFY-SKKKSSW  434



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKD+TDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  202  KVPFSEKDQTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  261

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+G  I +F+ S++ SVARDFTYID++VKGCL ALDTA+KSTGSGGKKK  AQLR
Sbjct  262  FTKNILKGNPISVFQGSNNKSVARDFTYIDEIVKGCLGALDTAEKSTGSGGKKKKNAQLR  321

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV KLVS LEKLLKVKAK+ VL +PRNGDV FTHANI+ A+ E GYKPTT
Sbjct  322  VFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPRNGDVMFTHANISYAQKEFGYKPTT  381

Query  218  DLETGLKKFVKWYLNYY  168
            DL+ GL+KFV WYL+YY
Sbjct  382  DLQMGLQKFVNWYLDYY  398



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  247  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  307  FTKDILQGKSIDVYKTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG+LV  LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKPTT
Sbjct  367  VYNLGNTSPVPVGRLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPTT  426

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG + R
Sbjct  427  DLAAGLRKFVKWYVGYYGIQPR  448



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  251  QNPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  310

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T +   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  311  FTKDILQGKTIDVYQTQEGKQVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPAQLR  370

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVG LVS LE LL  KAKK V+ MP NGDVPFTHAN++LA  +  Y PTT
Sbjct  371  VYNLGNTSPVPVGTLVSILEGLLSTKAKKHVIKMPSNGDVPFTHANVSLAYRDFSYNPTT  430

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWYL YYG ++R
Sbjct  431  DLATGLRKFVKWYLGYYGLQQR  452



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +   +ARDFTYIDD+VKGCL +LDTAKKSTGSGGKK+G AQ R
Sbjct  286  FTRNILQGKPITVYSGKNRVDLARDFTYIDDIVKGCLGSLDTAKKSTGSGGKKRGPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LVS LE+ LKVKAK+ V+ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  346  IYNLGNTSPVTVPMLVSILERHLKVKAKRNVMEMPGNGDVPFTHANISLARAELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            +LETGLKKFVKWYL YYG  +R A
Sbjct  406  NLETGLKKFVKWYLQYYGYSRRGA  429



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  244  ENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  303

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  304  FTKDILQGKSIDIYQTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  363

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPVGKLV  LE LL  KAKK V+ MPRNGDVP+THAN++LA  + GYKP T
Sbjct  364  VYNLGNTSPVPVGKLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPAT  423

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY+ YYG   R
Sbjct  424  DLAAGLRKFVKWYVGYYGIHPR  445



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFT YGPWGRPDMAYF 
Sbjct  234  ENPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTAYGPWGRPDMAYFF  293

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL GK I +++T +   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  294  FTKDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  353

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVGKLVS LE LL  KAKK ++ MPRNGDVP+THAN+T+A  +  YKPTT
Sbjct  354  IYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYKPTT  413

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWY+ YYG + R
Sbjct  414  DLATGLRKFVKWYVRYYGIQSR  435



>ref|XP_008376451.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 4-like 
[Malus domestica]
Length=407

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDM Y+S
Sbjct  202  KVPFSETHRTDQPASLYAATKKAGEEIAHAYNHIYGLSITGLRFFTVYGPWGRPDMMYYS  261

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+LRGK I +FE   H SVARDFTY+DDVVKG LAA+DTA+KSTGSGGK +  AQLR
Sbjct  262  FTRDMLRGKPIVVFEGPGHKSVARDFTYVDDVVKGLLAAVDTAEKSTGSGGKVERPAQLR  321

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PVPV ++V  LE+LL VKAKK V+ MPRNGDV FTHAN++LAR ELGY PTT
Sbjct  322  VFNLGNTSPVPVNEVVGLLERLLGVKAKKVVVPMPRNGDVLFTHANVSLARRELGYVPTT  381

Query  218  DLETGLKKFVKWYLNYYG-SKKRSAW  144
            DL+TGL+KFV WYL+YY  S  +SAW
Sbjct  382  DLKTGLRKFVDWYLDYYSESNWKSAW  407



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
              PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  237  NVPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  296

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I ++ T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+  AQLR
Sbjct  297  FTKDILQGKGINLYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRAPAQLR  356

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV VGKLVS LE LL VKAKK V+ MPRNGDVP+THAN++LA  + GY+PTT
Sbjct  357  VYNLGNTSPVSVGKLVSILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYQPTT  416

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGL+KFVKWYL+YYG + +
Sbjct  417  DLSTGLRKFVKWYLSYYGIQSK  438



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKK+GEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSESDRTDRPASLYAATKKSGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I I+   D   +ARDFTYIDD+VKGCL +LDTA+KSTGSGGKK+  AQ R
Sbjct  286  FTRNILQGKPITIYRGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LVS LE+ LKVKAK+ V+ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  346  IYNLGNTSPVTVPTLVSILERYLKVKAKRNVVEMPGNGDVPFTHANISLARAELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            +LETGLKKFVKWYL+YYG + R +
Sbjct  406  NLETGLKKFVKWYLHYYGYRPRGS  429



>ref|XP_008794557.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Phoenix dactylifera]
Length=462

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEIAH+YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  249  KVPFSESDRTDRPASLYAATKKAGEEIAHVYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  308

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++ILRGK I IFE   H +VARDFTYIDD+V+GC+AALDTA KSTGSGGKK+G A LR
Sbjct  309  FTRNILRGKPISIFEGPGHATVARDFTYIDDIVRGCVAALDTAGKSTGSGGKKRGPAPLR  368

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE LL VKA +K + MPRNGDV FTHANI+LA+ ELGY PTT
Sbjct  369  VYNLGNTSPVPVADLVSILENLLGVKAVRKAVKMPRNGDVQFTHANISLAQRELGYHPTT  428

Query  218  DLETGLKKFVKWYLNYY  168
            +L TGLK+FV+WYL YY
Sbjct  429  NLHTGLKRFVRWYLQYY  445



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KAPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   D   +ARDFTYIDD+VKGCL +LDTA+KSTGSGGKK+G AQ R
Sbjct  286  FTRNILQGKPITVYSGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRGPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LVS LE+ LK KAK+ V+ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  346  IYNLGNTSPVTVPMLVSILERHLKAKAKRNVVAMPGNGDVPFTHANISLARAELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            +LETGLKKFVKWYL+YYG   R
Sbjct  406  NLETGLKKFVKWYLHYYGYSPR  427



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE D TD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  228  KVPFSELDGTDRPASLYAATKKAGEEITHCYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  287

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I +F   D   +ARDFTYIDDVVKGC+AALDTA+ STGSGG+K+  AQ R
Sbjct  288  FTRNILQGKPITVFRGRDGTDLARDFTYIDDVVKGCVAALDTAEASTGSGGRKRSPAQYR  347

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LV  LE+ LK+KAKK V  MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  348  IYNLGNTSPVTVPALVGILERHLKMKAKKNVAEMPGNGDVPFTHANISLARAELGYKPTT  407

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            +LETGLKKFVKWYL+YYG  +R
Sbjct  408  NLETGLKKFVKWYLSYYGYSRR  429



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   279 bits (714),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  232  KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++  +   VARDFTYIDD+ KGC+AALDTAKKSTGSGGKKKG AQLR
Sbjct  292  FTKDILQGKSIDVYQGLNKVDVARDFTYIDDIAKGCVAALDTAKKSTGSGGKKKGPAQLR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LV+ LE+LLKVKAKK ++ MP NGDVPFTHAN++LA  ELGY+PTT
Sbjct  352  IYNLGNTSPVSVPDLVNILERLLKVKAKKNIISMPSNGDVPFTHANVSLAHTELGYQPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL+TGLKKFVKWYL+YYG   R
Sbjct  412  DLQTGLKKFVKWYLSYYGVPGR  433



>gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=262

 Score =   273 bits (699),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE D+TDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  57   KVPFSESDQTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  116

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +H  +ARDFTYIDD+VKGC+ +LDT+ KSTGSGGKK+G A  R
Sbjct  117  FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYR  176

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LE+ LKVKAK+ ++ MP NGDVPFTHANI+ AR ELGYKPTT
Sbjct  177  IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTT  236

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFVKWYL+YYG
Sbjct  237  DLQTGLKKFVKWYLSYYG  254



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAA+KKAGE IAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  225  ENPFSEHDRTDQPASLYAASKKAGEAIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  284

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I IF+  +   VARDFTYIDD+VKGC+ ALDTA+KSTGSG KKKG AQLR
Sbjct  285  FTKDILQGKTIPIFQGPNQVDVARDFTYIDDIVKGCVGALDTAEKSTGSGEKKKGPAQLR  344

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V +LV  LE+LLKVKAKK VL MP NGDVPFTHAN+TLA  ELGYKPTT
Sbjct  345  IYNLGNTSPVSVPELVRILEELLKVKAKKNVLRMPSNGDVPFTHANVTLASMELGYKPTT  404

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL TGLKKFVKWYL+YYG   R
Sbjct  405  DLATGLKKFVKWYLSYYGVPGR  426



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD PASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KVPFSEIDRTDHPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +FE+ D  SVARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG A  R
Sbjct  290  FTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLV  LEKLLK+KAKKKV+ +PRNGDV FTHANITLA+ E+GYKP  
Sbjct  350  IYNLGNTSPVPVTKLVKILEKLLKMKAKKKVMPLPRNGDVEFTHANITLAQSEIGYKPAV  409

Query  218  DLETGLKKFVKWYLNYY-GSKKRSAW  144
            DLETGLKKFVKWY+ +Y  SKK+S+W
Sbjct  410  DLETGLKKFVKWYMGFYSASKKKSSW  435



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            Q PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  227  QNPFSELHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I +++T D   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKK+G AQLR
Sbjct  287  FTKDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQLR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPVG LVS LE LL  KAK+ V+ MP NGDVP+THAN++ A  +  YKPTT
Sbjct  347  IYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYKPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY+ YYG + R
Sbjct  407  DLPSGLRKFVKWYVGYYGPQLR  428



>ref|XP_004147978.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
 ref|XP_004159529.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
 gb|KGN55909.1| hypothetical protein Csa_3G035870 [Cucumis sativus]
Length=440

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 178/202 (88%), Gaps = 1/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KIPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+ + I I+E  DH +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKK+  AQLR
Sbjct  290  FTRDILKRRPITIYEAPDHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKRKPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LVS LEKLLKVKAKKK+L MPRNGDV FTHANI+LA  E GY+PTT
Sbjct  350  IFNLGNTSPVPVSELVSILEKLLKVKAKKKLLPMPRNGDVKFTHANISLAHKEFGYRPTT  409

Query  218  DLETGLKKFVKWYLNYY-GSKK  156
            +L TGL+KFV WY +YY GSKK
Sbjct  410  NLRTGLEKFVNWYKDYYSGSKK  431



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
              PFSE DRTD+PASLYAATKKAGEEIAH+YNHIYGL+ITGLRFFTVYGPWGRPDMAYF 
Sbjct  238  HVPFSEVDRTDRPASLYAATKKAGEEIAHVYNHIYGLAITGLRFFTVYGPWGRPDMAYFF  297

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DILR K I IFE   H +VARDFTYIDD+V GCLAALD A KSTGSGGKK+G+A LR
Sbjct  298  FTRDILRSKPISIFEGPGHATVARDFTYIDDIVSGCLAALDNAGKSTGSGGKKRGSAPLR  357

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LE+LLKVKA + V+ MPRNGDV FTHANI+LA+ ELGY PTT
Sbjct  358  VYNLGNTSPVPVSHLVSILEQLLKVKAVRNVVKMPRNGDVQFTHANISLAQRELGYHPTT  417

Query  218  DLETGLKKFVKWYLNYY  168
             L TGLKKFV+WYL YY
Sbjct  418  GLNTGLKKFVRWYLGYY  434



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ +TDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  239  KVPFSEEHKTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+++GK I ++ T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  299  FTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  358

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLVS LE LL VKAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  359  VYNLGNTSPVSVRKLVSILENLLSVKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTT  418

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  419  DLSIGLRKFVKWYVSYYGIQSR  440



>ref|XP_009401924.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTD+PASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  247  RVPFSEAHRTDRPASLYAATKKAGEEIAHAYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  306

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL GK + IFE  DH +VARDFTYIDD+VKGCLAALD A KSTGSGGKK+G A LR
Sbjct  307  FTRDILLGKPVSIFEGPDHATVARDFTYIDDIVKGCLAALDHAGKSTGSGGKKRGPAPLR  366

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PVPV KLVS LE+LLKVKA KK++ MPRNGDV FTHANIT A+ ELGY+PTT
Sbjct  367  IYNLGNTSPVPVTKLVSILERLLKVKAVKKLVKMPRNGDVQFTHANITFAQKELGYRPTT  426

Query  218  DLETGLKKFVKWYLNYY  168
             L TGLKKFV+WYL YY
Sbjct  427  GLHTGLKKFVRWYLEYY  443



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  225  RVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  284

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GK I I+   +   +ARDFTYIDDVVKGC+A+LDTA+KSTGSGGKK+  AQ R
Sbjct  285  FTKNILKGKPITIYRGKNQVDLARDFTYIDDVVKGCVASLDTAEKSTGSGGKKRRPAQYR  344

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  +VS LEK LKVKAKK V+ MP NGDVPFTHANIT AR EL YKPTT
Sbjct  345  IFNLGNTSPVTVPMMVSILEKHLKVKAKKNVVDMPGNGDVPFTHANITAARRELAYKPTT  404

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFV+WYL+YYG
Sbjct  405  DLQTGLKKFVRWYLSYYG  422



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  232  KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   DH  +ARDFTYIDD+VKGCL +LDTA KSTG+GGKK+G A  R
Sbjct  292  FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LEK L+VKAKK V+ MP NGDVPFTHANI+LAR +LGYKPTT
Sbjct  352  IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +L+ GLKKFVKWYL+YYG  + S
Sbjct  412  NLDVGLKKFVKWYLSYYGYTRGS  434



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE D+TDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  229  KVPFSESDQTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  288

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +H  +ARDFTYIDD+VKGC+ +LDT+ KSTGSGGKK+G+A  R
Sbjct  289  FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGSAPYR  348

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LE+ LKVKAK+ ++ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  349  IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISLARRELGYKPTT  408

Query  218  DLETGLKKFVKWYLNYYGSKK  156
            DL+TGLKKFVKWYL+YYG  K
Sbjct  409  DLQTGLKKFVKWYLSYYGYGK  429



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
              PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+T LRFFTVYGPWGRPDMAYF 
Sbjct  238  NVPFSENHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  297

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+ +GK I ++ T D+  VARDFTYIDDVVKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  298  FTKDMTQGKPINVYVTQDNKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLR  357

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLV+ LE LL VKAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  358  VYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYKPTT  417

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWYL+YYG + +
Sbjct  418  DLSSGLRKFVKWYLSYYGIQSK  439



>ref|XP_008448903.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=440

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 177/202 (88%), Gaps = 1/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSEKDRTD PASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  230  KIPFSEKDRTDHPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  289

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+ + I I+E  DH +VARDFTYIDD+VKGCL ALDTAKKSTGSGGKK+  AQLR
Sbjct  290  FTRDILKRRPITIYEAPDHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKRKPAQLR  349

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PVPV +LVS LEKLLKVKAKKK+L MPRNGDV FTHANI+LA  E GYKPTT
Sbjct  350  IFNLGNTSPVPVSELVSILEKLLKVKAKKKILPMPRNGDVKFTHANISLAHKEFGYKPTT  409

Query  218  DLETGLKKFVKWYLNYY-GSKK  156
            +L TGL+KFV WY +YY GSKK
Sbjct  410  NLRTGLEKFVNWYQDYYSGSKK  431



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  232  KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   DH  +ARDFTYIDD+VKGCLA+L+TA KSTG+GGKK+G A  R
Sbjct  292  FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LEK L+VKAKK V+ MP NGDVPFTHANI+LAR +LGYKPTT
Sbjct  352  IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYG  165
            +L+ GLKKFVKWYL+YYG
Sbjct  412  NLDVGLKKFVKWYLSYYG  429



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   277 bits (709),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
              PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+T LRFFTVYGPWGRPDMAYF 
Sbjct  242  NVPFSESHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  301

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+++GK I ++ T D   VARDFTYIDD+VKGC+ +LDTA+KSTGSGGKKKG AQLR
Sbjct  302  FTKDMVQGKPINVYVTQDDKEVARDFTYIDDIVKGCIGSLDTAEKSTGSGGKKKGPAQLR  361

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLV+ LE LL VKAKK V+ MPRNGDVPFTHANITLA+ + GYKPTT
Sbjct  362  VYNLGNTSPVSVNKLVTILENLLNVKAKKNVIKMPRNGDVPFTHANITLAKKDFGYKPTT  421

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY++YYG + +
Sbjct  422  DLSSGLRKFVKWYVSYYGIQSK  443



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   277 bits (708),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  232  KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   DH  +ARDFTYIDD+VKGCLA+L+TA KSTG+GGKK+G A  R
Sbjct  292  FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LEK L+VKAKK V+ MP NGDVPFTHANI+LAR +LGYKPTT
Sbjct  352  IFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTT  411

Query  218  DLETGLKKFVKWYLNYYG  165
            +L+ GLKKFVKWYL+YYG
Sbjct  412  NLDVGLKKFVKWYLSYYG  429



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  227  KAPFSEADRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +   +ARDFT+IDD+VKGC+A+LDTA+KSTGSGG+K   AQ R
Sbjct  287  FTRNILQGKPITVYRGKNRVDLARDFTFIDDIVKGCVASLDTAEKSTGSGGRKGSPAQYR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LV  LE+ LKVKAKK V+ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  347  IYNLGNTSPVTVPALVGILERHLKVKAKKNVVEMPGNGDVPFTHANISLARAELGYKPTT  406

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +LETGLKKFV+WYL+YYG   RS
Sbjct  407  NLETGLKKFVRWYLSYYGYSPRS  429



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  232  KVPFSERDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  291

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   DH  +ARDFTYIDD+VKGCL +LDTA KSTG+GGKK+G A  R
Sbjct  292  FTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYR  351

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LEK L+VKAKK V+ MP NGDVPFTHANI+LAR +LGYKP+T
Sbjct  352  IFNLGNTSPVTVPNLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLAREQLGYKPST  411

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +L+ GLKKFVKWYL+YYG  + S
Sbjct  412  NLDVGLKKFVKWYLSYYGYTRGS  434



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGP+GRPDMAYFS
Sbjct  236  KVPFSEMDRTDQPASLYAATKKAGEAIAHSYNHIYGLSITGLRFFTVYGPYGRPDMAYFS  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++  D   +ARDFTYIDD+VKGCL ALDTA  STG+GGKK+G AQLR
Sbjct  296  FTKDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPAQLR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V +LVS LEK LKVKAKK  + MPRNGDVPFTHAN+TLAR EL Y P+T
Sbjct  356  VYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYNPST  415

Query  218  DLETGLKKFVKWYLNYYG  165
            DL TGLKKFVKWY +YYG
Sbjct  416  DLYTGLKKFVKWYESYYG  433



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGE IAH YNHIYGLSITGLRFFTVYGP+GRPDMAYFS
Sbjct  231  KVPFSEVDRTDQPASLYAATKKAGEAIAHSYNHIYGLSITGLRFFTVYGPYGRPDMAYFS  290

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKDIL+GK I I++  D   +ARDFTYIDD+VKGCL ALDTA  STG+GGKK+G AQLR
Sbjct  291  FTKDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPAQLR  350

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V +LVS LEK LKVKAKK  + MPRNGDVPFTHAN+TLAR EL Y P+T
Sbjct  351  VYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYNPST  410

Query  218  DLETGLKKFVKWYLNYYG  165
            DL TGLKKFVKWY +YYG
Sbjct  411  DLYTGLKKFVKWYESYYG  428



>ref|XP_009395225.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=433

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLS TGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSELDRTDRPASLYAATKKAGEEITHTYNHIYGLSTTGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   D   +ARDFTYIDD+VKGC+A+LDTA+KSTGSGG+K+G AQ R
Sbjct  286  FTRNILQGKPITVYRGKDRADLARDFTYIDDIVKGCVASLDTAEKSTGSGGRKRGPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LV+ LE+ LKVKAKKKV+ MP NGDVPFTHANI+LA+ ELGYKPTT
Sbjct  346  IYNLGNTSPVTVPALVNILERHLKVKAKKKVVEMPGNGDVPFTHANISLAQAELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +LE GLKKFVKWYL+YYG K RS
Sbjct  406  NLEIGLKKFVKWYLSYYGYKPRS  428



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE+ RTDQPASLYAATKKAGEEIAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  239  KVPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  298

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+++GK I ++ T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKKKG AQLR
Sbjct  299  FTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLR  358

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLV  LE LL +KAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  359  VYNLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTT  418

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL  GL+KFVKWY++YYG + R
Sbjct  419  DLSIGLRKFVKWYVSYYGIQPR  440



>ref|XP_004296420.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  752  PFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  573
            PFSE DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT
Sbjct  231  PFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFT  290

Query  572  KDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLRIF  393
            ++IL+GK I ++   +H  +ARDFTYIDD+VKGCL +LDT+ KSTGSGGKK+G A  RIF
Sbjct  291  RNILQGKSITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRIF  350

Query  392  NLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTTDL  213
            NLGNT PV V  LV+ LE+ LK+KAK+ V+ MP NGDVPFTHANI+LAR +LGYKPTTDL
Sbjct  351  NLGNTSPVTVPTLVNILERHLKMKAKRNVVEMPGNGDVPFTHANISLARTQLGYKPTTDL  410

Query  212  ETGLKKFVKWYLNYYG  165
            +TGLKKFV+WYL+YYG
Sbjct  411  QTGLKKFVRWYLSYYG  426



>ref|XP_011029969.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Populus euphratica]
Length=410

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 176/205 (86%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD P+SLYAATKKAGE IAH YNHI+GLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  205  KVPFSEIDRTDNPSSLYAATKKAGEAIAHTYNHIHGLSITGLRFFTVYGPWGRPDMAYFF  264

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DIL+GK+I +FE  +  +V+RDFTYIDD+VKGCL ALDTA KSTGSGG KKG AQLR
Sbjct  265  FTRDILKGKQISVFEGLNGFTVSRDFTYIDDIVKGCLGALDTATKSTGSGGIKKGPAQLR  324

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV KLV+ LEKLLKVKA K V  MP NGDV FTHANI+LAR ELGYKPTT
Sbjct  325  VYNLGNTSPVPVSKLVNILEKLLKVKANKVVSPMPANGDVLFTHANISLARRELGYKPTT  384

Query  218  DLETGLKKFVKWYLNYYG-SKKRSA  147
            DL++GLKKFV WYL+YY  S K+S+
Sbjct  385  DLQSGLKKFVAWYLDYYKPSGKKSS  409



>ref|XP_010047039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW78789.1| hypothetical protein EUGRSUZ_C00223 [Eucalyptus grandis]
Length=442

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            ++PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  236  KSPFSESDRTDRPASLYAATKKAGEEITHAYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I I+   +   +ARDFTYIDDVVKGCLA+LDTA+KSTGSGGKK+G AQ R
Sbjct  296  FTRNILQGKPITIYRGKNRVDLARDFTYIDDVVKGCLASLDTARKSTGSGGKKRGPAQYR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PV V ++VS LE  L V+A+++ + MP NGDVPFTHANI+ AR ELGYKPTT
Sbjct  356  VFNLGNTSPVTVPEMVSMLEGHLGVRARRREVEMPGNGDVPFTHANISSARRELGYKPTT  415

Query  218  DLETGLKKFVKWYLNYYG  165
            DL TGLK+FVKWYL+YYG
Sbjct  416  DLRTGLKRFVKWYLSYYG  433



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KAPFSEADRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +H  +ARDFTYIDD+VKGC+A+LDTA+KSTGSGG+K+G AQ R
Sbjct  286  FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVASLDTAQKSTGSGGRKRGPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LV  LE+ LKVKAK+ V+ MP NGDVPFTHANI+ AR ELGY PTT
Sbjct  346  IFNLGNTSPVTVPALVGILERHLKVKAKRHVVEMPGNGDVPFTHANISSARTELGYNPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +LE GLKKFVKWYL+YYG   RS
Sbjct  406  NLEAGLKKFVKWYLSYYGYNPRS  428



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEIAH+YNHIYGLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  256  KVPFSESDRTDRPASLYAATKKAGEEIAHVYNHIYGLSITGLRFFTVYGPWGRPDMAYFF  315

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL GK I IFE   H +VARDFTYIDD+V+GC+AALDTA KSTGSGGKK+G A LR
Sbjct  316  FTRNILSGKPISIFEGPGHATVARDFTYIDDIVRGCVAALDTAGKSTGSGGKKRGPAPLR  375

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV  LVS LEKLL VKA ++V+ MPRNGDV FTHANI+LA+ ELGY P T
Sbjct  376  VYNLGNTSPVPVADLVSILEKLLGVKAIRRVVKMPRNGDVQFTHANISLAQRELGYHPAT  435

Query  218  DLETGLKKFVKWYLNYY  168
            +L TGLK+FV+WYL YY
Sbjct  436  NLRTGLKRFVRWYLQYY  452



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
              PFSE  RTDQPASLYAATKKAGEEIAH YNHIYGLS+T LRFFTVYGPWGRPDMAYF 
Sbjct  238  NVPFSENHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDMAYFF  297

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+ +GK I ++ T D   VARDFTYIDD+VKGCL ALDTA+KSTGSGGKKKG AQLR
Sbjct  298  FTKDMTQGKPINVYVTQDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLR  357

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLV+ LE LL VKAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  358  VYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYKPTT  417

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWYL+YYG + +
Sbjct  418  DLSSGLRKFVKWYLSYYGIQSK  439



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I I+   +   +ARDFTYIDD+VKGCL +LDTA+KSTGSGGKK+  AQ R
Sbjct  286  FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LVS LE+ LKVKAK+ V+ MP NGDVPFTHANI+LAR EL YKPTT
Sbjct  346  IYNLGNTSPVTVPTLVSILERHLKVKAKRNVVEMPGNGDVPFTHANISLARAELRYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            +LETGLKKFVKWYL YYG   R +
Sbjct  406  NLETGLKKFVKWYLRYYGYSPRGS  429



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  238  KVPFSEDHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  297

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+++GK I ++ T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  298  FTKDMIQGKSINVYVTQDDREVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  357

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLV+ LE LL +KAKK V+ MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  358  VYNLGNTSPVSVKKLVAILENLLNLKAKKNVIKMPRNGDVPFTHANVSLALRDFGYKPTT  417

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY++YYG + R
Sbjct  418  DLSSGLRKFVKWYVSYYGIQPR  439



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE  RTDQPASLYAATKKAGE IAH YNHIYGLS+TGLRFFTVYGPWGRPDMAYF 
Sbjct  242  KVPFSEDHRTDQPASLYAATKKAGEAIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFF  301

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTKD+++GK I ++ T D   VARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK+G AQLR
Sbjct  302  FTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLR  361

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PV V KLV+ LE LL +KAKK  + MPRNGDVPFTHAN++LA  + GYKPTT
Sbjct  362  VYNLGNTSPVSVKKLVAILENLLNLKAKKFFIKMPRNGDVPFTHANVSLALRDFGYKPTT  421

Query  218  DLETGLKKFVKWYLNYYGSKKR  153
            DL +GL+KFVKWY++YYG + R
Sbjct  422  DLSSGLRKFVKWYVSYYGIQSR  443



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLS TGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSTTGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   D   +ARDFTYIDD+VKGC+A+LDTA+KSTG+GG+K+G AQ R
Sbjct  286  FTRNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCVASLDTAEKSTGTGGRKRGPAQYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            I+NLGNT PV V  LV  LE  LK+KAK+ V+ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  346  IYNLGNTSPVTVPALVGILEHHLKMKAKRNVVEMPGNGDVPFTHANISLARAELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +LETGLK+FV+WYL YYG   RS
Sbjct  406  NLETGLKRFVRWYLLYYGYNTRS  428



>gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=341

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE D+TD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  136  KVPFSESDQTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  195

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +H  +ARDFTYIDD+VKGC+ +LDT+ KSTGSGGKK+G A  R
Sbjct  196  FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYR  255

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LE+ LKVKAK+ ++ MP NGDVPFTHANI+ AR ELGYKPTT
Sbjct  256  IFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTT  315

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFVKWYL+YYG
Sbjct  316  DLQTGLKKFVKWYLSYYG  333



>ref|XP_002318876.1| hypothetical protein POPTR_0012s14480g [Populus trichocarpa]
 gb|EEE97096.1| hypothetical protein POPTR_0012s14480g [Populus trichocarpa]
Length=405

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 176/205 (86%), Gaps = 1/205 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD P+SLYAATKKAGE IAH YNHI+GLSITGLRFFTVYGPWGRPDMAYF 
Sbjct  200  KVPFSEIDRTDNPSSLYAATKKAGEAIAHTYNHIHGLSITGLRFFTVYGPWGRPDMAYFF  259

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+D+L+GK+I +FE  +  +V+RDFTYIDD+VKGCL ALDTA KSTGSGG KKG AQLR
Sbjct  260  FTRDMLKGKQISVFEGLNGFTVSRDFTYIDDIVKGCLGALDTATKSTGSGGVKKGPAQLR  319

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            ++NLGNT PVPV KLV+ LEKLLKVKA K V  MP NGDV FTHANI+LAR ELGYKPTT
Sbjct  320  VYNLGNTSPVPVSKLVNILEKLLKVKANKVVSPMPANGDVLFTHANISLARRELGYKPTT  379

Query  218  DLETGLKKFVKWYLNYYG-SKKRSA  147
            DL++GLKKFV WYL+YY  S K+S+
Sbjct  380  DLQSGLKKFVAWYLDYYKPSGKKSS  404



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  227  KAPFSESDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FTK+IL+GK I I+   +   +ARDFTYIDD+VKGC+A+LDTAK+STGSGGKK+G AQ R
Sbjct  287  FTKNILQGKPITIYRGKNRVELARDFTYIDDIVKGCVASLDTAKRSTGSGGKKRGPAQFR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  +V  LEK LK KA K V+ MP NGDVPFTHANI+ AR ELGYKPTT
Sbjct  347  IFNLGNTSPVTVPMMVGILEKQLKTKAHKNVVEMPGNGDVPFTHANISSARIELGYKPTT  406

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFV+WYL+YYG
Sbjct  407  DLQTGLKKFVRWYLSYYG  424



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
              PFSE DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  227  NVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  286

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I I+   +   +ARDFTYIDD+VKGCL +LDT+ KSTGSGGKK+GAA  R
Sbjct  287  FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGAAPYR  346

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LV+ LE+ L+ KAKK V+ MP NGDVPFTHANI+LAR ELGYKPTT
Sbjct  347  IFNLGNTSPVTVPTLVNILERHLRTKAKKNVVDMPGNGDVPFTHANISLARRELGYKPTT  406

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFV+WYL+YYG
Sbjct  407  DLQTGLKKFVRWYLSYYG  424



>ref|XP_001761086.1| predicted protein [Physcomitrella patens]
 gb|EDQ74153.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEIAH YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  237  KVPFSESDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  296

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT+DILRGK I I+  +    +ARDFTYIDD+VKGC+ ALDTA+KSTGSGGKK G AQLR
Sbjct  297  FTRDILRGKAINIYTGNGGKDLARDFTYIDDIVKGCVGALDTAEKSTGSGGKKTGPAQLR  356

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            +FNLGNT PV V  LV  LEK LK KAK+ ++ MPRNGDVPFTHANI+ A+ +  Y PTT
Sbjct  357  VFNLGNTSPVTVPTLVDILEKYLKQKAKRNIIKMPRNGDVPFTHANISYAQSQFNYHPTT  416

Query  218  DLETGLKKFVKWYLNYYG  165
            +L+TGLKKFVKWYL+YYG
Sbjct  417  NLDTGLKKFVKWYLSYYG  434



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  236  KVPFSEADRTDQPASLYAATKKAGEEITHSYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  295

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   +H  +ARDFTYIDD+VKGCL +LDTA +STG+GGKK+G A  R
Sbjct  296  FTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPAPYR  355

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LEK L+VKAKK V+ MP NGDVPFTHANI+LAR +LGYKPTT
Sbjct  356  IFNLGNTSPVTVPTLVSILEKHLRVKAKKHVIEMPGNGDVPFTHANISLARQQLGYKPTT  415

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            +L+ GLKKFVKWYL+YYG  + S
Sbjct  416  NLDAGLKKFVKWYLSYYGYTRGS  438



>dbj|BAH20281.1| AT4G30440 [Arabidopsis thaliana]
Length=257

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEI H YNHIYGL+ITGLRFFTVYGPWGRPDMAYFS
Sbjct  51   KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRPDMAYFS  110

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I I+   +   +ARDFTYIDD+VKGCL +LD++ KSTGSGGKK+GAA  R
Sbjct  111  FTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGAAPYR  170

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LV  LEK LKVKAK+  + MP NGDVPFTHANI+ AR E GYKPTT
Sbjct  171  IFNLGNTSPVTVPILVDILEKHLKVKAKRNFVEMPGNGDVPFTHANISSARNEFGYKPTT  230

Query  218  DLETGLKKFVKWYLNYYGSKKRS  150
            DLETGLKKFV+WYL+YYG   ++
Sbjct  231  DLETGLKKFVRWYLSYYGYNTKA  253



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTD+PASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSELDRTDRPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I ++   DH  +ARDFTYIDD+VKGC+A+LDT+ KSTGSGGKKKG A  R
Sbjct  286  FTRNILQGKRITVYRGKDHTDLARDFTYIDDIVKGCVASLDTSGKSTGSGGKKKGPAPYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LV  LEK LKVKAK+ V+ MP NGDVPFTHANI+LA+ ELGYKPTT
Sbjct  346  IFNLGNTSPVTVPDLVGILEKHLKVKAKRNVVEMPGNGDVPFTHANISLAQKELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYGSKKRSA  147
            DL+TGLKKFVKWY +YYG  +  A
Sbjct  406  DLQTGLKKFVKWYQSYYGYHRGKA  429



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  758  QTPFSEKDRTDQPASLYAATKKAGEEIAHIYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  579
            + PFSE DRTDQPASLYAATKKAGEEI H YNHIYGLSITGLRFFTVYGPWGRPDMAYFS
Sbjct  226  KVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFS  285

Query  578  FTKDILRGKEIKIFETSDHHSVARDFTYIDDVVKGCLAALDtakkstgsggkkkgaAQLR  399
            FT++IL+GK I +F   +   +ARDFTYIDD+VKGCL +LDT+ KSTGSGGKK GAA  R
Sbjct  286  FTRNILQGKPITVFRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKTGAAPYR  345

Query  398  IFNLGNTKPVPVGKLVSTLEkllkvkakkkvlVMPRNGDVPFTHANITLARGELGYKPTT  219
            IFNLGNT PV V  LVS LE+ LKVKAKK V+ MP NGDVPFTHANI+ AR ELGYKPTT
Sbjct  346  IFNLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPGNGDVPFTHANISSARRELGYKPTT  405

Query  218  DLETGLKKFVKWYLNYYG  165
            DL+TGLKKFV+WYL+YYG
Sbjct  406  DLQTGLKKFVRWYLSYYG  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470