BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF023A05

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               275   8e-86   Nicotiana tomentosiformis
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               275   2e-85   Nicotiana sylvestris
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               263   7e-81   Nicotiana tomentosiformis
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               262   7e-81   Sesamum indicum [beniseed]
ref|XP_002313809.1|  putative sorbitol transporter family protein       258   4e-79   Populus trichocarpa [western balsam poplar]
ref|XP_002519083.1|  sugar transporter, putative                        258   7e-79   Ricinus communis
gb|KDP46229.1|  hypothetical protein JCGZ_10069                         257   8e-79   Jatropha curcas
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               257   1e-78   Sesamum indicum [beniseed]
ref|XP_010096202.1|  Polyol transporter 5                               256   4e-78   Morus notabilis
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               254   4e-78   Solanum tuberosum [potatoes]
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               255   6e-78   Nicotiana sylvestris
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               254   7e-78   Populus euphratica
gb|EYU42629.1|  hypothetical protein MIMGU_mgv1a0059092mg               245   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    252   7e-77   Populus euphratica
emb|CDO97075.1|  unnamed protein product                                250   4e-76   Coffea canephora [robusta coffee]
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               251   4e-76   Solanum tuberosum [potatoes]
gb|AFI61955.1|  polyol transporter                                      249   7e-76   Camellia sinensis [black tea]
gb|ABK29439.1|  sugar transport protein                                 249   1e-75   Coffea canephora [robusta coffee]
gb|ACB56939.1|  mannitol transporter                                    248   3e-75   Artemisia annua [sweet Annie]
gb|KHG20989.1|  Polyol transporter 5 -like protein                      248   4e-75   Gossypium arboreum [tree cotton]
gb|KJB32189.1|  hypothetical protein B456_005G228500                    248   4e-75   Gossypium raimondii
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                247   8e-75   
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               246   2e-74   Fragaria vesca subsp. vesca
gb|AAZ80876.1|  putative sorbitol transporter                           239   4e-74   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_008368693.1|  PREDICTED: polyol transporter 5-like               240   4e-74   
ref|NP_001280902.1|  putative polyol transporter 1                      244   7e-74   Malus domestica [apple tree]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               243   1e-73   
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           243   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           243   2e-73   
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               243   2e-73   Malus domestica [apple tree]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           243   2e-73   
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             243   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           242   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               242   8e-73   Citrus sinensis [apfelsine]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           241   8e-73   Pyrus x bretschneideri [bai li]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             241   9e-73   Citrus clementina [clementine]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           241   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_009785575.1|  PREDICTED: polyol transporter 5-like isoform X2    236   1e-72   Nicotiana sylvestris
gb|KEH30427.1|  polyol/monosaccharide transporter 1                     235   1e-72   Medicago truncatula
gb|AAM44082.1|  putative sorbitol transporter                           241   2e-72   Prunus cerasus [pie cherry]
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    241   2e-72   Vitis vinifera
gb|AGY96955.1|  polyol transporter 1                                    240   2e-72   Vitis vinifera
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           240   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_008246181.1|  PREDICTED: polyol transporter 5-like               235   2e-72   Prunus mume [ume]
ref|NP_001281038.1|  polyol transporter 5-like                          239   3e-72   Malus domestica [apple tree]
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           240   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               239   4e-72   
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           239   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           239   4e-72   Pyrus x bretschneideri [bai li]
ref|NP_001289249.1|  polyol transporter 5-like                          239   5e-72   Pyrus x bretschneideri [bai li]
gb|KDP46230.1|  hypothetical protein JCGZ_10070                         239   7e-72   Jatropha curcas
gb|ACB86853.1|  mannitol transporter                                    239   1e-71   Citrus sinensis [apfelsine]
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           239   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             239   1e-71   Citrus clementina [clementine]
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               238   2e-71   Cicer arietinum [garbanzo]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           237   3e-71   
gb|EPS69995.1|  sugar transport protein                                 237   4e-71   Genlisea aurea
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           237   5e-71   
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           236   6e-71   
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     235   6e-71   Medicago truncatula
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           236   7e-71   Pyrus x bretschneideri [bai li]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           236   8e-71   Prunus mume [ume]
ref|XP_009785574.1|  PREDICTED: polyol transporter 5-like isoform X1    231   8e-71   Nicotiana sylvestris
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           236   9e-71   Pyrus x bretschneideri [bai li]
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    236   1e-70   
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               236   1e-70   Fragaria vesca subsp. vesca
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     235   2e-70   Medicago truncatula
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           235   2e-70   Prunus mume [ume]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           235   2e-70   Prunus mume [ume]
ref|XP_008466959.1|  PREDICTED: polyol transporter 5-like               227   4e-70   Cucumis melo [Oriental melon]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               234   5e-70   Nicotiana tomentosiformis
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               234   8e-70   Eucalyptus grandis [rose gum]
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               234   1e-69   Eucalyptus grandis [rose gum]
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               233   2e-69   Citrus sinensis [apfelsine]
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             233   2e-69   Prunus persica
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             233   2e-69   
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             233   2e-69   Prunus persica
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               232   2e-69   Prunus mume [ume]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           232   3e-69   Pyrus x bretschneideri [bai li]
gb|AAY88181.2|  mannitol transporter 1                                  231   3e-69   Olea europaea
gb|AAO39267.1|AF482011_1  sorbitol transporter                          231   4e-69   Prunus cerasus [pie cherry]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                231   4e-69   Erythranthe guttata [common monkey flower]
gb|AAL85876.2|AF480069_1  mannitol transporter                          231   5e-69   Apium graveolens Dulce Group [celery]
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               231   5e-69   Prunus mume [ume]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           232   5e-69   Pyrus x bretschneideri [bai li]
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               231   6e-69   Prunus mume [ume]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             231   7e-69   Prunus persica
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             231   7e-69   
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               231   8e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             231   1e-68   Prunus persica
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           231   2e-68   Malus domestica [apple tree]
gb|AIU41385.1|  sorbitol transporter 1                                  230   2e-68   Prunus salicina [Japanese plum]
gb|KHN25361.1|  Polyol transporter 5                                    229   3e-68   Glycine soja [wild soybean]
ref|NP_001287655.1|  polyol transporter 5-like                          230   3e-68   Solanum lycopersicum
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               229   3e-68   
ref|NP_001281033.1|  polyol transporter 5-like                          229   4e-68   Malus domestica [apple tree]
gb|ACD68477.1|  plasma membrane mannitol transporter                    227   4e-68   Arachis hypogaea [goober]
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      229   8e-68   
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    228   1e-67   Sesamum indicum [beniseed]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               228   1e-67   Sesamum indicum [beniseed]
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    228   1e-67   Sesamum indicum [beniseed]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    227   2e-67   
emb|CAP58707.1|  putative polyol transported protein 2                  227   3e-67   Hevea brasiliensis [jebe]
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               227   5e-67   Prunus mume [ume]
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             226   6e-67   
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               224   1e-66   Eucalyptus grandis [rose gum]
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               224   1e-66   Pyrus x bretschneideri [bai li]
gb|AAL38359.1|  sugar transporter protein                               217   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               225   2e-66   Solanum tuberosum [potatoes]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               224   2e-66   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    224   2e-66   Pyrus pyrifolia [sha li]
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               224   2e-66   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    225   2e-66   Pyrus pyrifolia [sha li]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           225   2e-66   Pyrus x bretschneideri [bai li]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     224   2e-66   Eucalyptus grandis [rose gum]
gb|AAO88964.1|  sorbitol transporter                                    223   5e-66   Malus domestica [apple tree]
emb|CAP58706.1|  putative polyol transporter protein 1                  223   7e-66   Hevea brasiliensis [jebe]
gb|KJB12318.1|  hypothetical protein B456_002G011700                    223   8e-66   Gossypium raimondii
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           223   1e-65   Elaeis guineensis
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                222   1e-65   Erythranthe guttata [common monkey flower]
ref|NP_001281036.1|  polyol transporter 5-like                          221   2e-65   Malus domestica [apple tree]
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               222   2e-65   Cicer arietinum [garbanzo]
gb|AAT06053.2|  sorbitol transporter                                    222   3e-65   Malus domestica [apple tree]
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             221   4e-65   Phaseolus vulgaris [French bean]
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               221   7e-65   Cucumis sativus [cucumbers]
emb|CDX95491.1|  BnaC01g33830D                                          221   8e-65   
gb|KHN39768.1|  Polyol transporter 5                                    220   8e-65   Glycine soja [wild soybean]
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           221   9e-65   Pyrus x bretschneideri [bai li]
ref|XP_003603886.1|  Mannitol transporter                               220   1e-64   Medicago truncatula
ref|NP_001236592.1|  sorbitol-like transporter                          220   1e-64   
gb|KJB12316.1|  hypothetical protein B456_002G011500                    220   1e-64   Gossypium raimondii
gb|KJB12315.1|  hypothetical protein B456_002G011400                    220   1e-64   Gossypium raimondii
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           220   2e-64   Malus domestica [apple tree]
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           219   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             219   2e-64   Phaseolus vulgaris [French bean]
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    219   3e-64   
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    219   3e-64   Brassica rapa
ref|XP_002885281.1|  ATPLT5                                             218   8e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               218   8e-64   Solanum tuberosum [potatoes]
gb|KJB12317.1|  hypothetical protein B456_002G011600                    217   1e-63   Gossypium raimondii
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    218   1e-63   Camelina sativa [gold-of-pleasure]
ref|NP_188513.1|  polyol transporter 5                                  218   1e-63   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM66295.1|  sorbitol transporter                                   214   4e-63   Pyrus pyrifolia [sha li]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               216   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_003607077.1|  Sorbitol-like transporter                          216   5e-63   Medicago truncatula
dbj|BAM66296.1|  sorbitol transporter                                   214   5e-63   Pyrus pyrifolia [sha li]
ref|XP_008812826.1|  PREDICTED: polyol transporter 5-like               209   5e-63   Phoenix dactylifera
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               216   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    215   6e-63   
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    216   7e-63   Setaria italica
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               215   8e-63   Tarenaya hassleriana [spider flower]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    215   1e-62   Brassica rapa
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          215   1e-62   Sorghum bicolor [broomcorn]
gb|AAN07021.1|  putative mannitol transporter                           214   2e-62   Phelipanche ramosa
emb|CDY61985.1|  BnaC03g73840D                                          214   2e-62   Brassica napus [oilseed rape]
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         214   2e-62   
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           214   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         214   3e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          213   3e-62   Oryza sativa Indica Group [Indian rice]
dbj|BAC83310.1|  putative sorbitol transporter                          213   3e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    213   3e-62   Cucumis melo [Oriental melon]
ref|XP_004148312.1|  PREDICTED: polyol transporter 5-like               212   5e-62   
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              213   7e-62   
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               212   8e-62   Oryza brachyantha
ref|NP_001060108.1|  Os07g0582400                                       213   1e-61   
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             212   1e-61   Phaseolus vulgaris [French bean]
emb|CDP10064.1|  unnamed protein product                                212   1e-61   Coffea canephora [robusta coffee]
gb|AAG43998.1|AF215837_1  mannitol transporter                          212   1e-61   Apium graveolens Dulce Group [celery]
gb|KGN44323.1|  Sugar transporter                                       212   2e-61   Cucumis sativus [cucumbers]
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    212   2e-61   
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    212   2e-61   Arabis alpina [alpine rockcress]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               211   2e-61   Brachypodium distachyon [annual false brome]
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          211   3e-61   Sorghum bicolor [broomcorn]
emb|CAD58709.1|  polyol transporter                                     211   4e-61   Plantago major [cart-track plant]
gb|ABX71752.1|  mannitol transporter                                    211   4e-61   Apium graveolens
ref|NP_001045505.2|  Os01g0966900                                       209   8e-61   
emb|CAJ29291.1|  putative polyol transporter protein 4                  209   1e-60   Lotus japonicus
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               209   1e-60   Glycine max [soybeans]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             209   1e-60   Eutrema salsugineum [saltwater cress]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               209   1e-60   Zea mays [maize]
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               208   4e-60   Setaria italica
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               206   1e-59   
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               207   2e-59   Phoenix dactylifera
ref|NP_001049270.1|  Os03g0197200                                       200   2e-59   
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               206   3e-59   Phoenix dactylifera
dbj|BAJ85302.1|  predicted protein                                      206   5e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               205   5e-59   Phoenix dactylifera
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             204   1e-58   Capsella rubella
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           203   1e-58   
gb|EMT15230.1|  Polyol transporter 5                                    204   1e-58   
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           204   2e-58   Phoenix dactylifera
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               204   2e-58   
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    204   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           199   2e-58   
gb|AEX55225.1|  sugar transporter                                       202   6e-58   Allium sativum
ref|NP_001168177.1|  uncharacterized protein LOC100381931               201   1e-57   Zea mays [maize]
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             201   1e-57   Phaseolus vulgaris [French bean]
ref|NP_001141158.1|  hypothetical protein                               200   2e-57   Zea mays [maize]
emb|CAR82417.1|  polyol transporter                                     197   2e-57   Plantago major [cart-track plant]
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          201   2e-57   Sorghum bicolor [broomcorn]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    201   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             201   2e-57   Phaseolus vulgaris [French bean]
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               201   2e-57   Cucumis melo [Oriental melon]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    201   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         200   3e-57   Zea mays [maize]
gb|EAY88906.1|  hypothetical protein OsI_10385                          200   4e-57   Oryza sativa Indica Group [Indian rice]
gb|EMS55536.1|  Polyol transporter 5                                    200   4e-57   Triticum urartu
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    200   4e-57   Tarenaya hassleriana [spider flower]
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               199   4e-57   
gb|EEE58504.1|  hypothetical protein OsJ_09775                          200   5e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           201   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           199   7e-57   Phoenix dactylifera
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       199   8e-57   Cucumis sativus [cucumbers]
gb|ABF94465.1|  Sugar transporter family protein, expressed             200   8e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               199   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN41994.1|  Putative polyol transporter 6                           197   2e-56   Glycine soja [wild soybean]
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    197   2e-56   Phoenix dactylifera
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      197   2e-56   Glycine max [soybeans]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    197   2e-56   
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    198   2e-56   Phoenix dactylifera
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               197   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    198   3e-56   Setaria italica
gb|KGN44326.1|  Mannitol transporter                                    197   4e-56   Cucumis sativus [cucumbers]
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          197   5e-56   Sorghum bicolor [broomcorn]
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               197   5e-56   Eucalyptus grandis [rose gum]
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               197   6e-56   Glycine max [soybeans]
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               197   6e-56   Cucumis melo [Oriental melon]
emb|CAD58710.1|  polyol transporter                                     197   7e-56   Plantago major [cart-track plant]
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           196   1e-55   
ref|XP_010908358.1|  PREDICTED: probable polyol transporter 6           196   1e-55   
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           196   1e-55   
gb|ACN26310.1|  unknown                                                 195   2e-55   Zea mays [maize]
ref|NP_001132062.1|  proton myo-inositol cotransporter                  195   2e-55   Zea mays [maize]
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           195   2e-55   
gb|ACG35144.1|  proton myo-inositol cotransporter                       195   2e-55   Zea mays [maize]
gb|KHN25431.1|  Polyol transporter 5                                    195   2e-55   Glycine soja [wild soybean]
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           195   3e-55   Brassica rapa
ref|NP_001147446.1|  sorbitol transporter                               195   4e-55   Zea mays [maize]
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               194   4e-55   Nelumbo nucifera [Indian lotus]
emb|CDY24775.1|  BnaA08g15350D                                          194   4e-55   Brassica napus [oilseed rape]
ref|XP_010095276.1|  putative polyol transporter 6                      194   5e-55   Morus notabilis
emb|CDY35469.1|  BnaC03g61910D                                          194   5e-55   Brassica napus [oilseed rape]
emb|CDX75588.1|  BnaA01g01140D                                          194   5e-55   
ref|XP_007156029.1|  hypothetical protein PHAVU_003G252500g             193   1e-54   Phaseolus vulgaris [French bean]
emb|CDY67098.1|  BnaCnng53530D                                          192   2e-54   Brassica napus [oilseed rape]
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             192   2e-54   Capsella rubella
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             192   2e-54   Eutrema salsugineum [saltwater cress]
dbj|BAK00091.1|  predicted protein                                      192   3e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP18000.1|  unnamed protein product                                192   4e-54   Coffea canephora [robusta coffee]
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    192   4e-54   Brassica rapa
ref|XP_009138439.1|  PREDICTED: probable polyol transporter 6           192   4e-54   Brassica rapa
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          191   8e-54   Sorghum bicolor [broomcorn]
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      191   9e-54   Cicer arietinum [garbanzo]
emb|CDP02097.1|  unnamed protein product                                191   1e-53   Coffea canephora [robusta coffee]
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    190   2e-53   Cucumis melo [Oriental melon]
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           190   2e-53   Camelina sativa [gold-of-pleasure]
emb|CDY70259.1|  BnaCnng67460D                                          183   2e-53   Brassica napus [oilseed rape]
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               189   3e-53   Setaria italica
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    190   4e-53   Cucumis melo [Oriental melon]
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       188   4e-53   Cucumis sativus [cucumbers]
gb|KHN41995.1|  Putative polyol transporter 3                           188   4e-53   Glycine soja [wild soybean]
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           189   6e-53   Camelina sativa [gold-of-pleasure]
emb|CDX72594.1|  BnaC07g46160D                                          191   7e-53   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      188   8e-53   Glycine max [soybeans]
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like               189   8e-53   
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               188   9e-53   Oryza brachyantha
ref|NP_001182999.1|  uncharacterized protein LOC100501319               186   1e-52   Zea mays [maize]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             187   1e-52   
ref|XP_007046983.1|  Major facilitator superfamily protein              188   1e-52   
gb|AFK38433.1|  unknown                                                 179   2e-52   Lotus japonicus
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840          187   2e-52   Amborella trichopoda
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             187   2e-52   
emb|CDY72601.1|  BnaAnng41630D                                          185   2e-52   Brassica napus [oilseed rape]
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             187   3e-52   Phaseolus vulgaris [French bean]
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           189   3e-52   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           187   3e-52   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              186   4e-52   
ref|XP_002884156.1|  predicted protein                                  187   4e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           186   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_010530516.1|  PREDICTED: putative polyol transporter 1           182   5e-52   
gb|KHN44499.1|  Putative polyol transporter 3                           185   5e-52   
ref|NP_195385.1|  putative polyol transporter 6                         186   5e-52   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    186   5e-52   
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      186   9e-52   
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      185   1e-51   
gb|EMS66679.1|  Putative polyol transporter 2                           184   1e-51   
gb|KHN00554.1|  Putative polyol transporter 3                           185   1e-51   
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             185   1e-51   
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           185   1e-51   
emb|CDY46218.1|  BnaA07g03520D                                          185   2e-51   
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           185   2e-51   
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           185   2e-51   
dbj|BAJ98962.1|  predicted protein                                      179   2e-51   
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    183   3e-51   
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             184   3e-51   
emb|CDP17996.1|  unnamed protein product                                184   4e-51   
gb|EMT00465.1|  Putative polyol transporter 1                           184   5e-51   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           184   5e-51   
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           184   6e-51   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           183   6e-51   
emb|CDY46217.1|  BnaA07g03530D                                          183   8e-51   
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           183   9e-51   
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             183   9e-51   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           183   9e-51   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    182   9e-51   
ref|XP_008447048.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    183   1e-50   
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    182   1e-50   
ref|XP_010527602.1|  PREDICTED: polyol transporter 5-like               173   1e-50   
gb|EMS61414.1|  Polyol transporter 5                                    180   1e-50   
emb|CDP17999.1|  unnamed protein product                                182   1e-50   
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           182   1e-50   
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           182   1e-50   
ref|XP_006856085.1|  hypothetical protein AMTR_s00059p00123280          182   2e-50   
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           182   2e-50   
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               182   3e-50   
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   182   3e-50   
dbj|BAJ86116.1|  predicted protein                                      182   3e-50   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    182   3e-50   
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   181   4e-50   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               181   5e-50   
gb|KDP27565.1|  hypothetical protein JCGZ_20028                         181   6e-50   
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           181   6e-50   
ref|XP_004163631.1|  PREDICTED: polyol transporter 5-like               181   6e-50   
gb|EEC66802.1|  hypothetical protein OsI_33208                          180   7e-50   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           180   8e-50   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  180   9e-50   
emb|CBI17542.3|  unnamed protein product                                178   1e-49   
dbj|BAK07233.1|  predicted protein                                      180   1e-49   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           180   1e-49   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               180   1e-49   
ref|NP_001064429.1|  Os10g0360100                                       180   1e-49   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           179   1e-49   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          179   2e-49   
dbj|BAJ93158.1|  predicted protein                                      180   2e-49   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           179   2e-49   
ref|XP_004166834.1|  PREDICTED: polyol transporter 5-like               179   2e-49   
gb|EAZ04481.1|  hypothetical protein OsI_26630                          179   2e-49   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   180   2e-49   
ref|XP_004148313.1|  PREDICTED: polyol transporter 5-like               179   3e-49   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               179   3e-49   
dbj|BAJ93015.1|  predicted protein                                      179   4e-49   
ref|NP_001060109.2|  Os07g0582500                                       178   4e-49   
dbj|BAC83311.1|  putative sorbitol transporter                          178   4e-49   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    178   6e-49   
emb|CAJ29288.1|  putative polyol transporter 1                          178   6e-49   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             178   7e-49   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  177   9e-49   
gb|AFK37582.1|  unknown                                                 177   9e-49   
gb|ACJ85829.1|  unknown                                                 177   1e-48   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           176   2e-48   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           175   6e-48   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             175   6e-48   
gb|ACF85526.1|  unknown                                                 166   9e-48   
ref|XP_006827104.1|  hypothetical protein AMTR_s00010p00243760          174   1e-47   
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           174   2e-47   
ref|XP_008447302.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    174   2e-47   
ref|XP_009411236.1|  PREDICTED: probable polyol transporter 6           173   2e-47   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    173   2e-47   
gb|KGN48817.1|  hypothetical protein Csa_6G502060                       174   2e-47   
ref|XP_007156922.1|  hypothetical protein PHAVU_002G028500g             173   3e-47   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           173   4e-47   
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          173   5e-47   
gb|EMS52712.1|  Putative polyol transporter 2                           173   5e-47   
ref|XP_002310213.2|  mannitol transporter family protein                172   6e-47   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           172   6e-47   
gb|ACF83985.1|  unknown                                                 172   7e-47   
ref|XP_002531429.1|  sugar transporter, putative                        172   8e-47   
ref|XP_006827103.1|  hypothetical protein AMTR_s00010p00243630          171   1e-46   
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           172   1e-46   
gb|EAY77363.1|  hypothetical protein OsI_05348                          171   1e-46   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           172   1e-46   
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      172   1e-46   
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    172   1e-46   
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             172   1e-46   
ref|XP_002886176.1|  predicted protein                                  171   2e-46   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             171   3e-46   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           171   3e-46   
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      171   3e-46   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           169   9e-46   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               169   1e-45   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           169   1e-45   
ref|XP_010067985.1|  PREDICTED: polyol transporter 5-like               160   1e-45   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           169   2e-45   
emb|CDP02044.1|  unnamed protein product                                168   3e-45   
emb|CDY66868.1|  BnaUnng01720D                                          168   3e-45   
ref|NP_179438.1|  putative polyol transporter 3                         168   3e-45   
gb|AEI98623.1|  hypothetical protein 111O18.10                          168   4e-45   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           167   4e-45   
gb|KDP33672.1|  hypothetical protein JCGZ_07243                         167   4e-45   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     166   8e-45   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           166   1e-44   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             166   1e-44   
ref|XP_011078372.1|  PREDICTED: polyol transporter 5-like               166   1e-44   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             166   2e-44   
gb|ACN35873.1|  unknown                                                 164   3e-44   
ref|XP_004159155.1|  PREDICTED: polyol transporter 5-like               164   4e-44   
gb|ACL53204.1|  unknown                                                 162   1e-43   
ref|XP_002514303.1|  sugar transporter, putative                        164   1e-43   
ref|XP_004148302.1|  PREDICTED: polyol transporter 5-like               164   1e-43   
ref|XP_007046981.1|  Polyol/monosaccharide transporter 5-like pro...    163   1e-43   
ref|XP_004980363.1|  PREDICTED: polyol transporter 5-like               164   1e-43   
ref|XP_007013176.1|  Polyol/monosaccharide transporter 5 isoform 3      161   1e-43   
ref|XP_002308474.2|  hypothetical protein POPTR_0006s16130g             163   2e-43   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             163   2e-43   
gb|KHN41999.1|  Putative polyol transporter 6                           162   3e-43   
gb|EMT15229.1|  Putative polyol transporter 1                           159   3e-43   
gb|KHN41996.1|  Putative polyol transporter 6                           162   4e-43   
gb|KCW58603.1|  hypothetical protein EUGRSUZ_H01262                     161   4e-43   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    166   4e-43   
ref|NP_001150711.1|  LOC100284344                                       162   4e-43   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               162   4e-43   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             162   5e-43   
ref|XP_010497333.1|  PREDICTED: putative polyol transporter 1           158   5e-43   
ref|XP_003538847.1|  PREDICTED: probable polyol transporter 3-like      162   6e-43   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      162   7e-43   
ref|NP_001289849.1|  probable polyol transporter 6                      162   7e-43   
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    161   7e-43   
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    161   8e-43   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           161   8e-43   
ref|XP_003538845.1|  PREDICTED: probable polyol transporter 3-like      161   9e-43   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    162   9e-43   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    161   1e-42   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               161   1e-42   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               160   1e-42   
ref|NP_001049269.1|  Os03g0197100                                       161   1e-42   
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                160   2e-42   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               160   2e-42   
ref|XP_006833286.1|  hypothetical protein AMTR_s00109p00027810          159   3e-42   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               159   3e-42   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    160   3e-42   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               159   4e-42   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           159   6e-42   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     159   8e-42   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           158   1e-41   
ref|XP_007013178.1|  Polyol/monosaccharide transporter 5 isoform 2      155   1e-41   
gb|ACG47895.1|  polyol transporter protein 4                            158   1e-41   
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      158   2e-41   
ref|NP_001142160.1|  hypothetical protein                               158   2e-41   
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               158   2e-41   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           157   2e-41   
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         157   2e-41   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   158   2e-41   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               158   2e-41   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             158   2e-41   
dbj|BAJ86526.1|  predicted protein                                      157   2e-41   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    157   3e-41   
gb|KDP33673.1|  hypothetical protein JCGZ_07244                         157   3e-41   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           157   3e-41   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               157   3e-41   
ref|XP_010041832.1|  PREDICTED: polyol transporter 5-like               157   4e-41   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      157   4e-41   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      157   4e-41   
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          157   4e-41   
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               157   5e-41   
ref|XP_010244297.1|  PREDICTED: putative polyol transporter 1           156   6e-41   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like      156   6e-41   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               156   7e-41   
ref|XP_002514302.1|  sugar transporter, putative                        156   8e-41   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      156   8e-41   
gb|KHN41998.1|  Putative polyol transporter 6                           155   1e-40   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    155   1e-40   
ref|XP_010051593.1|  PREDICTED: polyol transporter 5-like               154   2e-40   
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           155   2e-40   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            155   3e-40   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           154   3e-40   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               154   3e-40   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      154   4e-40   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           154   5e-40   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    154   5e-40   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                153   5e-40   
emb|CDP03333.1|  unnamed protein product                                153   6e-40   
ref|XP_010049693.1|  PREDICTED: probable polyol transporter 6           154   7e-40   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               153   9e-40   
gb|KHN14857.1|  Polyol transporter 5                                    143   2e-39   
gb|EPS67834.1|  hypothetical protein M569_06938                         152   2e-39   
ref|XP_010099586.1|  Polyol transporter 5                               152   3e-39   
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           151   5e-39   
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           151   5e-39   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               151   5e-39   
emb|CAJ29290.2|  putative polyol transporter protein 3                  150   6e-39   
ref|XP_009396729.1|  PREDICTED: probable polyol transporter 6           150   6e-39   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               150   6e-39   
ref|XP_010068000.1|  PREDICTED: polyol transporter 5-like               151   7e-39   
gb|AFK46229.1|  unknown                                                 150   7e-39   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    150   8e-39   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               150   2e-38   
ref|XP_010237226.1|  PREDICTED: putative polyol transporter 1           149   2e-38   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      149   2e-38   
gb|EMS55537.1|  Putative polyol transporter 1                           147   2e-38   
ref|XP_003618299.1|  Mannitol transporter                               149   3e-38   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               148   4e-38   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      148   4e-38   
gb|EAY83298.1|  hypothetical protein OsI_38507                          148   4e-38   
gb|EMT29310.1|  Putative polyol transporter 6                           142   5e-38   
ref|NP_001066878.1|  Os12g0514000                                       148   5e-38   
ref|XP_009398416.1|  PREDICTED: probable polyol transporter 4           148   5e-38   
ref|XP_004503439.1|  PREDICTED: polyol transporter 5-like               148   5e-38   
ref|XP_006664062.1|  PREDICTED: polyol transporter 5-like               147   7e-38   
gb|KDP24153.1|  hypothetical protein JCGZ_25810                         148   7e-38   
ref|XP_004243120.1|  PREDICTED: polyol transporter 5-like               147   9e-38   



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  L + LTVIDHS   V WA+A+ I M LAYVA
Sbjct  342  LVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDGTVFWAIALCITMVLAYVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRATGCSL   +NRVTSGVVSMTF+SL KAI+IGG+FF 
Sbjct  402  LFSIGAGPITWVYSSEIFPLRLRATGCSLAVALNRVTSGVVSMTFLSLEKAITIGGAFFF  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTL  124
            YA +A + WVFFFTLMPETQGKTLEETE LFGTFF+WR   RE+ AK+ NNN+Q+QM T+
Sbjct  462  YAGLAGLAWVFFFTLMPETQGKTLEETEELFGTFFKWRLTLRELKAKEKNNNAQIQMATV  521

Query  123  QA  118
             A
Sbjct  522  PA  523



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  L + LTVIDHS   V WA+A+ I M L YVA
Sbjct  342  LVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDGTVFWAIALCITMVLVYVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRATGC L   +NRVTSGVVSMTF+SL KAI+IGG+FFL
Sbjct  402  LFSIGAGPITWVYSSEIFPLRLRATGCGLAVALNRVTSGVVSMTFLSLEKAITIGGAFFL  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTL  124
            YA +A + WVFFFTLMPETQGKTLEETE LFG FF+WRS  RE+ AK+ NNN+Q+QM T+
Sbjct  462  YAGLAGLAWVFFFTLMPETQGKTLEETEELFGNFFKWRSTLRELQAKEENNNAQIQMATV  521

Query  123  QA  118
             A
Sbjct  522  PA  523



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 150/190 (79%), Gaps = 8/190 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLLTSV GMV +L LL   LT+ID S +KV WA+A++I M LAYVA
Sbjct  347  LVATFMLDKSGRRPLLLTSVAGMVLSLMLLATGLTIIDQSEQKVVWAIALSITMVLAYVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL KAI+IGG+FFL
Sbjct  407  LFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSLEKAITIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANNN  148
            YA +AAV +VFFFTLMPETQGKTLEE EALFGTF+ WR   RE+          K +N+N
Sbjct  467  YAGLAAVAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDN  526

Query  147  SQLQMGTLQA  118
             Q+QMG   A
Sbjct  527  GQIQMGIAPA  536



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +L  LG+ LT+I+H+ +K+ WAVA+ IA  L+YVA
Sbjct  335  LVATFLLDKIGRRPLLLSSVAGMILSLVGLGIGLTIIEHADQKLIWAVALCIATVLSYVA  394

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSG++SMTFISLYKAISIGG+FFL
Sbjct  395  FFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAANRVTSGMISMTFISLYKAISIGGAFFL  454

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            YA IAA+ WVFF+TL PETQGKTLEE E  FGTFF+WRS  R ++ KK  +N QLQ+ T
Sbjct  455  YAGIAAIAWVFFYTLYPETQGKTLEEMETFFGTFFKWRSTMRALEEKKGESNGQLQLTT  513



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHS EK+PWAVA++IAM LAYV+
Sbjct  348  LVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTMIDHSDEKLPWAVALSIAMVLAYVS  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S TFI LYKAI+IGGSFFL
Sbjct  408  FFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTTFILLYKAITIGGSFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK---ANNNSQLQM  133
            +A +AAVGW+FF+  +PET+G+TLE+ E LFG+FF+WRS  ++   K+     N  Q+QM
Sbjct  468  FAGVAAVGWLFFYACLPETRGRTLEDMEVLFGSFFKWRSALKDEQRKEVSSGENGGQIQM  527

Query  132  GT  127
            GT
Sbjct  528  GT  529



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (80%), Gaps = 4/183 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SV GM+ +LA LG SLTVIDHSHEK+ WAVA+ IAM LAYVA
Sbjct  346  LVATFLLDRIGRRPLLLSSVAGMIFSLATLGFSLTVIDHSHEKLTWAVALCIAMILAYVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S TFISLYK I+IGG+FFL
Sbjct  406  FFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTTFISLYKGITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA----NNNSQLQ  136
            +AAIA+V W FFFT +PETQG+TLE+ E LFG F +WRS  ++    KA      N Q+Q
Sbjct  466  FAAIASVAWTFFFTCLPETQGRTLEDMEVLFGHFIKWRSAAKDEKLNKAEFHGETNGQIQ  525

Query  135  MGT  127
            MGT
Sbjct  526  MGT  528



>gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   257 bits (656),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL SV GM+ +LA LG SLT+IDHSH+K+ WA+ + I M LAYVA
Sbjct  323  LVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHDKLTWAIVLCITMVLAYVA  382

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISLYK I+IGG+FFL
Sbjct  383  FFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISLYKGITIGGAFFL  442

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK----ANNNSQLQ  136
            +AAIA V W FFFT +PETQG+TLE+ E LFG F  WRS  +E + KK    + NN Q+Q
Sbjct  443  FAAIATVAWTFFFTCLPETQGRTLEDMEVLFGRFINWRSALKEENLKKKAANSENNGQIQ  502

Query  135  MGT  127
            +GT
Sbjct  503  LGT  505



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SVGGMV +L  LG+ LT++++S  K+ WA+A+ I+  L++VA
Sbjct  343  LVATFLLDKIGRRPLLLSSVGGMVASLVGLGLGLTIVENSDHKMVWAIALCISTVLSFVA  402

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLY AISIGG FFL
Sbjct  403  FFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAMNRVTSGVISMTFISLYNAISIGGVFFL  462

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTL  124
            YA IAAV WVFF+T +PETQGKTLEE E LFGTF++WRS  R ++ KK   + Q+QM   
Sbjct  463  YAGIAAVAWVFFYTFLPETQGKTLEEMETLFGTFYKWRSTLRALNEKKREGDRQVQMRNA  522

Query  123  QAANK  109
             +++K
Sbjct  523  TSSSK  527



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 12/197 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +LA LG++LTVIDHS EK+ WA+ + IAM LAYVA
Sbjct  345  LVATFLLDRIGRRPLLLSSVGGMIFSLASLGIALTVIDHSSEKLMWAIVLCIAMVLAYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+   +NRVTSGV+SM+FISLYK I+IGG+FFL
Sbjct  405  FFSIGLGPITWVYSSEIFPLKLRAQGASMAVAVNRVTSGVISMSFISLYKGITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ---------REVDAKKANN  151
            +AA+A V WVFF+TL+PETQG+TLE+ E LFG FF+WRS           +EV+ +  NN
Sbjct  465  FAALAVVAWVFFYTLLPETQGRTLEDMEVLFGKFFKWRSANEILKNNSMGKEVNGQDNNN  524

Query  150  ---NSQLQMGTLQAANK  109
               N  +Q+GT +   K
Sbjct  525  AKANGHIQLGTTKDQTK  541



>ref|XP_006361759.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=475

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTS GGM  +L LL + L VID S+ +V WAVA+ + M   YVA
Sbjct  291  LVATFLLDRVGRRPLLLTSFGGMTISLILLSIGLAVIDRSNSQVTWAVALCVMMVSVYVA  350

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPI WVY SE+FPLKLRATG S+G  +NRVTSGV+SMTF+SL KAI+I G+FF 
Sbjct  351  LFSIGAGPIAWVYGSEVFPLKLRATGFSVGVAVNRVTSGVISMTFLSLEKAITIQGAFFS  410

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            YA IA + WVFFFTLMPETQGKTLEET ALFGTFF WRS  RE+  KK NNN ++QM T
Sbjct  411  YAGIAGMAWVFFFTLMPETQGKTLEETVALFGTFFEWRSTARELKGKKMNNNDEIQMAT  469



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLLTSV GMV +L LL   LT+ID S +KV WA+A++I M LAYVA
Sbjct  345  LVATFMLDKSGRRPLLLTSVAGMVLSLLLLATGLTIIDQSEQKVVWAIALSITMVLAYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL K+I+IGG+FFL
Sbjct  405  LFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSLVKSITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE-----VDAKKANNNSQL  139
            Y  +AAV +VFFFTLMPETQGKTLEE EALFG+F+ WR   RE     +  K +N+N Q+
Sbjct  465  YFGLAAVAFVFFFTLMPETQGKTLEEMEALFGSFWDWRKTARELKEAKITEKNSNDNGQI  524

Query  138  QMGTLQA  118
            QMGT  A
Sbjct  525  QMGTAPA  531



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +L+ LG  LT+IDHS EK+PWAVA++IAM LAYV+
Sbjct  348  LVATFFLDRIGRRPLLLSSVGGMVLSLSTLGFGLTMIDHSDEKLPWAVALSIAMVLAYVS  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S TFI LYKAI+IGGSFFL
Sbjct  408  FFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTTFILLYKAITIGGSFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQMG  130
            +A +AAVGW+FF+  +PET+G+TLE+ E LFG FF WRS  ++   K+    N  Q+QMG
Sbjct  468  FAGVAAVGWLFFYACLPETRGRTLEDMEVLFGHFFNWRSALKDEQRKEVSGENGGQIQMG  527

Query  129  T  127
            T
Sbjct  528  T  528



>gb|EYU42629.1| hypothetical protein MIMGU_mgv1a0059092mg, partial [Erythranthe 
guttata]
Length=275

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +L  L + LTVI+H+  K+ WA+A+ I  TL+YV+
Sbjct  92   LVATFLLDKIGRRPLLLSSVAGMIVSLLGLAIGLTVIEHAEHKLIWAIALCIGSTLSYVS  151

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+SMTF+SL +AI+IGG+FFL
Sbjct  152  FFSIGMGPITWVYSSEIFPLRLRAQGCAMGVALNRVTSGVISMTFLSLNRAITIGGAFFL  211

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            YA +AA+  VFF+TL PETQGKTLEE E+LFGTF +WRS  R ++ KK+  N Q+Q+
Sbjct  212  YAGVAAIALVFFYTLYPETQGKTLEEMESLFGTFSKWRSTLRTLNEKKSEKNGQIQL  268



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 144/183 (79%), Gaps = 5/183 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +LA LG  LT+IDHSHEK+PWAVA++IAM LA+VA
Sbjct  348  LVATFLLDRIGRRPLLLSSVGGMILSLATLGFGLTIIDHSHEKLPWAVALSIAMVLAFVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S TFI LYKAISIGGSFFL
Sbjct  408  FFSIGMGPIAWVYSSEIFPLRLRAQGTGMGVAVNRVTSGVISTTFIMLYKAISIGGSFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS----RQREVDAKKANNNSQLQ  136
            +A IA V WVFFF   PET+G+TLE+ E LFG F  WRS     Q+E +A    N+ Q+Q
Sbjct  468  FAGIATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSALKDEQKEGEA-HGGNDGQIQ  526

Query  135  MGT  127
            MGT
Sbjct  527  MGT  529



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LALLG+ LT++DHS  K+ WAVA  + M LAYV+
Sbjct  346  LVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEHKMVWAVAWCLIMVLAYVS  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+SMTF+SL KAI+ GG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISMTFLSLSKAITTGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTL  124
            +A IA+V + FF+TL+PET+G+TLEE E LFGTFF+WR++ RE++ +K     QLQMGT 
Sbjct  466  FAGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMRELEKQKTGQ--QLQMGTT  523

Query  123  QAANK  109
              A K
Sbjct  524  ATAAK  528



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L LL   LT+IDHS +K+ WA+A+ I+M LAYVA
Sbjct  364  LVATFMLDRSGRRPLLLTSVGGMVASLVLLATGLTIIDHSEQKLVWAIALCISMVLAYVA  423

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL LRATGCS+G  +NRVTSGVVSMTF+SL KAI+IG +FFL
Sbjct  424  LFSIGMGPITWVYSSEIFPLTLRATGCSIGVAVNRVTSGVVSMTFLSLQKAITIGAAFFL  483

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD-----AKKANNNSQL  139
            YAA+AAV WVFF+TLMPETQGKTLEE E LFGTF+ WR R RE+       K +N+N Q+
Sbjct  484  YAALAAVAWVFFYTLMPETQGKTLEEMETLFGTFWNWRERGRELKELKKTEKNSNDNGQI  543

Query  138  QMGTLQAA  115
            QMGT   A
Sbjct  544  QMGTNNPA  551



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   249 bits (637),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 147/184 (80%), Gaps = 5/184 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +LA L +SLT+IDHS +KV WAVA+AI   L++V 
Sbjct  345  LVATFLLDRVGRRPLLLSSVGGMILSLAGLAVSLTIIDHSEKKVAWAVALAITTVLSFVG  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA G S+GT +NR+ SG +SMTFISLY AISIGG+FFL
Sbjct  405  TFSIGMGPIAWVYSSEIFPLRLRAQGTSIGTAMNRLISGTISMTFISLYNAISIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA-----NNNSQL  139
            +  +A V WVFF+TL+PETQG+TLEE + LFGTFF+WRS  RE++  K      N+N Q+
Sbjct  465  FMGVAIVSWVFFYTLLPETQGRTLEEMQVLFGTFFKWRSTLREMEKNKKIRDNDNSNGQI  524

Query  138  QMGT  127
            Q+GT
Sbjct  525  QLGT  528



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LALLG+ LT++DHS  K+ WAVA  + M LAYV+
Sbjct  346  LVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEHKMVWAVAWCLIMVLAYVS  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+SMTF+SL KAI+ GG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISMTFLSLSKAITTGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            +A IA+V + FF+TL+PET+G+TLEE E LFGTFF+WR++ RE++ +K     QLQMGT
Sbjct  466  FAGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMRELEKQK--TGQQLQMGT  522



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 142/179 (79%), Gaps = 8/179 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +L  LG+ LT+IDHS  K+ WA+A+ IA  L+YVA
Sbjct  344  LVATFFLDKVGRRPLLLSSVAGMILSLMGLGIGLTIIDHSDHKIEWAIALCIATILSYVA  403

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+ SGV+ MTFISLYKAI+IGG+FFL
Sbjct  404  FFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAVNRIVSGVIGMTFISLYKAITIGGAFFL  463

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANN  151
            +  +A VG+VFF+TL PETQGK LEE E +FGTFFRWR+RQ E+D        +KKA N
Sbjct  464  FTGVAIVGFVFFYTLYPETQGKNLEEVEEVFGTFFRWRTRQAELDRAKEAEMVSKKAQN  522



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 7/186 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+ATF LD+ GRRPLLL+S+ GMV +L  LG SLT+IDHSHEK+PWA+ + I M LAYVA
Sbjct  350  LIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHEKIPWAIGLCITMVLAYVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISLYKAISIGG+FFL
Sbjct  410  LFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISLYKAISIGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNS  145
            +A IA V  +FF+   PETQGKTLEE E LFG F  WR   +++  KK         +N 
Sbjct  470  FAGIATVATLFFYMFYPETQGKTLEEMEGLFGKFIGWREEAKKLKMKKTMEVNGDGTSNG  529

Query  144  QLQMGT  127
            Q+Q+G 
Sbjct  530  QIQLGN  535



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+ATF LD+ GRRPLLL+S+ GMV +L  LG SLT+IDHSHEK+PWA+ + I M LAYVA
Sbjct  350  LIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHEKIPWAIGLCITMVLAYVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISLY+AISIGG+FFL
Sbjct  410  LFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISLYEAISIGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNS  145
            +A +A V  +FF+   PETQGKTLEE E LFG FF WR   +++  KK         +N 
Sbjct  470  FAGVAMVATLFFYMFYPETQGKTLEEMEGLFGKFFGWREEAKKLKMKKTMEVSGDGTSNG  529

Query  144  QLQMGT  127
            Q+Q+G 
Sbjct  530  QIQLGN  535



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +LA LG+SLT+IDHS EK+ WA+A+ I M LAYVA
Sbjct  348  LVATFFLDRIGRRPLLLSSVGGMVASLATLGLSLTIIDHSDEKLMWAIALCITMVLAYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G   NRVTSGV+SM+FISLYKAISIGG+FFL
Sbjct  408  FFSIGMGPITWVYSSEIFPLRLRAQGASMGVAANRVTSGVISMSFISLYKAISIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-------RQREVDAKKANNNS  145
            +A +A V W FF+T +PETQGKTLEE E LFG    WR        R +EV+     +N 
Sbjct  468  FAGVATVAWFFFYTCLPETQGKTLEEMEGLFGKLMGWRKEAKKLKMRMKEVNG-DGTSNG  526

Query  144  QLQMGT  127
            Q+Q+G 
Sbjct  527  QIQLGN  532



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 7/186 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+S+ GM+ +LA LG  LT++ HS EKV WAV ++I M L YVA
Sbjct  346  LVATFLLDRIGRRPLLLSSMAGMIASLACLGFGLTIVVHSDEKVMWAVVLSITMVLVYVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG +SMTFISLY+AI+IGG+FFL
Sbjct  406  FFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAVNRVVSGTLSMTFISLYEAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKAN--NNS  145
            +A IAAVGWVFF+T++PETQG+TLE+ E LFG F +W+      R + VD    +  N  
Sbjct  466  FAGIAAVGWVFFYTMLPETQGRTLEDMEVLFGKFHKWKKANALLRNKRVDPNSNDTANGG  525

Query  144  QLQMGT  127
            Q+Q+GT
Sbjct  526  QVQLGT  531



>gb|AAZ80876.1| putative sorbitol transporter, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=312

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRR LLLTSV GMV +L LL   LT+ID S +KV WA+A++I M LAYVA
Sbjct  120  LVATFMLDKSGRRKLLLTSVAGMVLSLMLLATGLTIIDQSEQKVIWAIALSITMVLAYVA  179

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF++L K I+IGG+FFL
Sbjct  180  LFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLTLVKRITIGGAFFL  239

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANNN  148
            Y  +AA  +VFFFTLMPETQGKTLEE EALFGTF+ WR   RE+          K +N+N
Sbjct  240  YFGLAAAAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDN  299

Query  147  SQLQMGTLQA  118
             Q+QMGT  A
Sbjct  300  GQIQMGTAPA  309



>ref|XP_008368693.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=353

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 139/179 (78%), Gaps = 6/179 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV + IAM L  VA
Sbjct  171  LVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAVGLCIAMVLFIVA  230

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISLYKAI+IGG+FFL
Sbjct  231  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRXTSGVISMTFISLYKAITIGGAFFL  290

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS  145
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++  + D    ++N 
Sbjct  291  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTNQADHGLGDDNK  349



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 141/181 (78%), Gaps = 7/181 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSVGGMV +L  LG+ LT++DH    VPWA+ + +AM    VA
Sbjct  346  LVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKGSVPWAIGLCMAMVYFNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVSMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQ  142
            YA I+A  W+FF+T++PETQG+TLE+TE LFG + RWR        +++VD    NNN+Q
Sbjct  466  YAGISAAAWIFFYTMLPETQGRTLEDTEVLFGKYHRWRKANAMLKERKQVDGDD-NNNAQ  524

Query  141  L  139
            +
Sbjct  525  V  525



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 6/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV + IAM L  VA
Sbjct  303  LVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAVGLCIAMVLFIVA  362

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKAI+IGG+FFL
Sbjct  363  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAITIGGAFFL  422

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++ ++ D    ++N
Sbjct  423  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADHGLGDDN  480



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 141/181 (78%), Gaps = 7/181 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSVGGM+ +L  LG+ LT++DH    VPWAV + +AM    VA
Sbjct  346  LVATFFLDKFGRRPLLLTSVGGMIFSLMFLGVGLTIVDHHKGSVPWAVGLCMAMVYFNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQ  142
            YA I+A  W+FF+T++PETQG+TLE+ E LFG +FRWR        +++VD    NNN+Q
Sbjct  466  YAGISAAAWMFFYTMLPETQGRTLEDMEVLFGKYFRWRKANAMLKERKQVDGDD-NNNAQ  524

Query  141  L  139
            +
Sbjct  525  V  525



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV+DHSH KV WAVA+ IAM +  VA
Sbjct  345  LVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHGKVQWAVALCIAMVMFNVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVISMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  142
            YA  +++ ++FF+T++PETQG+TLE+ E LFG + +WR     +  K+A   SQ
Sbjct  465  YAGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANAMLKKKEAAEKSQ  518



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 141/179 (79%), Gaps = 6/179 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTVID SH KVPWAV + IAM L  VA
Sbjct  345  LVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVIDQSHSKVPWAVGLCIAMVLFIVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS  145
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++ ++ D    ++N 
Sbjct  465  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANALLNKTKQADHGFGDDNK  523



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV+DHSH KV WAVA+ IAM +  VA
Sbjct  345  LVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHGKVQWAVALCIAMVMFNVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVISMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  142
            YA  +++ ++FF+T++PETQG+TLE+ E LFG + +WR     +  K+A   SQ
Sbjct  465  YAGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANAMLKKKEAAEKSQ  518



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 141/184 (77%), Gaps = 7/184 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHS EK+PWAVA++IAM LA+VA
Sbjct  348  LVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSPEKLPWAVALSIAMVLAFVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S TFI LYKAISIGG+FFL
Sbjct  408  FFSIGMGPIPWVYSSEIFPLRLRAQGTGMGVAMNRVTSGVISTTFIMLYKAISIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-----ANNNSQL  139
            +A  A V WVFFF   PET+G+TLE+ E LFG F  WRS  +  D KK       N+ Q+
Sbjct  468  FAGFATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSVLK--DGKKEEEVHGGNDGQI  525

Query  138  QMGT  127
            QMGT
Sbjct  526  QMGT  529



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTVID SH KVPWAV + IAM L  VA
Sbjct  348  LVATFQVDRFGRRILLLSSVGGMVISFILLGVGLTVIDQSHNKVPWAVGLCIAMVLFIVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  408  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +W+     ++  K  ++
Sbjct  468  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWKEANAMLNKTKQADH  519



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 147/190 (77%), Gaps = 7/190 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+K+ WA+ +AI+  L+YVA
Sbjct  347  LVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKMIWAIGLAISTVLSYVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFL
Sbjct  407  FFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVSMTFLSLSKAITIGGSFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----NNSQ  142
            YA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     + S 
Sbjct  467  YASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDSASN  525

Query  141  LQMGTLQAAN  112
            +Q+G +   N
Sbjct  526  VQLGPVSNGN  535



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV++HSH KV WA+A+ IAM L+ VA
Sbjct  345  LVATFMLDKFGRRPLLLTSVGGMIFSLMLLGVGLTVVEHSHSKVQWAIALCIAMVLSNVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEI+PL+LRA GC++G  +NR+ SGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGLGPITWVYSSEIYPLQLRAQGCAMGVAMNRLMSGVISMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  142
            YA  +++ ++FF+T++PETQG++LE+ E LFG + +WR     +  K+A   SQ
Sbjct  465  YAGTSSIAFMFFYTMLPETQGRSLEDMELLFGKYHKWRQANAMLKKKEAAEKSQ  518



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   241 bits (616),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 146/190 (77%), Gaps = 7/190 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+K+ WA+ +AI+  L+YVA
Sbjct  347  LVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKMIWAIGLAISTVLSYVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFL
Sbjct  407  FFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVSMTFLSLSKAITIGGSFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKANN-----NSQ  142
            YA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN       S 
Sbjct  467  YASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDGASN  525

Query  141  LQMGTLQAAN  112
            +Q+G +   N
Sbjct  526  VQLGPVSNGN  535



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   241 bits (616),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV + IAM L  VA
Sbjct  345  LVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAVGLCIAMVLFIVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKA++IGG+FFL
Sbjct  405  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAVTIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  465  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADH  516



>ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform X2 [Nicotiana sylvestris]
Length=336

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 138/183 (75%), Gaps = 2/183 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS  K+ WA+ + I  TL+ VA
Sbjct  153  LVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLKWAIVLCICTTLSSVA  212

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFL
Sbjct  213  FFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISLYKAISIGGAFFL  272

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQMG  130
            Y  IA + W+FF+ L+PETQG+TLEE E LFGTFF+WRS  +E+   K  ++ ++Q+QMG
Sbjct  273  YTGIAIIAWIFFYALLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESDGSAQVQMG  332

Query  129  TLQ  121
              Q
Sbjct  333  NSQ  335



>gb|KEH30427.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=333

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ K+ WA+ ++IA  L+YVA
Sbjct  152  LVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLNWAIGLSIATVLSYVA  211

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL K I+IGG+FFL
Sbjct  212  TFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSLSKGITIGGAFFL  271

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN-SQLQMGT  127
            +  IA +GW+FF+ ++PETQGKTLEE EA FG    WR  +   +A+K N   +Q+Q+GT
Sbjct  272  FGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKEAEKDNAQVAQVQLGT  329



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 151/193 (78%), Gaps = 9/193 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GMV TLA LG+ LT+IDHS EK+ WA+A+++ M LAYVA
Sbjct  346  LVATFMLDRIGRRPLLLTSVAGMVFTLACLGLGLTIIDHSGEKIMWAIALSLTMVLAYVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS-------  145
            +AAIAAVGW FFFT++PETQG+TLE+ E LFG F+RWR     +  KK  ++        
Sbjct  466  FAAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANALLKQKKQVDHGDGNNNPN  525

Query  144  --QLQMGTLQAAN  112
              Q+Q+GT   AN
Sbjct  526  NPQIQLGTKGQAN  538



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 5/183 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GM+ +LA LGM LTVIDHS  K+ WAVA+++   L+YVA
Sbjct  345  LVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKLIWAVALSLCTVLSYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS----QLQ  136
            Y+ +A VGW+FF+T +PETQG+TLE+ E LF T   W  ++   +    N+N     Q+Q
Sbjct  465  YSGVALVGWIFFYTWLPETQGRTLEDMEILF-TNSSWNKKKSSTNDTSGNSNDHINGQIQ  523

Query  135  MGT  127
            +GT
Sbjct  524  LGT  526



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 5/183 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GM+ +LA LGM LTVIDHS  K+ WAVA+++   L+YVA
Sbjct  345  LVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKLIWAVALSLCTVLSYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS----QLQ  136
            Y+ +A VGW+FF+T +PETQG+TLE+ E LF T   W  ++   +    N+N     Q+Q
Sbjct  465  YSGVALVGWIFFYTWLPETQGRTLEDMEILF-TNSSWNKKKSSTNDTSGNSNDHINGQIQ  523

Query  135  MGT  127
            +GT
Sbjct  524  LGT  526



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 139/182 (76%), Gaps = 8/182 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVAT  LDKFGRRPLLLTSV GMV +L  LG  LT++D  H K+ WA+ + I M L  VA
Sbjct  348  LVATVFLDKFGRRPLLLTSVAGMVFSLTCLGAGLTIVDQHHGKITWAIVLCITMVLLNVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  408  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS------RQREVDAKKANNNSQ  142
            YA IAAVGWVFF+TL PETQG+TLE+ E LFG + +WR       + ++VD +  +N  Q
Sbjct  468  YAGIAAVGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANAMLKKTKQVDGE--DNKGQ  525

Query  141  LQ  136
            + 
Sbjct  526  IH  527



>ref|XP_008246181.1| PREDICTED: polyol transporter 5-like, partial [Prunus mume]
Length=359

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAA  481
            +ATF LD+ GRRPLLLTS+GGM+ +LA LG +LT++DH    +PWAVA+ I M L  VA 
Sbjct  179  IATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDSTIPWAVALCITMVLFNVAF  238

Query  480  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  301
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++SMTF+SLYKAI+IGG+FFLY
Sbjct  239  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTFLSLYKAITIGGAFFLY  298

Query  300  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     + +KK ++  
Sbjct  299  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKSKKVDHGD  350



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVAT  LDKFGRRPLLLTSV GMV +L+ LG SLT++D  H K+ WA+ + I M L  VA
Sbjct  303  LVATVFLDKFGRRPLLLTSVAGMVFSLSCLGASLTIVDQQHGKIMWAIVLCITMVLLNVA  362

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  363  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  422

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD-AKKANNNSQLQM  133
            YA IAAVGWVFF+ L PETQG+TLE+ E LFG + +WR     +  AK+ + + + Q+
Sbjct  423  YAGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANALLQKAKQVDGDDKGQV  480



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 6/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D S  KVPWA+ + IAM L  VA
Sbjct  346  LVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSPSKVPWAIGLCIAMVLFIVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++ ++ D   A++N
Sbjct  466  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADHGFADHN  523



>ref|XP_008387375.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=520

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 6/179 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG  LTV+D SH KVPWAV + IAM L  VA
Sbjct  338  LVATFQVDRFGRRILLLSSVGGMVVSFTLLGXGLTVVDQSHSKVPWAVGLCIAMVLFIVA  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  398  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS------RQREVDAKKANNNS  145
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +W        + ++ D    ++N 
Sbjct  458  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWXEANXMLKKTKQADHXFGDDNK  516



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 140/178 (79%), Gaps = 6/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGM  +  LLG+ LTV+D SH KVPWAV + IAM L  VA
Sbjct  347  LVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHSKVPWAVGLCIAMVLFIVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKA++IGG+FFL
Sbjct  407  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAVTIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR      ++ ++ D    ++N
Sbjct  467  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADHGFGDDN  524



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGM  +  LLG+ LTV+D SH KVPWAV + IAM L  VA
Sbjct  345  LVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHSKVPWAVGLCIAMVLFIVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISLYKA++IGG+FFL
Sbjct  405  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISLYKAVTIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  465  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKTKQADH  516



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVAT  LDKFGRRPLLLTSV GMV +L+ LG  LT++D  H K+ WA+ + I M L  VA
Sbjct  348  LVATVFLDKFGRRPLLLTSVAGMVFSLSCLGAGLTIVDQQHGKIMWAIVLCITMVLLNVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  408  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV-DAKKANNNSQLQM  133
            YA IAAVGWVFF+ L PETQG+TLE+ E LFG + +WR     +  AK+A+ + + Q+
Sbjct  468  YAGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANALLKKAKQADGDDKGQV  525



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 141/183 (77%), Gaps = 4/183 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL SV GM+ +LA LG SLT+IDHSH+K+ WA+ + I M LAYVA
Sbjct  351  LVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHDKLTWAIVLCITMVLAYVA  410

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSE+FPL+LRA G S+G  +  VTSGV+S TFISLYK I+IGG+FFL
Sbjct  411  FFSIGMGPITWVYSSEVFPLRLRAQGASMGVAVGGVTSGVISTTFISLYKGITIGGAFFL  470

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK----ANNNSQLQ  136
            +AAIA   W FFFT +PET+G+TLE+ E  FG+F  WRS  +E + KK    + N+ Q+Q
Sbjct  471  FAAIATGAWTFFFTCLPETRGRTLEDMEVRFGSFINWRSALKEENLKKKAASSENDDQIQ  530

Query  135  MGT  127
            +GT
Sbjct  531  LGT  533



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 146/190 (77%), Gaps = 7/190 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+KV WAV +AI+  L+YVA
Sbjct  347  LVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKVIWAVGLAISTVLSYVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFL
Sbjct  407  FFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVSMTFLSLSKAITIGGSFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----NNSQ  142
            YA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     + S 
Sbjct  467  YASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDSASN  525

Query  141  LQMGTLQAAN  112
            +Q+G +   N
Sbjct  526  VQLGPVSNGN  535



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSV GMV +L  LG+ LT++DH    VPWA+ + +AM    VA
Sbjct  346  LVATFFLDKFGRRPLLLTSVAGMVFSLTFLGVGLTIVDHHKGSVPWAIGLCLAMVYFNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVS TFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVSTTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKANNNSQL  139
            YA I+A  W+FF+TL+PETQG+TLE+ E LFG F RWR      ++R+      NNN+Q+
Sbjct  466  YAGISAAAWIFFYTLLPETQGRTLEDMEVLFGKFHRWRKANAMLKERKQVHGDDNNNAQV  525



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 146/190 (77%), Gaps = 7/190 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+KV WAV +AI+  L+YVA
Sbjct  347  LVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKVIWAVGLAISTVLSYVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL KAI+IGGSFFL
Sbjct  407  FFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVSMTFLSLSKAITIGGSFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----NNSQ  142
            YA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     + S 
Sbjct  467  YASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGDSASN  525

Query  141  LQMGTLQAAN  112
            +Q+G +   N
Sbjct  526  VQLGPVSNGN  535



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 5/183 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  L +SLT+IDHS  K+ WAV ++IA  L+YVA
Sbjct  341  LVATFMLDRVGRRPLLLTSVGGMVLSLLTLAVSLTIIDHSETKLMWAVGLSIATVLSYVA  400

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL KAI+IGG+FFL
Sbjct  401  TFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSKAITIGGAFFL  460

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR----WRSRQREVDAKKANNNSQLQ  136
            + AIAA GWVFF+T++PETQGKTLEE E  FG F R    + S   E+D  K +  +Q+Q
Sbjct  461  FGAIAAAGWVFFYTMLPETQGKTLEEMEGSFGKFGRKSQSYDSTHNELDNGK-DQVAQVQ  519

Query  135  MGT  127
            +GT
Sbjct  520  LGT  522



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 139/181 (77%), Gaps = 7/181 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSVGGMV +L  LG+ LT++DH    VPWAV + +AM    VA
Sbjct  346  LVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKGSVPWAVGLCMAMIYFNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNSQ  142
            YA I+A  W+FF+T++PETQG+ LE+ E LFG + RWR        +++VD    N+N+Q
Sbjct  466  YAGISAAAWMFFYTMLPETQGRPLEDMEVLFGKYHRWRKADAMLKERKQVDGDD-NDNAQ  524

Query  141  L  139
            +
Sbjct  525  V  525



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +L  LG+ LTVI  S  K+ WAVA+ I   L+YVA
Sbjct  342  LVATFFLDKIGRRPLLLSSVAGMILSLMGLGLGLTVIARSDHKLVWAVALCITSVLSYVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTF+SLYKAISIGG+FFL
Sbjct  402  FFSIGMGPITWVYSSEIFPLQLRAQGCSVGVAVNRVTSGVISMTFLSLYKAISIGGTFFL  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            Y  +A V WVFF++L+PETQG+TLEE E+LFGTFF+WRS +R ++  K      +QM
Sbjct  462  YGGVAMVAWVFFYSLLPETQGRTLEEMESLFGTFFKWRSTRRALEENKKFGGKHVQM  518



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 135/177 (76%), Gaps = 6/177 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDKFGRRPLLLTSV GMV +L  LG+ LT++DH    VPWAV + +AM    VA
Sbjct  346  LVATFFLDKFGRRPLLLTSVAGMVFSLLFLGVGLTIVDHHKGSVPWAVGLCMAMVYFNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANN  151
            Y+ I+A  WVFF+T++PETQG+TLE+ E LFG + RWR        +++VD    NN
Sbjct  466  YSGISAAAWVFFYTMLPETQGRTLEDMEVLFGKYHRWRKANAMLKERKQVDGDDNNN  522



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 138/182 (76%), Gaps = 8/182 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVAT  LDKFGRRPLLLTSV GMV +L  LG  LT++D  H K+ WA+ + I M L  VA
Sbjct  348  LVATVFLDKFGRRPLLLTSVAGMVLSLTCLGAGLTIVDQHHGKITWAIVLCITMVLLNVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
              SIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISLYKAI+IGG+FFL
Sbjct  408  FXSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISLYKAITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS------RQREVDAKKANNNSQ  142
            YA IAA+GWVFF+TL PETQG+TLE+ E LFG + +WR       + ++VD +  +N  Q
Sbjct  468  YAGIAALGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANAMLKKTKQVDGE--DNKGQ  525

Query  141  LQ  136
            + 
Sbjct  526  IH  527



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ K+ WA+ ++IA  L+YVA
Sbjct  291  LVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLNWAIGLSIATVLSYVA  350

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL K I+IGG+FFL
Sbjct  351  TFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSLSKGITIGGAFFL  410

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN-SQLQMGT  127
            +  IA +GW+FF+ ++PETQGKTLEE EA FG    WR  +   +A+K N   +Q+Q+GT
Sbjct  411  FGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKEAEKDNAQVAQVQLGT  468



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KV WAV + IAM L  VA
Sbjct  347  LVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHSKVSWAVGLCIAMVLFIVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISLYK I+IGG+FFL
Sbjct  407  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVISMTFISLYKTITIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  467  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKSKQADH  518



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 139/180 (77%), Gaps = 8/180 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+FGRRPLLL+SV GM+ +L  LG+ LT+ID  H+ VPWA+A+ I M L  VA
Sbjct  346  LVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDQHHDTVPWAIALCITMVLLNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGGSFFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSLYKAITIGGSFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR--------SRQREVDAKKANNN  148
            YA IAAV WVFF+ L+PET+G+TLE+ E LFG + +W+        S+Q + +  K+  N
Sbjct  466  YAGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHKWKKANALLKQSKQGDGEENKSQVN  525



>ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS  K+ WA+ + I  TL+ VA
Sbjct  153  LVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLKWAIVLCICTTLSSVA  212

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFL
Sbjct  213  FFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISLYKAISIGGAFFL  272

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            Y  IA + W+FF+TL+PETQG+TLEE E LFGTFF+WRS  +E+   K  ++
Sbjct  273  YTGIAIIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESD  324



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KV WAV + IAM L  VA
Sbjct  347  LVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHSKVSWAVGLCIAMVLFIVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISLYK I+IGG+FFL
Sbjct  407  FFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVISMTFISLYKTITIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR     ++  K  ++
Sbjct  467  YAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANAMLNKSKQADH  518



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 139/178 (78%), Gaps = 6/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV + IAM L  VA
Sbjct  345  LVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAVGLCIAMVLFIVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIF L+LRA GCS+G  +NR+TSGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGLGPITWVYSSEIFSLQLRAQGCSMGEAVNRMTSGVISMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNN  148
            YA IAA+ WVFF+TL PET G++LE+ E LFG + +WR      ++ ++ D    ++N
Sbjct  465  YAGIAALSWVFFYTLYPETXGRSLEDMEVLFGKYHKWREANAMLNKTKQADQGFGDDN  522



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+S+ GM+ +L  LG  LT++DH+ EKV WA+ ++I M L YVA
Sbjct  346  LVATFLLDRIGRRPLLLSSMAGMIASLVCLGFGLTIVDHNDEKVMWAIVLSITMVLFYVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+TWVY+SEIFPLKLRA G S+G  +NRV SG++SMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGMGPVTWVYTSEIFPLKLRAQGFSIGVAVNRVASGILSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKANNNS  145
            YA I  VGWVFF+T++PET+G+TLE+ E LFG F RW+      + + VD     NN+
Sbjct  466  YAGIGVVGWVFFYTMLPETKGRTLEDIEVLFGKFHRWKETNAFLKNKRVDPNNNGNNT  523



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ K+ WA+ ++IA  L+YVA
Sbjct  341  LVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLNWAIGLSIATVLSYVA  400

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL K I+IGG+FFL
Sbjct  401  TFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSLSKGITIGGAFFL  460

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN-SQLQMGT  127
            +  IA +GW+FF+ ++PETQGKTLEE EA FG    WR  +   +A+K N   +Q+Q+GT
Sbjct  461  FGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKEAEKDNAQVAQVQLGT  518



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+ GRRPLLL S+GGMV +L  LG SLTVID SH  VPWA+ + I M L  VA
Sbjct  349  LVATFLIDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSHGTVPWAIGLCITMVLFNVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+TWVY+SEIFPLKLRA GCSLG  INRVTSG++SMTFISLYKAI+IGG+FFL
Sbjct  409  FFSIGLGPVTWVYTSEIFPLKLRAQGCSLGVAINRVTSGIISMTFISLYKAITIGGAFFL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  151
            YA +  VGW+FF+T++PET G+TLEE E LFG + +W+     +   K  +
Sbjct  469  YAGVGVVGWIFFYTMLPETHGRTLEEMEVLFGKYHKWKEANAMLKNGKQGD  519



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAA  481
            +ATF LD+ GRRPLLLTS+GGM+ +LA LG +LT++DH    +PWAVA+ I M L  VA 
Sbjct  348  IATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDSTIPWAVALCITMVLFNVAF  407

Query  480  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  301
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++SMTF+SLYKAI+IGG+FFLY
Sbjct  408  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTFLSLYKAITIGGAFFLY  467

Query  300  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     + +KK ++  
Sbjct  468  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKSKKVDHGD  519



>ref|XP_008466959.1| PREDICTED: polyol transporter 5-like, partial [Cucumis melo]
Length=276

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+ WAV + I+M L YVA
Sbjct  91   LVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKLMWAVVLCISMVLTYVA  150

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+F+SL KAI+ GG+FFL
Sbjct  151  SFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMSFLSLSKAITTGGAFFL  210

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            +AAIA V W FF+T +PETQGKTLEE E LFG  FRW+S       +K N +  +Q+
Sbjct  211  FAAIAIVAWFFFYTALPETQGKTLEEMEMLFG-HFRWKSAAAPAATEKDNGSGGVQL  266



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 138/183 (75%), Gaps = 2/183 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+ATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS  K+ WA+ + I  TL+ VA
Sbjct  348  LIATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLKWAIVLCICTTLSSVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFL
Sbjct  408  FFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISLYKAISIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQMG  130
            Y  IA + W+FF+TL+PETQG+TLEE E LFGTFF+WRS  +E+   K  ++ ++Q+QM 
Sbjct  468  YTGIAVIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESDGSAQVQME  527

Query  129  TLQ  121
              Q
Sbjct  528  NSQ  530



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +L  LG+ LT+I+HS  K+ WAV M IA  L+YVA
Sbjct  350  LVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQTKLMWAVVMCIASVLSYVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV +M+FISLY AISIGG+FFL
Sbjct  410  FFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVSAMSFISLYDAISIGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            + A+A   W+FF+ LMPETQG+TLEE    FG + +WRS  RE+D ++
Sbjct  470  FMAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAREIDIQR  517



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +L  LG+ LT+I+HS  K+ WAV + IA  L+YVA
Sbjct  350  LVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQTKLMWAVVVCIASVLSYVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV++M+FISLY+AISIGG+FFL
Sbjct  410  FFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVLAMSFISLYEAISIGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            + A+A   W+FF+ LMPETQG+TLEE    FG + +WRS  RE+D ++
Sbjct  470  FMAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAREIDIQR  517



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 146/194 (75%), Gaps = 11/194 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+KV WAV +AI+  L+YVA
Sbjct  347  LVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKVIWAVGLAISTVLSYVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSL----GTGINRVTSGVVSMTFISLYKAISIGG  316
             FSIG GPIT VYSSEI PLKLRA G S+    G  +NRVTSGVVSMTF+SL KAI+IGG
Sbjct  407  FFSIGMGPITLVYSSEILPLKLRAQGASIGIMVGVMVNRVTSGVVSMTFLSLSKAITIGG  466

Query  315  SFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSRQREVDAKKAN-----  154
            SFFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  +RE    KAN     
Sbjct  467  SFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDSKREKRRNKANEINGD  525

Query  153  NNSQLQMGTLQAAN  112
            + S +Q+G +   N
Sbjct  526  SASNVQLGPVSNGN  539



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAA  481
            +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   K+PWAVA+ I M L  VA 
Sbjct  347  IATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIPWAVALCIIMVLFNVAF  406

Query  480  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  301
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSLYKAITIGGAFFLY  466

Query  300  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     +  KK ++  
Sbjct  467  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKTKKVDHGD  518



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAA  481
            +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   K+PWAVA+ I M L  VA 
Sbjct  347  IATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIPWAVALCIIMVLFNVAF  406

Query  480  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  301
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSLYKAITIGGAFFLY  466

Query  300  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     +  KK ++  
Sbjct  467  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKTKKVDHGD  518



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAA  481
            +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   K+PWAVA+ I M L  VA 
Sbjct  347  IATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIPWAVALCIIMVLFNVAF  406

Query  480  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  301
            FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SLYKAI+IGG+FFLY
Sbjct  407  FSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSLYKAITIGGAFFLY  466

Query  300  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            A I  + WVFF+T++PETQG+TLEE E LFG + +WR     +  KK ++  
Sbjct  467  AGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLKTKKVDHGD  518



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 8/180 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+FGRRPLLL+SV GM+ +L  LG+ LT+IDH  + VPWA+A+ I M L  VA
Sbjct  332  LVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDHHSDTVPWAIALCITMVLLNVA  391

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGG+FFL
Sbjct  392  FFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSLYKAITIGGAFFL  451

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREV---DAKKANNN  148
            YA I A+ WVFF+ L+PET+G+TLEETE LFG + R        RQRE    D  K+  N
Sbjct  452  YAGIGALSWVFFYMLLPETRGRTLEETEVLFGKYHRLEKANAVLRQREQGFGDENKSQVN  511



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 141/192 (73%), Gaps = 8/192 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+SV GM+ +L  LG+ LT+ID  H  K+ W  A+ + M +AY 
Sbjct  346  LVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHGAKMTWTTALCLTMVIAYA  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FF
Sbjct  406  ALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISLYKAITMGGAFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS  145
            LY  IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR        + +VD    NN +
Sbjct  466  LYGGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREANAMLETKTQVDHGDGNNGT  525

Query  144  -QLQMGTLQAAN  112
              +++GT   AN
Sbjct  526  GAVELGTKGPAN  537



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTS+GGM+ +L LLG SL VI HS   V WAVA+AI   LAYV 
Sbjct  303  LVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIGHSDHTVHWAVALAIFGVLAYVG  362

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSE+FPL+LRA GCS+G  +NR TSG++SMTF+SLYKAISI G+F+L
Sbjct  363  TFSIGLGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMTFLSLYKAISIAGAFYL  422

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREV-DAKKAN  154
            +AAIA V W+F FTL+PETQG++LEE   LFGT+F WR      + RE  +AK AN
Sbjct  423  FAAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLKGLKNREAEEAKNAN  478



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVA   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH  EK+ WA  + + M LAYV 
Sbjct  338  LVAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHETEKMMWASVLCLTMVLAYVG  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV+SM+FISLYKAI++GG+FFL
Sbjct  398  FFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLSMSFISLYKAITMGGTFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  157
            YA IA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  458  YAGIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRP++L+S+GGM+ ++  L   LTVID +  K+ WA+A+  A  + YVA
Sbjct  323  LVATFLLDRVGRRPMVLSSMGGMIVSIMCLATGLTVIDQADHKIMWAIALCTASIMFYVA  382

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSE FPL+LRA GCS+G  +NR  S ++SMTFI+LYK I+IGG+F+L
Sbjct  383  FFSIGMGPIAWVYSSETFPLRLRAQGCSMGVALNRCISALISMTFITLYKGITIGGAFYL  442

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            Y AI+ V W+FFFTL+PETQGKTLEE E+LFGTFFRWR+  RE++ +K   N
Sbjct  443  YGAISIVAWLFFFTLLPETQGKTLEEMESLFGTFFRWRTTLRELNERKREKN  494



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTS+GGM+ +L LLG SL VIDHS   V WAVA+AI   LAYV 
Sbjct  347  LVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIDHSDHTVHWAVALAIFGVLAYVG  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI W YSSE+FPL+LRA GCS+G  +NR TSG++SMTF+SLYKAISI G+F+L
Sbjct  407  TFSIGLGPIAWGYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMTFLSLYKAISIAGAFYL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREV-DAKKAN  154
            +AAIA V W+F FTL+PETQG++LEE   LFGT+F WR      + RE  +AK AN
Sbjct  467  FAAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLKGLKNREAEEAKNAN  522



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 136/180 (76%), Gaps = 8/180 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+FGRR LLL+SV GM+ +L  LG+ LT+IDH    VPWA+A+ I M L  V 
Sbjct  332  LVATFLLDRFGRRRLLLSSVAGMIFSLVCLGVGLTIIDHHRGTVPWAIALCITMVLFNVV  391

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGGSFFL
Sbjct  392  FFSIGLGPITWVYSSEIFPLKLRAQGASMGVAVNRITSGVISMTFLSLYKAITIGGSFFL  451

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR--------SRQREVDAKKANNN  148
            YA IAAV WVFF+ L+PET+G+TLE+ E LFG + RW+        S+Q + D  K+  N
Sbjct  452  YAGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANAVLKQSKQGDGDENKSQVN  511



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 141/192 (73%), Gaps = 8/192 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+SV GM+ +L  LG+ LT+ID  H  K+ W  A+ + M +AY 
Sbjct  346  LVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHGAKMTWTTALCLTMVIAYA  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG++SMTFISLYKAI++GG+FF
Sbjct  406  ALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGILSMTFISLYKAITMGGAFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS  145
            LY  IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR        + +VD    NN +
Sbjct  466  LYGGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREANAMLETKTQVDHGDGNNGT  525

Query  144  -QLQMGTLQAAN  112
              +++GT   AN
Sbjct  526  GAVELGTKGPAN  537



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH +EK+ WA  + + M LAYV 
Sbjct  338  LIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENEKMMWASVLCLTMVLAYVG  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+LYKAI++GG+FFL
Sbjct  398  FFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMGGTFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  157
            Y AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  458  YGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH +EK+ WA  + + M LAYV 
Sbjct  338  LIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENEKMMWATVVCLTMVLAYVG  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+LYKAI++GG+FFL
Sbjct  398  FFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMGGTFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  157
            Y AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  458  YGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 138/186 (74%), Gaps = 5/186 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL S+GGMV +L  LG SLTVID S   V WAV + I M L  VA
Sbjct  346  LVATFLLDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSQGTVTWAVGLCITMVLFNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+TWVY+SEIFPLKLRA GCS+G  INRVTSG++SMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGLGPVTWVYTSEIFPLKLRAQGCSMGVAINRVTSGIISMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS-----RQREVDAKKANNNSQL  139
            YA +  V W+FF+T++PETQG+TLEE E LFG + +W+      ++R+   K+  +N   
Sbjct  466  YAGVGVVAWIFFYTMLPETQGRTLEEMEVLFGKYHKWKEANAMLKKRKQGKKRDVHNFFF  525

Query  138  QMGTLQ  121
             +  LQ
Sbjct  526  LLNYLQ  531



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SV GM+ +L  L   LTVI++S +K+PWA+ + I M L +VA
Sbjct  338  LVATFLLDRVGRRPLLLSSVAGMIVSLVGLATGLTVIENSDKKLPWAIVLCIMMVLTFVA  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTFISLYKAI+IGG+FFL
Sbjct  398  SFSIGLGPITWVYSSEIFPLRLRAQGAAVGVAVNRVTSGVLAMTFISLYKAITIGGAFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  139
            Y  +A V W FFFT +PETQG+ LEETE LFG  FRWRS   +    K  N SQL
Sbjct  458  YGGVATVAWFFFFTFLPETQGRALEETEELFGN-FRWRSALTKKKMNKNQNQSQL  511



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 139/183 (76%), Gaps = 11/183 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+FGRR LLL+SV GM+ +LA LG+ LT+ID+  E VPWA+A+ I M L  VA
Sbjct  346  LVATFFLDRFGRRKLLLSSVAGMIFSLACLGVGLTIIDNHKETVPWAIALCITMVLLNVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SLYKAI+IGGSFFL
Sbjct  406  FFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSLYKAITIGGSFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-----------SRQREVDAKKA  157
            YA IAA+ WVFF+ L+PET+G+TLE+ E LFG + RW+           ++Q + D  K+
Sbjct  466  YAGIAALSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANAVLKQTKQTKQGDGDENKS  525

Query  156  NNN  148
              N
Sbjct  526  QVN  528



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+SV GMV +L  LG++LT+ID  H  K+ W  A+ + M +AY 
Sbjct  347  LVATFLLDRIGRRPLLLSSVAGMVFSLGSLGVALTIIDQHHGAKMTWTTALCLTMVIAYA  406

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FF
Sbjct  407  ALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISLYKAITMGGAFF  466

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LY  IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR     ++ K   N+     GT
Sbjct  467  LYGGIAAVAWVFFYTMYPETQGRTLEDMEILFGKFHKWREANAMLETKTQVNHGDGNNGT  526



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH  EK+ WA  + + M LAYV 
Sbjct  338  LIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHEKEKMMWASVVCLTMVLAYVG  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+LYKAI++GG+FFL
Sbjct  398  FFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMGGTFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  157
            Y AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR     +  K+A
Sbjct  458  YGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLRNKRA  506



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 141/181 (78%), Gaps = 5/181 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L ATFTLD+ GRRPLLL+SVGGMV +L  L +SLT+I HS  K+ WAVA++IAM LAYVA
Sbjct  340  LAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSERKLMWAVALSIAMVLAYVA  399

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVSMTF+SL +AI+IGG+FFL
Sbjct  400  TFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMTFLSLSEAITIGGAFFL  459

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN--SQLQMG  130
            Y  IA +GW+FF+TL+PET+GKTLE+ E  FGTF   RS+       +  N   +Q+Q+G
Sbjct  460  YCGIATLGWIFFYTLLPETRGKTLEDMEGSFGTF---RSKSNATKGVENGNGQVAQVQLG  516

Query  129  T  127
            T
Sbjct  517  T  517



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRR LLLTSVGGMV +L LL   LT+I+HS +K+ WA+A+ IAM LAYVA
Sbjct  338  LVATFMLDRSGRRRLLLTSVGGMVASLVLLATGLTIIEHSEQKLIWAIALCIAMVLAYVA  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL KAI+IG +FFL
Sbjct  398  LFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSLEKAITIGAAFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD-----AKKANNNSQL  139
            YAA+AAV  VFF+TLMPETQGKTLEE E LFGTF+ WR+R RE+       K +N+N  +
Sbjct  458  YAALAAVALVFFYTLMPETQGKTLEEMETLFGTFWNWRARARELKELKKTEKNSNDNGHI  517

Query  138  QMGTLQA  118
             MGT  A
Sbjct  518  PMGTSNA  524



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 141/181 (78%), Gaps = 5/181 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L ATFTLD+ GRRPLLL+SVGGMV +L  L +SLT+I HS  K+ WAVA++IAM LAYVA
Sbjct  342  LAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSERKLMWAVALSIAMVLAYVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVSMTF+SL +AI+IGG+FFL
Sbjct  402  TFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMTFLSLSEAITIGGAFFL  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN--SQLQMG  130
            Y  IA +GW+FF+TL+PET+GKTLE+ E  FGTF   RS+       +  N   +Q+Q+G
Sbjct  462  YCGIATLGWIFFYTLLPETRGKTLEDMEGSFGTF---RSKSNATKGVENGNGQVAQVQLG  518

Query  129  T  127
            T
Sbjct  519  T  519



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 142/191 (74%), Gaps = 7/191 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +HE++ WA  + + M L YVA
Sbjct  345  LVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHERILWAAVLCLTMVLLYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA-------NNNS  145
            YAAIA+V WVFFFT++PET G+TLE+ E LFG F +WR     +  KK         NN 
Sbjct  465  YAAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNASHGDGITNNG  524

Query  144  QLQMGTLQAAN  112
            Q+Q+GT    N
Sbjct  525  QVQLGTRGQVN  535



>gb|ACD68477.1| plasma membrane mannitol transporter [Arachis hypogaea]
Length=434

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ ++  LG+SLT+I HS +K+ WAV ++IA  L+YVA
Sbjct  258  LVATFMLDRVGRRPLLLSSVGGMILSVLTLGISLTIITHSDKKLMWAVGLSIATVLSYVA  317

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL KAISIGG+FFL
Sbjct  318  TFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSKAISIGGAFFL  377

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            +  IA VGW+FF+T++PET+GKTLE+ E  FG F   R+           N  Q+Q+GT
Sbjct  378  FGGIATVGWIFFYTMLPETRGKTLEDMEGSFGQF---RANPAGTKGVDNGNKGQVQLGT  433



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +LA +  SLT+IDHS EK+ WA+ + I M LA+VA
Sbjct  347  LVATFLLDRIGRRPLLLSSVGGMVASLAAIAFSLTIIDHSEEKLVWAIGLCITMVLAFVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI  VY+SEIFPL+LRA G S+   +NRVTSGV +MTFISLY AI+IGG+FFL
Sbjct  407  FFSIGMGPIAGVYTSEIFPLRLRAQGVSMAVAVNRVTSGVTAMTFISLYNAITIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS-QLQMGT  127
            +A IAA+GWVFF+T +PET+GKTLEE E LFG    WR   +++ +      S Q+Q+G 
Sbjct  467  FAGIAAMGWVFFYTCVPETRGKTLEEMEGLFGKLVGWREEAKKMKSTVMEEESRQVQLGN  526



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF +DK GRR LLLTS GG+  +L  L   LT+IDH   +K+ WAV + +A +LA V
Sbjct  351  LVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDDQKLTWAVVLCVATSLACV  410

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV MTFISLYKAI+IGG+FF
Sbjct  411  AFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVLMTFISLYKAITIGGAFF  470

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            L+  +A + W+FF+TL+PETQG+ LEE EALFG+FFRWRS  RE+  KK   +S
Sbjct  471  LFTGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMRELKRKKLEQDS  524



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATFTLDK GRRPL+LTS+GG    L +L   LT I +S  ++ WA+A+ +   L +VA
Sbjct  338  LVATFTLDKIGRRPLILTSIGGCCVCLLVLATGLTFIQNSDHRLVWAIALCLVAILCFVA  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             F +G GPITWVYSSEIFPL+LRA GC+L    NRVTS +++MTFISLYKAI++ G+FFL
Sbjct  398  IFGMGMGPITWVYSSEIFPLRLRAQGCALAIASNRVTSALLTMTFISLYKAITLAGAFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            YA  AAV WVFF+TL PET+GKTLEE  +LFGTFF+WRS  R ++ KK + N  +Q G 
Sbjct  458  YAGFAAVAWVFFYTLYPETKGKTLEEMGSLFGTFFKWRSTVRALEEKKGDYNGHVQTGN  516



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF +DK GRR LLLTS GG+  +L  L   LT+IDH   +K+ WAV + +A +LA V
Sbjct  349  LVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDDQKLTWAVVLCVATSLACV  408

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV MTFISLYKAI+IGG+FF
Sbjct  409  AFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVLMTFISLYKAITIGGAFF  468

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            L+  +A + W+FF+TL+PETQG+ LEE EALFG+FFRWRS  RE+  KK   +S
Sbjct  469  LFTGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMRELKRKKLEQDS  522



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 141/191 (74%), Gaps = 7/191 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +HE++ WA  + + M L YVA
Sbjct  345  LVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHERILWAAVLCLTMVLLYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLY AI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAMNRVVSGVLSMTFISLYDAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNS  145
            YAAIA+V WVFFFT++PET G+TLE+ E LFG F +WR     +  KK         NN 
Sbjct  465  YAAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNASHGDGNANNG  524

Query  144  QLQMGTLQAAN  112
            Q+Q+GT    N
Sbjct  525  QVQLGTRGQVN  535



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SV GMV +LA LG SLT+IDHSHEK+ WA+A+ IAM L YVA
Sbjct  348  LVATFLLDRIGRRPLLLSSVAGMVFSLATLGFSLTIIDHSHEKLTWAIALCIAMVLLYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S TFISLYK I+IGG+FFL
Sbjct  408  TFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTTFISLYKGITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  175
            +AAIAAV W FFFT +PETQG+TLE+ E LFG F +WRS  +E
Sbjct  468  FAAIAAVAWTFFFTCLPETQGRTLEDMEILFGHFIKWRSALKE  510



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 148/193 (77%), Gaps = 9/193 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GMV TLALLG+ LT+IDH HE++ WAV + + M LAYVA
Sbjct  346  LVATFMLDRLGRRPLLLTSVAGMVVTLALLGLGLTIIDHHHERIMWAVVLCLTMVLAYVA  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI+IGG+FFL
Sbjct  406  FFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTFISLYKAITIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS-------  145
            +AAIAAVGW FFFT++PETQG+TLE+ E LFG F+RWR     +  KK            
Sbjct  466  FAAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANALLKQKKQGERGDGNNNPN  525

Query  144  --QLQMGTLQAAN  112
              Q+Q+GT   AN
Sbjct  526  NPQIQLGTKGVAN  538



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHSHEK+PWAVA++IAM LA+VA
Sbjct  348  LVATFFLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSHEKLPWAVALSIAMVLAFVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI  VYSSEIFPL+LRA G  +G  +NRVTSGV++ TFI LYKAISIGG+FFL
Sbjct  408  FFSIGMGPIAGVYSSEIFPLRLRAQGIGMGVAVNRVTSGVITTTFIMLYKAISIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR  196
            +A IA V WVFFF   PET+G+TLE+ E LFG F +
Sbjct  468  FAGIATVAWVFFFACYPETRGRTLEDMEVLFGNFIK  503



>ref|XP_010068107.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=487

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LV+TF LD+ GRRPLLL+SVGGM+ +LA L   LT+ID SH  + WAVAM IA  L +VA
Sbjct  303  LVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHTTLKWAVAMCIASVLFFVA  362

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ MTF+SL KAI+IGG+FFL
Sbjct  363  FFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLVMTFLSLSKAITIGGAFFL  422

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKAN---NN  148
            Y  I    WVFF+ LMPETQG+TLEE +  FG + +WRS  RE++ ++     NN
Sbjct  423  YTGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTARELEMRRNKAVVNN  477



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WAV + +   LAYV
Sbjct  303  LVATFFLDRVGRRPLLLTSMAGMVGSLVCLGTSLTIVDQHEGVRMTWAVVLCLCCVLAYV  362

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FSIG GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFI+LYKAI++GG+FF
Sbjct  363  GFFSIGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFITLYKAITMGGTFF  422

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            LYAAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ KK
Sbjct  423  LYAAIGIVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKK  471



>gb|AAL38359.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AAM10180.1| sugar transporter protein [Arabidopsis thaliana]
Length=245

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +KV WAV +AIA  + YVA
Sbjct  54   LVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAVVVAIATVMTYVA  113

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S++F+ + KA++ GG+F+L
Sbjct  114  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPMSKAMTTGGAFYL  173

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMG  130
            +  IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + +   + +K   N ++++G
Sbjct  174  FGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKSKPKGNPEKTVPNPEVEIG  232



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 131/176 (74%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS   + WA+ + +  T + VA
Sbjct  330  LVATFLVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSDHTLKWAIVVCVCATYSTVA  389

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFL
Sbjct  390  FFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMTFISLYKAISIGGAFFL  449

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  136
            YA +A+V W+FF+TL+PET+G+TLEE E LFGTFF+WRS  +E+   +   +  L 
Sbjct  450  YAGVASVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKELKKNRVEGDDMLS  505



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WAV + +   LA+V
Sbjct  303  LVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEGARMTWAVVLCLFCVLAFV  362

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFISLYKAI++GG+FF
Sbjct  363  GFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFISLYKAITMGGAFF  422

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            LYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ K+
Sbjct  423  LYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKR  471



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WAV + +   LA+V
Sbjct  303  LVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEGARMTWAVVLCLFCVLAFV  362

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFISLYKAI++GG+FF
Sbjct  363  GFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFISLYKAITMGGAFF  422

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            LYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ K+
Sbjct  423  LYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKR  471



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WAV + +   LA+V
Sbjct  303  LVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEGARMTWAVVLCLFCVLAFV  362

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFISLYKAI++GG+FF
Sbjct  363  GFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFISLYKAITMGGAFF  422

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            LYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ K+
Sbjct  423  LYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKR  471



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 139/191 (73%), Gaps = 7/191 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA  + I M L YVA
Sbjct  345  LVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAAVLCITMVLLYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNS  145
            YAAIA V WVFFF ++PET G+TLE+ E LFG F +WR     +  KK         NN 
Sbjct  465  YAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNLSHGDGNTNNG  524

Query  144  QLQMGTLQAAN  112
            Q+Q+GT    N
Sbjct  525  QVQLGTKGQVN  535



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 139/191 (73%), Gaps = 7/191 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA  + I M L YVA
Sbjct  345  LVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAAVLCITMVLLYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK-------ANNNS  145
            YAAIA V WVFFF ++PET G+TLE+ E LFG F +WR     +  KK         NN 
Sbjct  465  YAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNLSHGDGNTNNG  524

Query  144  QLQMGTLQAAN  112
            Q+Q+GT    N
Sbjct  525  QVQLGTKGQVN  535



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LV+TF LD+ GRRPLLL+SVGGM+ +LA L   LT+ID SH  + WAVAM IA  L +VA
Sbjct  339  LVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHTTLKWAVAMCIASVLFFVA  398

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ MTF+SL KAI+IGG+FFL
Sbjct  399  FFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLVMTFLSLSKAITIGGAFFL  458

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            Y  I    WVFF+ LMPETQG+TLEE +  FG + +WRS  RE++ ++
Sbjct  459  YTGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTARELEMRR  506



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS+ GMV  L  LG SLT++D H   ++ WAV + +   LAYV
Sbjct  303  LVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTIVDQHEGVRMTWAVILCLCCVLAYV  362

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFISLYKAI++GG+FF
Sbjct  363  GFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFISLYKAITMGGTFF  422

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LYAAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ KK   +  +  GT
Sbjct  423  LYAAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKKRVAHGDI--GT  480

Query  126  LQAANK  109
                N+
Sbjct  481  SDPDNR  486



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +LA LG +LT+IDHSHEK+ WA+A+ IAM LA VA
Sbjct  347  LVATFLLDRIGRRPLLLSSVGGMIFSLATLGFALTIIDHSHEKLTWAIALCIAMVLANVA  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVY++EI PL+LRA G S+G  +NRVTSGV+S TFISLYK I+IGG+FFL
Sbjct  407  FFSIGLGPIAWVYTTEIIPLRLRAQGASMGAAVNRVTSGVISTTFISLYKGITIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS--RQREVDAKKANNNSQLQM  133
            +AAIAAV W FFFT +PETQG+TLE+ E LFG F +WRS  ++ E   K   +N Q Q+
Sbjct  467  FAAIAAVAWSFFFTCLPETQGRTLEDMEVLFGHFIKWRSALKKHEEGNKDGESNGQTQL  525



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRR LLL S GGMV +LA LG SLT+I+HS  K+ WA+A+ I M L++ A
Sbjct  345  LVATFLLDKSGRRALLLISTGGMVVSLATLGFSLTIINHSEAKLTWAIALCITMVLSFAA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             F+IG GPI  +Y+SEIFPLKLRA G SLG  +NRVTSG++SMTF+SLY+AI+IGG+FFL
Sbjct  405  FFAIGMGPIAGIYTSEIFPLKLRAQGISLGVAVNRVTSGIISMTFLSLYQAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  142
            +A IAAVGW+FF   +PET+GKTLEETE LFG    W    REVD K   +N++
Sbjct  465  FAGIAAVGWLFFNICLPETRGKTLEETERLFGNLVGW----REVDKKMKEDNTK  514



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG  LTVIDH  H ++PWA+ ++IA  LAYV
Sbjct  346  LVATFMLDRVGRRPLLLSSTGGMIVSLASLGFGLTVIDHHPHGQLPWAIGLSIASILAYV  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  406  AFFSIGLGPITWVYSSEIFPLRLRAQGASVGVVVNRVTSGVITMTFISLYKAITIGGSFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LYA +AAV WVFFFT + ET+GKTLEE E LFG
Sbjct  466  LYAGVAAVAWVFFFTYLKETRGKTLEEMENLFG  498



>gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata]
Length=509

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS--HEKVPWAVAMAIAMTLAY  490
            LVATF +D+ GRR LLLTS GG+  +L  L   LTVID +   +K+ WAVA+ +AM+L+ 
Sbjct  334  LVATFLVDRVGRRTLLLTSCGGLAASLFGLATGLTVIDQNDDEQKLTWAVALCVAMSLSS  393

Query  489  VAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSF  310
            VA FSIG GPI WVYSSEI+PL+LRA GCS+G   NR  SGVV MTFISLY+ I+IGG+F
Sbjct  394  VAFFSIGMGPIAWVYSSEIYPLRLRAQGCSMGVAANRFMSGVVLMTFISLYETITIGGAF  453

Query  309  FLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            FL+  IA V W+FF+TL+PET+G+TLEE E LFGTFF WRS  +E++ KK  NN+
Sbjct  454  FLFTGIAVVAWIFFYTLLPETKGRTLEEMEDLFGTFFNWRSTSKELNIKKEANNT  508



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYVA  484
            VATF LD+ GRRPL+LTS+ GMV +L  LG SLT++D H   ++ WAV + +   LA+V 
Sbjct  304  VATFFLDRVGRRPLVLTSMAGMVASLVCLGTSLTIVDQHEGARMTWAVVLCLCCVLAFVG  363

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SGV+SMTFISLYKAI++GG+FFL
Sbjct  364  FFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGVLSMTFISLYKAITMGGAFFL  423

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            YAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ ++
Sbjct  424  YAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKER  471



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +L  L +SLTV+DHSH +  WAV ++I   L+YVA
Sbjct  345  LVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSHVRKMWAVGLSIVSVLSYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++SMTF+SL   ISIGG+FFL
Sbjct  405  TFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISMTFLSLSDKISIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTF-FRWRSRQREVDAKKANNN  148
            +  IAA GW+FF+ L+PETQGKTLEE E  FG F  +  ++    + +  NNN
Sbjct  465  FGGIAACGWIFFYALLPETQGKTLEEMEGSFGKFGVKLSTKNDNGEIQFTNNN  517



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS+ GMV  L  LG SLT++D H   ++ WAV + +   LAYV
Sbjct  345  LVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTMVDQHEGVRMTWAVILCLCCVLAYV  404

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFISLYKAI++GG+FF
Sbjct  405  GFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFISLYKAITMGGTFF  464

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LYAAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   + ++ KK   +  +  GT
Sbjct  465  LYAAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKANKLLEKKKRVAHGDI--GT  522

Query  126  LQAANK  109
                N+
Sbjct  523  SDPDNR  528



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +L  L +SLT+ID S  K+ WA+ ++I M L YVA
Sbjct  339  LVATFMLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIDRSESKLMWAIGLSITMVLVYVA  398

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGV+SMTF+SL KAI+IGG+FFL
Sbjct  399  TFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVISMTFLSLTKAITIGGAFFL  458

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            Y  IA VGW+FFF ++PET+GKTLE+ E  FGTF   R++       +     Q+Q+GT
Sbjct  459  YCGIAVVGWLFFFIVLPETRGKTLEDMEGSFGTF---RAKSNNGVENENAKVPQVQLGT  514



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 136/177 (77%), Gaps = 1/177 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+ WAV + I+M L YVA
Sbjct  349  LVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKLMWAVVLCISMVLTYVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+F+SL KAI+ GG+FFL
Sbjct  409  SFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMSFLSLSKAITTGGAFFL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            +AAIA V W FF+T +PETQGKTLEE E LFG   R +S       +K N +  +Q+
Sbjct  469  FAAIAIVAWFFFYTALPETQGKTLEEMETLFG-HIRCKSAAASAGTEKDNGSGGVQL  524



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+ GRRPLLLTSVGGM+ +LA LG SLT+IDH+ +KV WA+ ++I   + YVA
Sbjct  348  LVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEKKVTWALVLSITTVMTYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+SMTF+ L KA++ GG+F+L
Sbjct  408  TFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVISMTFLLLSKAMTTGGAFYL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQREVDAKKANNNSQLQMG  130
            +  IA V WVFF+T +PETQG++LE+ + LF + FRWR S+ +  + K +++N Q+++G
Sbjct  468  FGGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKSKPKNNKNSSSNPQVEIG  525



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 140/181 (77%), Gaps = 5/181 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L ATFTLD+ GRRPLLL+SVGGMV +L  L +SLTVIDHS  K+ WAV  +IAM LAYVA
Sbjct  342  LAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKLMWAVGSSIAMVLAYVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMTF+SL +AI+IGG+FFL
Sbjct  402  TFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMTFLSLTRAITIGGAFFL  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN--SQLQMG  130
            Y  IA VGW+FF+T++PET+GKTLE+ E  FGTF   RS+     A +  N   +Q+Q+G
Sbjct  462  YCGIATVGWIFFYTVLPETRGKTLEDMEGSFGTF---RSKSNASKAVENENGQVAQVQLG  518

Query  129  T  127
            T
Sbjct  519  T  519



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 133/183 (73%), Gaps = 8/183 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWAVAMAIAMTLAYV  487
            LVATF +D+ GRRPLLLTSV GMV +L  L + LT+ID  H  K+ W  A+ + M LAY 
Sbjct  346  LVATFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDQHHGAKMTWTTALCLTMVLAYA  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FF
Sbjct  406  AFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVLSMTFISLYKAITMGGAFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK-------KANNN  148
             Y  IA V W+FF+T++PETQG+TLE+ E LFG F +W+    +++ +         NN 
Sbjct  466  FYGGIATVAWLFFYTMLPETQGRTLEDMEVLFGKFHKWKEANAQLETRAQVDHGGDGNNK  525

Query  147  SQL  139
            S +
Sbjct  526  SGM  528



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGMV +L  L +SLTV+DHS  +  WAV ++IA  L+YVA
Sbjct  341  LVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSRVRQMWAVGLSIASVLSYVA  400

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++SMTF+SL   ISIGG+FFL
Sbjct  401  TFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISMTFLSLSDKISIGGAFFL  460

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTF  202
            +  IAA GW+FF+TL+PETQGKTLEE E  FG F
Sbjct  461  FGGIAACGWIFFYTLLPETQGKTLEEMEGTFGKF  494



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 140/181 (77%), Gaps = 5/181 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L ATFTLD+ GRRPLLL+SVGGMV +L  L +SLTVIDHS  K+ WAV  +IAM LAYVA
Sbjct  342  LAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKLMWAVGSSIAMVLAYVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMTF+SL +AI+IGG+FFL
Sbjct  402  TFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMTFLSLTRAITIGGAFFL  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN--SQLQMG  130
            Y  IA VGW+FF+T++PET+GKTLE+ E  FGTF   RS+     A +  N   +Q+Q+G
Sbjct  462  YCGIATVGWIFFYTVLPETRGKTLEDMEGSFGTF---RSKSNASKAVENENGQVAQVQLG  518

Query  129  T  127
            T
Sbjct  519  T  519



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 138/186 (74%), Gaps = 6/186 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL S GGMV  LA LG+SLTVI HS +K  WAV + I M L+ VA
Sbjct  348  LVATFLLDKIGRRPLLLISSGGMVVILATLGLSLTVIGHSDKKQTWAVGLCITMVLSSVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYS+EIFPL+LRA G SLG  +NRV SGV+SM+FISLYKAI+IGG+FFL
Sbjct  408  VFSIGMGPITWVYSTEIFPLRLRAQGASLGVAVNRVMSGVISMSFISLYKAITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK--AN----NNSQ  142
            YA +A V + FFFT +PET+GKTLEE E LFG    WR   +++  K+  AN     N Q
Sbjct  468  YAGVALVAFFFFFTFLPETRGKTLEEMEGLFGKLVGWREEAKKMKRKRNEANGDGIGNDQ  527

Query  141  LQMGTL  124
            +Q+G +
Sbjct  528  IQLGKI  533



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 135/181 (75%), Gaps = 2/181 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK GRRPLLL S GGMV  LA LG SLT+I HS  K+ WAV + I M L+ VA
Sbjct  348  LVATFLLDKIGRRPLLLISSGGMVVILATLGFSLTIIGHSDNKITWAVGLCITMVLSSVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPI WVYS+EIFPL+LRA G S+G  +NRVTSGV+SM+FISLY+AI+IGG+FFL
Sbjct  408  VFSIGMGPIAWVYSTEIFPLRLRAQGASIGVAVNRVTSGVISMSFISLYEAITIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN--NSQLQMG  130
            YA +A V + FFFT +PETQGKTLEE E LFG    WR   +++  K+  N  N Q+Q+G
Sbjct  468  YAGVALVAFFFFFTFLPETQGKTLEEMEWLFGKLVGWREEAQKLKRKRKMNEANHQIQLG  527

Query  129  T  127
             
Sbjct  528  N  528



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 136/192 (71%), Gaps = 10/192 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVA F +D+ GRRPLLLTSV GMV +L  L + LT+ID H   K+ W  A+ + M LAY 
Sbjct  346  LVAMFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDRHQGAKMTWTTALCLTMVLAYA  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISLYKAI++GG+FF
Sbjct  406  AFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVLSMTFISLYKAITMGGAFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKANNNS  145
             YA IA V WVFF+T++PETQG+TLE+ E LFG F +W+        + +VD     NN 
Sbjct  466  FYAGIATVAWVFFYTMLPETQGRTLEDMEVLFGKFHKWKEVNALLETKTQVDHGGDGNN-  524

Query  144  QLQMGTLQAANK  109
              + G +Q   K
Sbjct  525  --RSGMIQLETK  534



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 141/191 (74%), Gaps = 7/191 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRRPLLL SV GM+ +L  LG+ LT+I  ++ ++ WA  + I M L YVA
Sbjct  345  LVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIGQNNGRIMWAAVLCITMVLLYVA  404

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISLYKAI+IGG+FFL
Sbjct  405  FFSIGMGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISLYKAITIGGAFFL  464

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR------SRQREVDAKKAN-NNS  145
            YAAIA+V WVFFF ++PET G+TLE+ E LFG F +WR       +++ V     N NN 
Sbjct  465  YAAIASVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANALLKQKKNVSHGDGNTNNG  524

Query  144  QLQMGTLQAAN  112
            Q+Q+GT    N
Sbjct  525  QVQLGTKGQVN  535



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 137/177 (77%), Gaps = 3/177 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  L +SLTVI+ S  ++ WA+ ++IA  L+YV+
Sbjct  339  LVATFLLDRVGRRPLLLTSVGGMVFSLLTLAVSLTVIERSRAELKWAIGLSIATVLSYVS  398

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL   I+IGG+FF+
Sbjct  399  TFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSNKITIGGAFFI  458

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            +  IA  GW+FFFT++PETQGKTLEETE  FG F  W   +     K  +N++++++
Sbjct  459  FGGIAMCGWIFFFTMLPETQGKTLEETEECFGKFGSWSHSKGN---KDTHNSAEIEL  512



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+ WAV + I+M L YVA
Sbjct  349  LVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKLMWAVVLCISMVLTYVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSE FPLKLRA G S+G  +NRVTSGV+SM+F+SL KAI+ GG+FFL
Sbjct  409  SFSIGMGPITWVYSSEXFPLKLRAQGTSMGVAVNRVTSGVISMSFLSLSKAITTGGAFFL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            +AAIA V W FF+T +PETQGKTLEE E LFG   R +S       +K N +  +Q+
Sbjct  469  FAAIAIVAWXFFYTALPETQGKTLEEMETLFG-HIRCKSAAASAGTEKDNGSGGVQL  524



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+ GRRPLLLTSVGGM+ +LA LG SLT+IDH+ +KV WA+ ++I   + YVA
Sbjct  348  LVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEKKVTWALVLSITTVMTYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+SMTF+ L +A++ GG+F+L
Sbjct  408  TFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVISMTFLLLSEAMTTGGAFYL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQREVDAKKANNNSQLQMG  130
            +  IA V WVFF+T +PETQG++LE+ + LF + FRWR S+ +  + K +++N Q+++G
Sbjct  468  FGGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKSKPKNNKNSSSNPQVEIG  525



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 9/184 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +KV WAV +AIA  + YVA
Sbjct  348  LVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAVVVAIATVMTYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SM F+ L K I+ GG+F+L
Sbjct  408  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMAFLPLSKGITTGGAFYL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKAN-----NNSQL  139
            +  IA V WVFF+T +PETQG+ LE+ + LF + FRWR  +   +  K+N     +N ++
Sbjct  468  FGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSK---NKPKSNPEMTVSNPEV  523

Query  138  QMGT  127
            ++G+
Sbjct  524  EIGS  527



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS   + WA+ + +  T + VA
Sbjct  344  LVATFFVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSDHTLKWAIVVCVCATYSTVA  403

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISLYKAISIGG+FFL
Sbjct  404  FFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMTFISLYKAISIGGAFFL  463

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKAN  154
            Y  IA V W+FF+TL+PET+G+TLEE E LFGTFF+WRS  +E+   +  
Sbjct  464  YTGIAIVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKELKRSRVE  513



>gb|KJB12317.1| hypothetical protein B456_002G011600 [Gossypium raimondii]
Length=486

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVAT  LDK GRR LLL+SVGGMV +LA +G SLT+ DHS  K+ WA+ + + M LA+V+
Sbjct  316  LVATLLLDKIGRRVLLLSSVGGMVVSLATIGFSLTIADHSETKLTWAIVLCMTMVLAFVS  375

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             F+IG GPIT VY SEIFPL+LRA G S+G  +NRV SG++SMTFISLYKAI+IGG+FFL
Sbjct  376  FFAIGMGPITNVYMSEIFPLRLRAQGVSMGVAVNRVVSGIISMTFISLYKAITIGGAFFL  435

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD  169
            +A IA VGWVFF+  MPET+GKTLEE E LFG    W+   ++++
Sbjct  436  FAGIATVGWVFFYVCMPETRGKTLEEMECLFGKLVGWKEASKKMN  480



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 141/187 (75%), Gaps = 7/187 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDHS +KV WAV +AIA  + YVA
Sbjct  349  LVATFLLDRIGRRPLLLTSVGGMVLSLMALGTSLTIIDHSEKKVMWAVVLAIATVMTYVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L
Sbjct  409  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKKMTTGGAFYL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMG  130
            +  IA V W+FF+T +PETQG+ LE+ E LF + FRWR  + +   + +K   N ++++ 
Sbjct  469  FGGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKNKPKGNPEKTIANPEVEI-  526

Query  129  TLQAANK  109
               A+NK
Sbjct  527  ---ASNK  530



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 140/181 (77%), Gaps = 3/181 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +KV WAV +AIA  + YVA
Sbjct  348  LVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAVVVAIATVMTYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S++F+ + KA++ GG+F+L
Sbjct  408  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPMSKAMTTGGAFYL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQMG  130
            +  IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + +   + +K   N ++++G
Sbjct  468  FGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKSKPKGNPEKTVPNPEVEIG  526

Query  129  T  127
            +
Sbjct  527  S  527



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA  + I M L YVA
Sbjct  296  LVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAAVLCITMVLLYVA  355

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFL
Sbjct  356  FFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFL  415

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS  187
            YAAIA V WVFFF ++PET G+TLE+ E LFG F RWR 
Sbjct  416  YAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHRWRK  454



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDHS +KV WAV +AIA  + YVA
Sbjct  349  LVATFLLDRIGRRPLLLTSVGGMVLSLLALGTSLTIIDHSEKKVMWAVVLAIATVMTYVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L
Sbjct  409  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKKMTTGGAFYL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQM  133
            +  IA V W+FF+T +PETQG+ LE+ E LF + FRWR  + +   + +K   N ++++
Sbjct  469  FGGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKNKPKGNPEKTIANPEVEI  526



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRR LLLTSVGG++ +L  L +SLT+ID+S   + WA++++IA  L+Y A
Sbjct  337  LVATFLLDRVGRRVLLLTSVGGLIISLLTLAISLTIIDNSSATLTWAISLSIAAVLSYAA  396

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG+GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTF+SL  AI+IGG+FFL
Sbjct  397  TFSIGSGPITWVYSSEIFPLRLRAQGVSIGAVVNRVTSGVISMTFLSLSNAITIGGAFFL  456

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  136
            +A IA V W+F +T++PETQGKTLEE E  FG F  WR  +    A+ AN   QL 
Sbjct  457  FAGIAIVAWIFHYTMLPETQGKTLEEIEGSFGNF--WRKPKASATAEGANGKIQLS  510



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA  + I M L YVA
Sbjct  296  LVATFLLDRVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAAVLCITMVLLYVA  355

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISLY+AI+IGG+FFL
Sbjct  356  FFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISLYEAITIGGAFFL  415

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS  187
            YAAIA V WVFFF ++PET G+TLE+ E LFG + RWR 
Sbjct  416  YAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKYHRWRE  454



>ref|XP_008812826.1| PREDICTED: polyol transporter 5-like, partial [Phoenix dactylifera]
Length=281

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  HEK+ WA AM+IA  L +V
Sbjct  100  LVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHEKLTWAAAMSIATVLTFV  159

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGV+SMTFISLYKAI+I GS+F
Sbjct  160  GSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTGTNRIVSGVISMTFISLYKAITIAGSYF  219

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALF  211
             YA IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  220  FYAGIAAAGWLFFYFFLPETRGRSLEDMEVLF  251



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDH+ +KV WAV +AIA  + YVA
Sbjct  349  LVATFLLDRIGRRPLLLTSVGGMVISLIALGTSLTIIDHTKKKVTWAVVLAIATVMTYVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L
Sbjct  409  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKKMTTGGAFYL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQM  133
            +  IA V W+FF+T +PETQG+ LE+ E LF   FRWR  + +   + +K   N ++++
Sbjct  469  FGGIATVAWLFFYTFLPETQGRMLEDMEELFNG-FRWRDSKNKPKGNPEKTIANPEVEI  526



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPWAVAMAIAMTLAY  490
            LVATFTLD FGRRPLLLTS GGMV +L  LG+ LTVI H  E   +PWAV + IA  L  
Sbjct  334  LVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPEGTTIPWAVGVCIASILGV  393

Query  489  VAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSF  310
            VA FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSF
Sbjct  394  VAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKGITIGGSF  453

Query  309  FLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG-TFFRWRSRQREVDAKKANNNSQL  139
            FLYA IA++ WVFFFT + ET+G+TLE+   LFG       S Q++   +K  NN ++
Sbjct  454  FLYAGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDSYQQQQSPEKERNNVEM  511



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 131/178 (74%), Gaps = 3/178 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPWAVAMAIAMTLAY  490
            LVATFTLD FGRRPLLLTS GGMV +L  LG+ LTVI H  E   +PWAV + IA  L  
Sbjct  346  LVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPEGTTIPWAVGVCIASILGV  405

Query  489  VAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSF  310
            VA FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSF
Sbjct  406  VAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKGITIGGSF  465

Query  309  FLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG-TFFRWRSRQREVDAKKANNNSQL  139
            FLYA IA++ WVFFFT + ET+G+TLE+   LFG       S Q++   +K  NN ++
Sbjct  466  FLYAGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDSYQQQQSPEKERNNVEM  523



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+SVGGMV +L  LGMSLTV+DH+  +KV WAV ++I   + YV
Sbjct  346  LVATFFLDRIGRRPLLLSSVGGMVLSLLTLGMSLTVVDHTVDKKVMWAVVLSITTVMTYV  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTF+SL KAI+ GG+FF
Sbjct  406  ATFSIGAGPITWVYSSEIFPLRLRAQGASMGVIVNRVTSGVISMTFLSLSKAITTGGAFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  175
            L+  IA V WVFF+T +PETQGK LEE + LF   F WR  + +
Sbjct  466  LFGGIATVAWVFFYTFLPETQGKMLEEMDELFEK-FNWRDSKSK  508



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +LA+LG SLTVID S +KV WAV ++IA  + YVA
Sbjct  354  LVATFLLDRVGRRPLLLTSVGGMVISLAVLGTSLTVIDQSDKKVMWAVVLSIATVMTYVA  413

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L
Sbjct  414  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKGMTTGGAFYL  473

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS  187
            +  IA V WVFF+T +PETQG+ LE+ + LF + FRWR 
Sbjct  474  FGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRD  511



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 131/181 (72%), Gaps = 2/181 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPWAVAMAIAMTLAY  490
            LVATFTLD+FGRRPLLLTS GGMV +L  LG  LTVI H  E   +PWA+ + IA  L  
Sbjct  345  LVATFTLDRFGRRPLLLTSTGGMVVSLVGLGFGLTVIGHHPEGTTIPWAIGVCIASILGV  404

Query  489  VAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSF  310
            VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSF
Sbjct  405  VAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGVNRVTSGVISMTFLSLSKGITIGGSF  464

Query  309  FLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  130
            FLYA +A + WVFFFT +PET+G+TLE+   LFG         ++   K+    S ++M 
Sbjct  465  FLYAGVATLAWVFFFTYLPETRGRTLEQMGDLFGIPNMAGDSDQQSPEKEKTTLSNVEMS  524

Query  129  T  127
            +
Sbjct  525  S  525



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LV TF +D+ GRR LLLTS GG+V ++  L   LTVIDH   ++ PW V + +  T + V
Sbjct  344  LVTTFMVDRIGRRVLLLTSCGGLVLSMLTLATGLTVIDHYGADRFPWVVVLCVLTTYSSV  403

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS+G GPI WVYSSEIFPLKLRA GC LG  INR T+GV+ M+FISLY AI+IGG+F+
Sbjct  404  AFFSMGMGPIAWVYSSEIFPLKLRAQGCGLGVAINRATNGVILMSFISLYNAITIGGAFY  463

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  151
            L++ I  V W+FFFTL+PET+G+TLE+ E LFGTFF+WR+  RE+  K+A +
Sbjct  464  LFSGIGIVTWIFFFTLLPETRGRTLEDMEVLFGTFFKWRTTMRELHKKEAED  515



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +LA+LG SLTVI+ S +KV WAV ++IA  + YVA
Sbjct  354  LVATFLLDRVGRRPLLLTSVGGMVLSLAVLGTSLTVINQSDKKVMWAVVLSIATVMTYVA  413

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ + K ++ GG+F+L
Sbjct  414  TFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPMSKGMTTGGAFYL  473

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  130
            +  IA V WVFF+T + ETQG+ LE+ + LF + FRWR  +     K + +N+++++G
Sbjct  474  FGGIATVAWVFFYTFLRETQGRMLEDMDELF-SGFRWRDSKN----KNSGSNTEVEIG  526



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 11/188 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK+GRRPLLLTSVGGM+  +  L MSLTVIDHSH K+ WA+A+ I M  A VA
Sbjct  350  LVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSHHKITWAIALCITMVCAVVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSE+FPL+LRA G S+G  +NRV SGV+S+ F+ L   I+ GG+FFL
Sbjct  410  SFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVISIFFLPLSHKITTGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-------SRQREVDAKK---AN  154
            +  IA + W FF T +PET+G+TLE    LF   FRWR       S   E   +K    N
Sbjct  470  FGGIAIIAWFFFLTFLPETRGRTLENMHELFED-FRWRESFPGNKSNNDENSTRKQSNGN  528

Query  153  NNSQLQMG  130
            + SQ+Q+G
Sbjct  529  DKSQVQLG  536



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 144/186 (77%), Gaps = 11/186 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS  GM+ +LA LG+ LT  +H  +  +PWAV ++IA  LAYV
Sbjct  340  LVATFLLDRVGRRPLLLTSFAGMILSLAGLGLGLTAAEHHTDGHLPWAVGLSIACVLAYV  399

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAIS+GGSFF
Sbjct  400  AFFSIGAGPITWVYSSEIFPLRLRAVGASIGVAVNRVTSGVITMTFISLYKAISLGGSFF  459

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LY  IAAV WVFFFT +PET+G+TLE+ E LFG       +++EVD K+    ++++M  
Sbjct  460  LYGGIAAVAWVFFFTYLPETRGRTLEDMEELFG-------KEKEVD-KQTKEENRVEM--  509

Query  126  LQAANK  109
            + A+N+
Sbjct  510  VNASNR  515



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 11/188 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LDK+GRRPLLLTSVGGM+  +  L MSLTVIDHSH K+ WA+A+ I M  A VA
Sbjct  350  LVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSHHKITWAIALCITMVCAVVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSE+FPL+LRA G S+G  +NRV SGV+S+ F+ L   I+ GG+FFL
Sbjct  410  SFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVISIFFLPLSHKITTGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-------SRQREVDAKK---AN  154
            +  IA + W FF T +PET+G+TLE    LF   FRWR       S   E   +K    N
Sbjct  470  FGGIAIIAWFFFLTFLPETRGRTLENMHELFED-FRWRESFPGNKSNNDENSTRKQSNGN  528

Query  153  NNSQLQMG  130
            + SQ+Q+G
Sbjct  529  DKSQVQLG  536



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA+ ++IA TLAYV
Sbjct  334  LVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWAIGLSIASTLAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+SL KAI+IGGSFF
Sbjct  394  AFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLSLSKAITIGGSFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAA+ WVFF+T +PET+G+TLEE   LFG
Sbjct  454  LYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG  486



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA+ ++IA TLAYV
Sbjct  334  LVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWAIGLSIASTLAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+SL KAI+IGGSFF
Sbjct  394  AFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLSLSKAITIGGSFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAA+ WVFF+T +PET+G+TLEE   LFG
Sbjct  454  LYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG  486



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTSV G + +L  LG  LTVI  + E K+ WAV + IAM L  V
Sbjct  335  LVATFLLDRVGRRPLLLTSVAGKMVSLVTLGFGLTVIQQNEEVKLRWAVGLCIAMVLCDV  394

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FF
Sbjct  395  AFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFF  454

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LYA IAA+ W+FF+ + PETQGKTLE+ E LFG+     S+  ++D        QLQ+ T
Sbjct  455  LYAGIAAISWLFFYVVFPETQGKTLEDMEGLFGSLLWKFSKDGKIDKNDVGVTRQLQLHT  514



>ref|XP_004148312.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=492

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H   K+ WAV + IAM L  V
Sbjct  311  LVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDVKLTWAVGLCIAMVLCDV  370

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FF
Sbjct  371  AFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFF  430

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LYA IAA+  VFF+ + PETQGKTLE+ E LFG      S+ R        + +QLQ+ T
Sbjct  431  LYAGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKHRHFHKNDVGDVAQLQLHT  490



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPWAVAMAIAMTLAY  490
            LVATFTLD+FGRRPLLL S GGMV +L  LG  LTVI H  E   +PWA+ + IA  L  
Sbjct  345  LVATFTLDRFGRRPLLLASTGGMVVSLVGLGFGLTVIGHHQEGTTIPWAIGVCIASILGV  404

Query  489  VAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSF  310
            VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL K I+IGGSF
Sbjct  405  VAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKGITIGGSF  464

Query  309  FLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            FLYA IA++ WVFFFT +PET+G+TLE+   LFG
Sbjct  465  FLYAGIASLAWVFFFTYLPETRGRTLEQMGGLFG  498



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 130/176 (74%), Gaps = 4/176 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA+ ++IA TLAYV
Sbjct  334  LVATFFLDRIGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWAIGLSIASTLAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+SMTF+SL  AI+IGGSFF
Sbjct  394  AFFSIGLGPITWVYSSEIFPLQVRALGCALGVASNRVTSGVISMTFLSLSNAITIGGSFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  139
            LYA IAA+ WVFF+T +PET+G+TLEE   LFG      +R    D  K     ++
Sbjct  454  LYAGIAALAWVFFYTYLPETRGRTLEEMSKLFGA---TDARPEADDTAKEKQKVEM  506



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA+ ++IA TLAYV
Sbjct  401  LVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWAIGLSIASTLAYV  460

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+SL KAI+IGGSFF
Sbjct  461  AFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLSLSKAITIGGSFF  520

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            LY+ IAA+ WVFF+T +PET+G+TLEE   LFG              KK
Sbjct  521  LYSGIAALAWVFFYTYLPETRGRTLEEMSKLFGDTAAASESDEPAKEKK  569



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+S GGM+ +L  L +SLTVI  S +K  W + +++ M L+YVA
Sbjct  337  LVATFMLDRLGRRPLLLSSFGGMLLSLLTLAVSLTVIHESKKKPIWVIGLSMVMVLSYVA  396

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIGAGP+TWVYSSEIFPL+LRA G ++G  +NR TSGV+S+TF+SL KAI+IGG+FFL
Sbjct  397  SFSIGAGPVTWVYSSEIFPLRLRAQGMAVGVVVNRTTSGVLSITFLSLSKAITIGGAFFL  456

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTL  124
            Y+AIAA GW+F +T++PET+GKTLEE +  FG F+   +  + V+ + A    QLQ GT+
Sbjct  457  YSAIAAFGWLFIYTVLPETRGKTLEEMDTSFGKFWVKSTTTKPVNNRHA-QVPQLQQGTI  515

Query  123  Q  121
             
Sbjct  516  H  516



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            L++T  LD+ GRR LL+ S  G+V +L  L + LTVIDH   +K+ WA+ ++   TL+ V
Sbjct  344  LISTCYLDRVGRRVLLIASSAGLVASLWGLAIGLTVIDHYPGQKLTWAIGISFFCTLSSV  403

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS G GPI WVYSSEIFPLKLRA G S+   INRVTSG++ MTFISLYKAI+IGGSFF
Sbjct  404  ATFSSGMGPIAWVYSSEIFPLKLRAQGNSIAVAINRVTSGIILMTFISLYKAITIGGSFF  463

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  142
             Y AIA  G++FF TL+PET+G++LEETE LFGTFFRWRSR REV+++K  N   
Sbjct  464  FYGAIAFAGFLFFCTLLPETKGRSLEETEELFGTFFRWRSRAREVESRKWENEKN  518



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L++TF LDK GRRPL+LTS+GGMV  L +L  SLTVI+ SH    WA  +AI    A+V+
Sbjct  335  LISTFQLDKIGRRPLMLTSMGGMVIALFVLAGSLTVINKSHHTGHWAGGLAIFTVYAFVS  394

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MTFIS+YKA++IGG+F L
Sbjct  395  IFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGMSGIIGMTFISMYKAMTIGGAFLL  454

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  157
            +A +A++GWVF +T+ PETQG+ LEE E LFG++F WR   +++ AK+A
Sbjct  455  FAVVASIGWVFMYTMFPETQGRNLEEIELLFGSYFGWRKTLKDLKAKEA  503



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H   K+ WAV + IAM L  V
Sbjct  335  LVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDVKLTWAVGLCIAMVLCDV  394

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FF
Sbjct  395  AFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFF  454

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LYA IAA+  VFF+ + PETQGKTLE+ E LFG      S+ R        + +QLQ+ T
Sbjct  455  LYAGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKHRHFHKNDVGDVAQLQLHT  514



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H   K+ WAV + IAM L  V
Sbjct  335  LVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDVKLTWAVGLCIAMVLCDV  394

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+SL KAI+IGG+FF
Sbjct  395  AFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLSLTKAITIGGAFF  454

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LYA IAA+  VFF+ + PETQGKTLE+ E LFG      S+ R        + +QLQ+ T
Sbjct  455  LYAGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKHRHFHKNDVGDVAQLQLHT  514



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATFTLD+FGRRPLLLTSVGGMV +LA LG SLT+ID + +KV WAV ++I   + YVA
Sbjct  348  LVATFTLDRFGRRPLLLTSVGGMVLSLAALGTSLTIIDQTEKKVMWAVVLSITTVMTYVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVY+SEIFPL+LR+ G S+G  +NRVTSGV+S+ FI L + I+ GG+F+L
Sbjct  408  TFSIGAGPITWVYTSEIFPLRLRSQGSSMGVVVNRVTSGVISIGFIPLSEGITTGGAFYL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS  187
            +  +A V W+FF+T +PET+G+TLE+   LFG  FRWR 
Sbjct  468  FCGVATVAWIFFYTFLPETRGRTLEDMGELFGN-FRWRD  505



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 132/179 (74%), Gaps = 3/179 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  L   LTV+  H  E++PWA+A+ I   LAYV
Sbjct  334  LVATFLLDRVGRRPLLLSSTGGMIVSLVGLAAGLTVVSRHPDEQIPWAIALCILCILAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL +RA GCSLG   NR+TSGV+SMTFISL KAI+IGG+FF
Sbjct  394  AFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAANRLTSGVISMTFISLSKAITIGGAFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  130
            L+A IA++ WVFFFT +PET+G+TLE+  ALFG       +Q+  +        +++MG
Sbjct  454  LFAGIASLAWVFFFTYLPETRGRTLEDMSALFGN--TATHKQQGSNGADDGKEKKVEMG  510



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+SVGGM+ +L  L   LTVI+H  + K+PWA+ +AIA T+AYV
Sbjct  334  LVATFLLDRVGRRPLLLSSVGGMIISLVGLAAGLTVIEHHPDGKIPWAIGVAIASTMAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSE+FPL +RA GC+LG   NRVTSGV+SMTFISL KAI+IGG+FF
Sbjct  394  AFFSIGMGPITWVYSSEVFPLHVRALGCALGVASNRVTSGVISMTFISLTKAITIGGAFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LYA +A + WVFFFT +PET+G+TLE    LFG
Sbjct  454  LYAGVAVLAWVFFFTFLPETRGRTLEAMHKLFG  486



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            L+ TF +D+FGRRPLLLTS  G+  ++  LG SLT+ID + +  +   +  A+ +T+A V
Sbjct  354  LITTFFVDRFGRRPLLLTSCAGVALSMFALGTSLTIIDRNPDGNIKGLLIFAVILTMAIV  413

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS+G GPI WVYSSEIFPLKLRA GCS+G  +NR  SGV+ M+FISLYKAI+IGG+FF
Sbjct  414  GFFSMGLGPIAWVYSSEIFPLKLRAQGCSMGVAMNRFMSGVILMSFISLYKAITIGGAFF  473

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            L+  I  V ++FF+TL PETQG+TLEE E LFGTFF WR+R +E+DAKK   + 
Sbjct  474  LFGGITTVAFIFFYTLFPETQGRTLEEMEELFGTFFSWRTRMKELDAKKKTGSE  527



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L++TF LDK GRRPL+L+S+GGMV  L +L  SL+VI+HSH+ VPWAVA+AI     +V+
Sbjct  346  LISTFLLDKVGRRPLMLSSMGGMVIALLVLSGSLSVINHSHQTVPWAVALAIISVYGFVS  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MTFIS+YKA++IGG+FF+
Sbjct  406  VFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGVSGIIGMTFISMYKALTIGGAFFV  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKA  157
            +A +AA+GWVF FT+ PETQG+ LEE E LFG++F WR   +++  K+A
Sbjct  466  FAVVAAIGWVFMFTMFPETQGRNLEEIEVLFGSYFGWRKTLKDLKKKEA  514



>ref|NP_001045505.2| Os01g0966900 [Oryza sativa Japonica Group]
 dbj|BAD88259.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ14958.1| hypothetical protein OsJ_04892 [Oryza sativa Japonica Group]
 dbj|BAF07419.2| Os01g0966900 [Oryza sativa Japonica Group]
Length=479

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATFTLD+FGRRPLLL S GGM+ TL  LG+ LTVI        WA+A++IA  LA+VA
Sbjct  281  LVATFTLDRFGRRPLLLASAGGMIATLVTLGLGLTVIGEDATGGGWAIAVSIASILAFVA  340

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL KAI+IGGSFFL
Sbjct  341  FFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSLSKAITIGGSFFL  400

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALF  211
            YA +A++ W+FFFT +PET+G+TLE+   LF
Sbjct  401  YAGVASLAWLFFFTYLPETRGRTLEQMGELF  431



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 0/173 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+ID S  KV WAV ++IA  L+YVA
Sbjct  344  LVATFMLDRIGRRPLLLTSVGGMVLSLLTLGTSLTIIDRSDTKVTWAVGLSIATVLSYVA  403

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+SMTF+SL K I+IGG+FFL
Sbjct  404  TFSIGAGPITWVYSSEIFPLRLRAQGCAMGVVVNRVTSGVISMTFLSLSKGITIGGAFFL  463

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            +  IA  GW+FF+T++PET+GKTLE+ E  FG         + V   K N+ +
Sbjct  464  FGGIAICGWIFFYTMLPETRGKTLEDMEGSFGQSKSKIKGNKGVGNGKDNDQA  516



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 5/175 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLLTSVGGMV +L  LG+SLTVIDHS   + WA+ ++I M L+YV+
Sbjct  338  LVATFLLDRVGRRPLLLTSVGGMVFSLLTLGLSLTVIDHSRAVLKWAIGLSIGMVLSYVS  397

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL   I+IGG+FFL
Sbjct  398  TFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSLSNKITIGGAFFL  457

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  139
            +  IA  GW+FF+T++PETQGKTLEE E  FG F  W S+ ++ D    N + QL
Sbjct  458  FGGIAMCGWIFFYTMLPETQGKTLEEMEGSFGKFASW-SKGKDGD----NGDIQL  507



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVP-WAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+IDH  EK   W + ++I+M + YV
Sbjct  348  LVATFLLDRVGRRPLLLTSVGGMVLSLATLGTSLTIIDHQTEKKAMWVLVLSISMVMTYV  407

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIGAGPITWVYSSEIFPL+LR+ G S    +NRVTSGV+SM F+ L + I+ GG+F+
Sbjct  408  ATFSIGAGPITWVYSSEIFPLRLRSQGSSFAVVVNRVTSGVISMGFLPLTEGITTGGAFY  467

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  130
            L+  IA V W FF+T +PETQG+ LE+ + LF + FRWR  + +   + +++N ++++G
Sbjct  468  LFCGIATVAWFFFYTFLPETQGRMLEDMDELF-SGFRWRDSKSKPKNRSSSSNPEVEIG  525



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+SVGGM+ +L  L   LTVI H   EK+PWA+ +AIA T+AYV
Sbjct  334  LVATFLLDRVGRRPLLLSSVGGMIFSLVGLAAGLTVIGHYQDEKIPWAIGVAIASTMAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSE+FPL +RA GC+LG   NR+TSGV+SMTFISL KAI+IGG+FF
Sbjct  394  AFFSIGLGPITWVYSSEVFPLHVRAMGCALGVASNRLTSGVISMTFISLSKAITIGGAFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LYA +A + WVFFFT +PET+G+TLE    LFG
Sbjct  454  LYAGVAVLAWVFFFTFLPETRGRTLEAMSKLFG  486



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LDK GRRPLLL+SVGGM+ +L  L   LTVI H  + K+PWA+A++IA T+AYV
Sbjct  334  LVATFLLDKVGRRPLLLSSVGGMIFSLVGLATGLTVIGHYPDAKIPWAIAVSIASTMAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+SMTFISL  AI+IGG+FF
Sbjct  394  AFFSIGLGPITWVYSSEIFPLQVRAMGCALGVATNRVTSGVISMTFISLSNAITIGGAFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY  IA + WVFFF+ +PET+G+TLE    LFG
Sbjct  454  LYGGIAVLAWVFFFSFLPETRGRTLESMSKLFG  486



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGMV +L +L   L+VI+H  HEK+ WA AM+IA  L +V
Sbjct  324  LVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPHEKLTWAAAMSIATVLTFV  383

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGVV+MTFISLYKAI+I GSFF
Sbjct  384  GSFSIGLGPIAWVYTSEIFPLRLRAQGVSLGTGTNRILSGVVTMTFISLYKAITIAGSFF  443

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALF  211
            LYA IAA GW+FF+  +PET+G++LE+  ALF
Sbjct  444  LYAGIAAAGWLFFYFFLPETRGRSLEDMGALF  475



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  HEK+ WA AM+IA  L +V
Sbjct  345  LVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHEKLTWAAAMSIASVLTFV  404

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV++MTFISLYK I+I GSFF
Sbjct  405  GSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVITMTFISLYKTITIAGSFF  464

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALF  211
            LYA IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  465  LYAGIAAAGWIFFYFFLPETRGRSLEDMEVLF  496



>ref|NP_001049270.1| Os03g0197200 [Oryza sativa Japonica Group]
 dbj|BAF11184.1| Os03g0197200, partial [Oryza sativa Japonica Group]
Length=295

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-VAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A V ++IAM L +V
Sbjct  115  LVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRPEGQATALVGLSIAMVLVFV  174

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+
Sbjct  175  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFY  234

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ--REVDAKKANNNSQL  139
            LYA IAA GWVF F  +PETQG++LE+T  LFG   R  +    RE D    N +++L
Sbjct  235  LYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFGGDERDANGTVGRE-DGHGQNKSTEL  291



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  HEK+ WA AM+I+  L +V
Sbjct  345  LVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHEKLTWAAAMSISTVLTFV  404

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV+SMTFISLYK I+I GS+F
Sbjct  405  GSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVISMTFISLYKTITIAGSYF  464

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
             YA IAA GW+FF+  +PET+G++LE+ E LFG
Sbjct  465  FYAGIAAAGWLFFYFFLPETRGRSLEDMEVLFG  497



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 2/178 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGM+ +L  L   LTV+  H  EK+ WA+ + I   +AYV
Sbjct  366  LVATFLLDRIGRRPLLLTSTGGMIVSLVGLATGLTVVSRHPDEKITWAIVLCIFCIMAYV  425

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFISL KA++IGG+FF
Sbjct  426  AFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFISLSKAMTIGGAFF  485

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            L+A IA+  WVFFF  +PET+G+TLE+  +LFG+    +    E D   A  + +++M
Sbjct  486  LFAGIASFAWVFFFAYLPETRGRTLEDMSSLFGSTATRKQGATEAD-DDAGKDKKVEM  542



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGMV +L +L   L+VI+H  HEK+ WA AM+IA  L +V
Sbjct  345  LVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPHEKLTWAAAMSIATVLTFV  404

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGVV+MTFISLYKAI+I GSFF
Sbjct  405  GSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRILSGVVTMTFISLYKAITIAGSFF  464

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALF  211
            LY+ IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  465  LYSGIAAAGWLFFYFFLPETRGRSLEDMEVLF  496



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEK-VPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+I  S EK V WAV +AI   + YV
Sbjct  347  LVATFLLDRIGRRPLLLTSVGGMVLSLMGLGTSLTIIGQSGEKKVMWAVVVAITTVMTYV  406

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIGAGPITWVYSSEIFPL+LR+ G SLG  +NRVTSGV+SMTF+ +   ++ GG+F+
Sbjct  407  ATFSIGAGPITWVYSSEIFPLRLRSQGSSLGVVVNRVTSGVISMTFLPMSDGMTTGGAFY  466

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV--DAKKANNNSQLQM  133
            L+  IA V WVFF+T +PETQGK LE+ + LF + FRWR  + +   + +K   N ++++
Sbjct  467  LFGGIATVAWVFFYTFLPETQGKMLEDMDELF-SGFRWRDSKNKPKGNPEKTIPNPEVEI  525

Query  132  GTLQAANK  109
                A+NK
Sbjct  526  ----ASNK  529



>ref|XP_008795662.1| PREDICTED: probable polyol transporter 6 [Phoenix dactylifera]
Length=480

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 135/182 (74%), Gaps = 9/182 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+ATF LD+ GRRPLLLTS+GGM+ +L+ LG+ LT+++H+ E++ WA++++I     +VA
Sbjct  303  LIATFLLDRVGRRPLLLTSLGGMIVSLSGLGLGLTMVEHTEERLVWAISLSILTVFFFVA  362

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPITWVYSSEIFPLKLRA G S+G  +NRV +G +SMTFISLYKAI+IGG+FF+
Sbjct  363  SFSIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRVMNGTISMTFISLYKAITIGGAFFM  422

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTL  124
            +A I+ + W+FFF L PET+G+ LEE E +F    +W          +  N  + +MG +
Sbjct  423  FAGISILAWMFFFFLCPETKGRPLEEMEEVFSK--KWLY-------SRPVNRERFEMGKV  473

Query  123  QA  118
            +A
Sbjct  474  EA  475



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  L   LTVI  H  EK+ WA+ + I   +AYV
Sbjct  344  LVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPDEKITWAIVLCIFCIMAYV  403

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFISL KA++IGG+FF
Sbjct  404  AFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFISLSKAMTIGGAFF  463

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            L+A IA+  WVFFF  +PET+G+TLE+  +LFG     +    E D   A    +++M
Sbjct  464  LFAGIASFAWVFFFAYLPETRGRTLEDMSSLFGNTATHKQGAAEAD-DDAGKEKKVEM  520



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT++DH  +  +PWA+ + IA  LAYV
Sbjct  346  LVATFLLDRVGRRPLLLSSTGGMILSLAGLGLGLTIVDHHPNGHLPWALGLCIASILAYV  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEIFPL+LRA G S G  +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  406  AFFSIGLGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGVITMTFISLYKAITIGGSFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  205
            LYA +AA  WVFFFT + ET+GKTLEE E LFG 
Sbjct  466  LYAGVAAAAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LVATF +D+ GRRPLLL S GGMV +L +L  +L +I H  HEK+ WA A++I+  L +V
Sbjct  342  LVATFLVDRVGRRPLLLCSAGGMVISLVILASNLCIIQHHPHEKLTWAAAISISTVLTFV  401

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVY+SEIFPL+LRA G SLGT  NRV SGV++MTFISLYKAI+I GSFF
Sbjct  402  GSFSIGLGPIAWVYTSEIFPLRLRAQGVSLGTATNRVMSGVITMTFISLYKAITIAGSFF  461

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALF  211
            LYA IAAVGW+FF+  +PET+G++LEE E +F
Sbjct  462  LYAGIAAVGWLFFYFFLPETRGRSLEEMEVIF  493



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 134/186 (72%), Gaps = 9/186 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA+ +++A  + YV
Sbjct  339  LVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWALGLSLATAITYV  398

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FF
Sbjct  399  ATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFF  458

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            L+  +A   W+FF+T +PET+GK LEE + LF   FRWR         K   + +++M T
Sbjct  459  LFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWR-------GSKTKEHMEVEMTT  510

Query  126  LQAANK  109
             ++  K
Sbjct  511  ERSPEK  516



>ref|XP_011088761.1| PREDICTED: putative polyol transporter 1 [Sesamum indicum]
Length=336

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  603  GGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPL  424
            GG    L  L   LT + +S  ++ WAVA+ +   L YV+ F+IG GP+TWVYSSEIFPL
Sbjct  170  GGCCVCLMGLATGLTFVQNSDHRLIWAVALCVCSILCYVSIFAIGMGPLTWVYSSEIFPL  229

Query  423  KLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQ  244
            ++RA GC L   +NRVTS V++MTFISLYKAI+IGG+FFLYA  AA+ W+FF+TL PET+
Sbjct  230  RVRAQGCGLAVAVNRVTSAVLTMTFISLYKAITIGGAFFLYAGFAALAWLFFYTLFPETR  289

Query  243  GKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            GKTLEE EALFGTFF+WRS  R ++ K  + + Q+Q G 
Sbjct  290  GKTLEEIEALFGTFFKWRSTMRALNQKSGDVSGQVQTGN  328



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVAT  LD+ GRRPLLLT   GM+ +LA LG  LTV+D H +E++ WA+ + IA  L YV
Sbjct  340  LVATVLLDRVGRRPLLLTGTAGMILSLASLGFGLTVVDRHPNERLEWAIVVCIASILIYV  399

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVY+SE+FPL+LRA G ++G  +NR TSGV++MTFISLYKAI+IGG+FF
Sbjct  400  AFFSIGLGPITWVYTSEVFPLRLRAQGAAIGVAVNRTTSGVLTMTFISLYKAITIGGAFF  459

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            LY  +A + W+FFFT +PET+GKTLEE E  FG   +  + +++    + ++ S ++ G 
Sbjct  460  LYGGVALIAWIFFFTYLPETRGKTLEEMEEFFGVRGKDLTDRKQGAGVELSSASGVESGD  519

Query  126  LQ  121
            ++
Sbjct  520  VK  521



>ref|NP_001168177.1| uncharacterized protein LOC100381931 [Zea mays]
 gb|ACN27335.1| unknown [Zea mays]
 tpg|DAA63326.1| TPA: hypothetical protein ZEAMMB73_286001 [Zea mays]
Length=510

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  LG +LTV+ H  + K+P  VA+ IA TLA+V
Sbjct  334  LVATFLLDRVGRRPLLLTSTGGMVISLISLGTALTVVGHHPDAKIPSVVALCIASTLAFV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY+SEIFPL+LRA G ++G   NRVTS V+SMTF+SL KAI+IGGSFF
Sbjct  394  AFFSIGLGPITGVYNSEIFPLQLRALGFAVGVACNRVTSAVISMTFLSLSKAITIGGSFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAAVGWVFFFT +PET+G+TLEE   LFG
Sbjct  454  LYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  486



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRR LLL SV G++ +L  LG+ LTV+ HS   + WA+ ++IA  LAY +
Sbjct  313  LVATFLLDRAGRRVLLLCSVSGLILSLVTLGVCLTVVGHSGSTLTWAIGLSIAAVLAYAS  372

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL KAI+ GG+FFL
Sbjct  373  TFSIGSGPITWVYSSEIFPLRLRAQGVAIGAVVNRVTSGVISMTFLSLCKAITTGGAFFL  432

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  136
            +A +A   W+F +T++PET+GKTLEE E  FG F  WR+ + +     AN ++QL+
Sbjct  433  FAGVAVAAWIFHYTMLPETRGKTLEEIEGSFGNF--WRNPKPK-GLHCANGDAQLR  485



>ref|NP_001141158.1| hypothetical protein [Zea mays]
 gb|ACF85577.1| unknown [Zea mays]
 tpg|DAA41235.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=473

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 128/172 (74%), Gaps = 9/172 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + K+P AVA+ IA TLAYV
Sbjct  293  LVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDAKIPSAVALCIASTLAYV  352

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL K I+IGGSFF
Sbjct  353  AFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVISMTFLSLSKGITIGGSFF  412

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  151
            LY+ IAAVGWVFFFT +PET+G+TLEE   LFG          + D  +A+N
Sbjct  413  LYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG--------MPDTDMAEAHN  456



>emb|CAR82417.1| polyol transporter [Plantago major]
Length=348

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            L+ TF +D+FGRR LLL S  G+  ++  LG  LT+ID + + K    + + + +T+  V
Sbjct  173  LITTFYVDRFGRRFLLLVSCAGVALSMFALGTVLTIIDRNPDAKQTGVLVLVVLLTMVIV  232

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS+G GPI WVYSSEIFPLKLRA GC LG  +NR  SGV+ M+FISLYK I+IGGSFF
Sbjct  233  GFFSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVILMSFISLYKEITIGGSFF  292

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            L+  I  +GW+FFFTL PET+G+TLEE E LFGTFF+WR+  +E+DAKK +   
Sbjct  293  LFGGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTMKELDAKKRSGTD  346



>ref|XP_002460924.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
 gb|EER97445.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
Length=510

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 9/174 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGM+  L  LG  LTV+ H  + K+P AVA+ IA TLAYV
Sbjct  334  LVATFLLDRVGRRPLLLTSAGGMIVALIGLGTGLTVVGHHPDAKIPSAVALCIASTLAYV  393

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL K I+IGGSFF
Sbjct  394  AFFSIGLGPITGVYNSEIFPLQVRALGFAVGMACNRVTSAVISMTFLSLSKGITIGGSFF  453

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
            LY+ IAAVGWVFFFT +PET+G+TLEE   LFG          ++D  +A++ +
Sbjct  454  LYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG--------MPDIDMAQADDTA  499



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA+ +++A  + YV
Sbjct  339  LVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWALGLSLATAITYV  398

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FF
Sbjct  399  ATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFF  458

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQRE  175
            L+  +A   W+FF+T +PET+GK LEE + LF   FRWR S+ +E
Sbjct  459  LFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSKTKE  502



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF +D+ GRRP+LL+SVGGMV +  +LG+  T+I+ S  K  WA+ ++I M L +VA
Sbjct  339  LVATFMMDRVGRRPMLLSSVGGMVVSFLILGIVFTIIEQSESKPMWAIGLSITMVLVFVA  398

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIGAGPITWVYS+EIFPL+LRA G + G  +NR+TSGV++MTF+SL KAI++GG+FFL
Sbjct  399  TFSIGAGPITWVYSAEIFPLRLRAQGVAAGVVVNRITSGVITMTFLSLTKAITVGGTFFL  458

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  139
            Y  IAA G +FF+  +PET+GKTLE+ EA FG F    ++  E      N N++L
Sbjct  459  YCGIAATGGLFFYIALPETRGKTLEDMEASFGNFNLKSNKGLE------NGNAKL  507



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPL+LTSV G   +LA+LG SLT+I++S  KV WA+ + IA  L+ VA
Sbjct  348  LVATFLLDRVGRRPLILTSVAGQTISLAILGFSLTIINNSDVKVKWAIVLCIATVLSNVA  407

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP++ VY+SEIFPL+LRA G S+   +NR+ SGVV+MTF+SLY A++IGG+FFL
Sbjct  408  FFSIGLGPMSPVYTSEIFPLRLRALGVSVAVTLNRIVSGVVAMTFLSLYHALTIGGAFFL  467

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            YA IAAVGW+FFF + PET+G  LE+ E LFG  F WR ++ +  A +
Sbjct  468  YAGIAAVGWLFFFVVFPETRGHNLEDIEGLFGN-FSWRLKKNKNTAME  514



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA+ +++A  + YV
Sbjct  339  LVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWALGLSLATAITYV  398

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FF
Sbjct  399  ATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFF  458

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQRE  175
            L+  +A   W+FF+T +PET+GK LEE + LF   FRWR S+ +E
Sbjct  459  LFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSKTKE  502



>ref|XP_008667512.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA41234.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=516

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 128/172 (74%), Gaps = 9/172 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + K+P AVA+ IA TLAYV
Sbjct  336  LVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDAKIPSAVALCIASTLAYV  395

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL K I+IGGSFF
Sbjct  396  AFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVISMTFLSLSKGITIGGSFF  455

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANN  151
            LY+ IAAVGWVFFFT +PET+G+TLEE   LFG          + D  +A+N
Sbjct  456  LYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG--------MPDTDMAEAHN  499



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-VAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A V ++IAM L +V
Sbjct  341  LVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRSEGQATALVGLSIAMVLVFV  400

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+
Sbjct  401  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFY  460

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ--REVDAKKANNNSQL  139
            LYA IAA GWVF F  +PETQG++LE+T  LFG   R  +    RE D    N +++L
Sbjct  461  LYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFGGDERDANGTVGRE-DGHGQNKSTEL  517



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +L  L   LTVI  H  EK+ WA+ + I   +AYV
Sbjct  335  LVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPDEKITWAIVLCIFCIMAYV  394

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GP+TWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFISL KA++IGG+FF
Sbjct  395  AFFSIGLGPVTWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFISLSKAMTIGGAFF  454

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            L+A IA+  WVFFF  +PET+G+TLE+  +LFG
Sbjct  455  LFAGIASFAWVFFFAYLPETRGRTLEDMSSLFG  487



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWAVAMAIAMTLAYV  487
            LV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA+ +++A  + YV
Sbjct  339  LVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWALGLSLATAITYV  398

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+SL KAI+ GG+FF
Sbjct  399  ATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLSLTKAITTGGAFF  458

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQRE  175
            L+  +A   W+FF+T +PET+GK LEE + LF   FRWR S+ +E
Sbjct  459  LFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSKTKE  502



>ref|XP_004148314.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 ref|XP_004166833.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=485

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRP +LTSV G   +LA LG SLT+I++SHEKV WA+ + IAM L+ V+
Sbjct  313  LVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINNSHEKVKWAIVLCIAMVLSNVS  372

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+  VY+SEIFPL+LRA G S+    NR+TSGVV+MTF+SLY A++IGG+FFL
Sbjct  373  FFSIGLGPMASVYTSEIFPLRLRALGVSVAIMANRITSGVVTMTFLSLYHAVTIGGAFFL  432

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  175
            +A I+AV W+FF+ + PET+G+ LE+ E LFG  F WR ++ +
Sbjct  433  FAGISAVSWLFFYVVFPETRGQNLEDVEKLFGN-FPWRMKKSK  474



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-VAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A V ++IAM L +V
Sbjct  341  LVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRPEGQATALVGLSIAMVLVFV  400

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+
Sbjct  401  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFY  460

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ--REVDAKKANNNSQL  139
            LYA IAA GWVF F  +PETQG++LE+T  LFG   R  +    RE D    N +++L
Sbjct  461  LYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFGGDERDANGTVGRE-DGHGQNKSTEL  517



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 131/176 (74%), Gaps = 10/176 (6%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF +D+ GRRPLLL+S GGM+ +LA LG+ LT IDH  + ++ WA+ + I   LAYV
Sbjct  385  LVATFLVDRIGRRPLLLSSTGGMILSLAALGLGLTQIDHHPDGQLRWAIGLCIVSILAYV  444

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GP+TWVY SEI PL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  445  AFFSIGLGPVTWVYCSEILPLRLRAQGASIGVAVNRVTSGVITMTFISLYKAITIGGSFF  504

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQL  139
            LY  IA   WVFFFT +PET+G+TLE+ E LFGT         + DA++A N  Q+
Sbjct  505  LYGGIALAAWVFFFTYLPETRGRTLEDMEELFGT---------KKDAEEAPNGVQM  551



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H   ++PWAV + IA  LAYV
Sbjct  346  LVATFQLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHPDGQLPWAVGLCIASILAYV  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  406  AFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFISLYKAITIGGSFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  205
            LYA IAAV WVFFFT + ET+GKTLEE E LFG 
Sbjct  466  LYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  499



>gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRP +LTSV G   +LA LG SLT+I++SHEKV WA+ + IAM L+ V+
Sbjct  347  LVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINNSHEKVKWAIVLCIAMVLSNVS  406

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+  VY+SEIFPL+LRA G S+    NR+TSGVV+MTF+SLY A++IGG+FFL
Sbjct  407  FFSIGLGPMASVYTSEIFPLRLRALGVSVAIMANRITSGVVTMTFLSLYHAVTIGGAFFL  466

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  175
            +A I+AV W+FF+ + PET+G+ LE+ E LFG  F WR ++ +
Sbjct  467  FAGISAVSWLFFYVVFPETRGQNLEDVEKLFGN-FPWRMKKSK  508



>gb|ABF94465.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
Length=553

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 129/178 (72%), Gaps = 4/178 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-VAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A V ++IAM L +V
Sbjct  373  LVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRPEGQATALVGLSIAMVLVFV  432

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FISLYKAI+  GSF+
Sbjct  433  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFISLYKAITFAGSFY  492

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ--REVDAKKANNNSQL  139
            LYA IAA GWVF F  +PETQG++LE+T  LFG   R  +    RE D    N +++L
Sbjct  493  LYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFGGDERDANGTVGRE-DGHGQNKSTEL  549



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT+IDH  + ++ WAV + IA  L YV
Sbjct  337  LVATFLLDRIGRRPLLLSSTGGMILSLAGLGLGLTLIDHHPDGQLRWAVGLCIASILGYV  396

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPITWVYSSEI PL+LRA G S+   +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  397  AFFSIGLGPITWVYSSEILPLRLRAQGASIAVAVNRVTSGVITMTFISLYKAITIGGSFF  456

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQ  142
            LY  IAA+ WVFFF  +PET+G+TLE+ E LFGT    +     V+   A+  ++
Sbjct  457  LYGGIAALAWVFFFACLPETRGRTLEDMEDLFGTRNDTKETTNGVEMANASQGNE  511



>gb|KHN41994.1| Putative polyol transporter 6 [Glycine soja]
Length=460

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            ++ATF +DK GRRPLLL SVGGMV +L +LG SLT++D SHE++ WA+ ++I  T  YVA
Sbjct  291  IIATFFIDKVGRRPLLLVSVGGMVCSLGVLGFSLTMVDTSHEELLWALILSIVATYIYVA  350

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             F++G GPITWVYSSEIFPLKLRA G S+G  +NR+T+  +SM+FIS+Y AI+IGG+FF+
Sbjct  351  FFNLGLGPITWVYSSEIFPLKLRAQGASIGVAVNRLTNAAISMSFISIYNAITIGGAFFM  410

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            +A I+ + W FF+  MPET+G  LEE E LF           E+D ++
Sbjct  411  FAGISVIAWAFFYFFMPETKGVALEEMEMLFSKNKGNNVTTTEIDLRQ  458



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H   ++PWAV   IA  LAYV
Sbjct  311  LVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHPDGQLPWAVGFCIASILAYV  370

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  371  AFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFISLYKAITIGGSFF  430

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  205
            LYA IAAV WVFFFT + ET+GKTLEE E LFG 
Sbjct  431  LYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  464



>ref|XP_006590682.1| PREDICTED: probable polyol transporter 6-like [Glycine max]
Length=497

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            ++ATF +DK GRRPLLL SVGGMV +L +LG SLT++D SHE++ WA+ ++I  T  YVA
Sbjct  328  IIATFFIDKVGRRPLLLVSVGGMVCSLGVLGFSLTMVDTSHEELLWALILSIVATYIYVA  387

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             F++G GPITWVYSSEIFPLKLRA G S+G  +NR+T+  +SM+FIS+Y AI+IGG+FF+
Sbjct  388  FFNLGLGPITWVYSSEIFPLKLRAQGASIGVAVNRLTNAAISMSFISIYNAITIGGAFFM  447

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            +A I+ + W FF+  MPET+G  LEE E LF           E+D ++
Sbjct  448  FAGISVIAWAFFYFFMPETKGVALEEMEMLFSKNKGNNVTTTEIDLRQ  495



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVA-MAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L  ID      P  +A ++IA  L +V
Sbjct  330  LVATFFLDRVGRRPLLLTSAGGMVVSLVTLASALHAIDRLPTGQPTPLAGVSIAAVLTFV  389

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+FISLYKAI+  GSF+
Sbjct  390  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFISLYKAITFAGSFY  449

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            +YA IAA GWVF F  +PET+G++LE+TE LFG       R+ E DA+K +  
Sbjct  450  VYAGIAAAGWVFMFFFLPETRGRSLEDTEKLFGGGDGQDGREDERDAQKKSTE  502



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H   ++PWAV   IA  LAYV
Sbjct  346  LVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHPDGQLPWAVGFCIASILAYV  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV++MTFISLYKAI+IGGSFF
Sbjct  406  AFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFISLYKAITIGGSFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  205
            LYA IAAV WVFFFT + ET+GKTLEE E LFG 
Sbjct  466  LYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S  GM+ +L  L   L  IDH   EK+ WAVA+ IA  L +V
Sbjct  324  LVATFLLDRVGRRPLLLSSAAGMIASLITLASVLLTIDHHPGEKLTWAVALCIATVLTFV  383

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
             +FSIG GPI WVYSSEIFPL+LRA G SLG  +NR+ SG V+M+F+SLYKAISI GSF+
Sbjct  384  GSFSIGLGPIAWVYSSEIFPLRLRAQGASLGASMNRLMSGAVTMSFLSLYKAISISGSFY  443

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  175
            LYA IAA GWVFF+  +PET+G+ LEE E LFG   +   +  E
Sbjct  444  LYAGIAAAGWVFFYVFLPETRGRNLEEMEELFGKASKSSEKAEE  487



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVA-MAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L  ID      P  +A ++IA  L +V
Sbjct  343  LVATFFLDRVGRRPLLLTSAGGMVVSLVTLASALHAIDRLPTGQPTPLAGVSIAAVLTFV  402

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG ++M+FISLYKAI+  GSF+
Sbjct  403  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAITMSFISLYKAITFAGSFY  462

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            +YA IAA GWVF F  +PET+G++LE+TE LFG       R+ E DA+K +  
Sbjct  463  VYAGIAAAGWVFMFFFLPETRGRSLEDTEKLFGGGDGQDGREDERDAQKKSTE  515



>gb|KGN44326.1| Mannitol transporter [Cucumis sativus]
Length=522

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPL+LTSV G   +L +LG+SLT+I++S  KV WA+ + I   L+ +A
Sbjct  351  LVATFLLDRVGRRPLILTSVAGQTISLVILGISLTIINNSEVKVKWAIVLCITTVLSNMA  410

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+  VY+SEIFPL+LRA G S+   +NR+ SGVV+MTF+SLY A++IGG+FFL
Sbjct  411  FFSIGLGPMAPVYTSEIFPLRLRALGVSVSVTLNRIVSGVVAMTFLSLYHALTIGGAFFL  470

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  175
            YA IAAV W+FFF + PET+G+ LE+ EALFG  F WRS++ +
Sbjct  471  YAGIAAVSWLFFFLVFPETRGQNLEDIEALFGN-FPWRSKKNK  512



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + K+PWAVA+ I   LAYV
Sbjct  329  LVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDAKIPWAVALCILSVLAYV  388

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            + FSIG GPI  VY+SEIFPL++RA G ++G   NRVTSGV+SMTF+SL KAI+IGGSFF
Sbjct  389  SFFSIGLGPIAGVYTSEIFPLRVRALGFAVGVASNRVTSGVISMTFLSLSKAITIGGSFF  448

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAA+ WVFFFT +PET+G+TLEE   LFG
Sbjct  449  LYSGIAALAWVFFFTYLPETRGRTLEEMGKLFG  481



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LV+TF LD+ GRRPLLLTSV GM+ +L  LG  LT+IDHS+EK+ WA+ + IAMTL +VA
Sbjct  350  LVSTFFLDRVGRRPLLLTSVAGMIISLTALGCGLTIIDHSNEKLMWAIGLCIAMTLTFVA  409

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FS+G GPI WVYSSEIFPL+LRA G S+G  +NR TSG+++MTF+SL KAI+IGG+FFL
Sbjct  410  SFSMGLGPIAWVYSSEIFPLRLRAQGASIGVAVNRATSGLITMTFLSLSKAITIGGAFFL  469

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR-------EVDAKKANNNS  145
            +AA+AAV W FFFT++PETQG+TLE+ + LFG+   WRS  R       E D K+    S
Sbjct  470  FAAVAAVAWAFFFTVLPETQGRTLEDMQVLFGSLTGWRSVARKLKMEVVEEDGKRDGGGS  529

Query  144  QLQMGT  127
             + +GT
Sbjct  530  HVPLGT  535



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRR LLL SV G++ +L  LG+SLTV+DHS   + WAV ++IA  L+YVA
Sbjct  349  LVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQTTLNWAVGLSIAAVLSYVA  408

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTF+SL KAI+IGG+FFL
Sbjct  409  TFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIAMTFLSLQKAITIGGAFFL  468

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            +A +AAV W+F +TL+PET+GKTLEE E  FG F R    +  +D     +N ++Q+ T
Sbjct  469  FAGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCRKPKAEEGLD-----DNVEIQLKT  522



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 129/177 (73%), Gaps = 9/177 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRP +LTSV G   +LA LG SLT+I+ S EKV WA+ + IAM L+ V+
Sbjct  346  LVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINRSQEKVKWAIVLCIAMVLSNVS  405

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GP+  VY+SEIFPL+LRA G S+    NR+TSGVV+MTF+SLY A++IGG+FFL
Sbjct  406  FFSIGLGPMAAVYTSEIFPLRLRALGVSVAIMANRITSGVVTMTFLSLYHALTIGGAFFL  465

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            +A I+AV W+FF+ + PET+G+ LE+ E LFG  F WR        KK N ++ +++
Sbjct  466  FAGISAVSWLFFYVVFPETRGQNLEDVERLFGN-FPWR--------KKKNKDTNIEV  513



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            L+ TF +D+FGRR LLL S  G+  ++  LG  LT+ID + + K    + + + +T+  V
Sbjct  355  LITTFYVDRFGRRFLLLVSCAGVALSMFALGTVLTIIDRNPDAKQTGVLVLVVLLTMVIV  414

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
              FS+G GPI WVYSSEIFPLKLRA GC LG  +NR  SGV+ M+FISLYK I+IGGSFF
Sbjct  415  GFFSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVILMSFISLYKEITIGGSFF  474

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            L+  I  +GW+FFFTL PET+G+TLEE E LFGTFF+WR+  +E+DAKK
Sbjct  475  LFGGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTMKELDAKK  523



>ref|XP_008670519.1| PREDICTED: putative polyol transporter 1 [Zea mays]
 tpg|DAA41238.1| TPA: hypothetical protein ZEAMMB73_503211 [Zea mays]
Length=520

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WAVA+ IA TLAY+
Sbjct  337  LVATFLLDRAGRRPLLLASTGGMIVSLLSLGAGLTVAGHHPDGKVAWAVALCIASTLAYI  396

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL K I+IGGSFF
Sbjct  397  AFFSIGLGPITGVYTSEIFPLRVRALGFAVGVASNRVTSAVISMTFLSLSKGITIGGSFF  456

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LYA IAAV WVFFFT +PET+G+TLEE   LFG
Sbjct  457  LYAGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  489



>ref|XP_010908358.1| PREDICTED: probable polyol transporter 6 [Elaeis guineensis]
Length=535

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 130/178 (73%), Gaps = 1/178 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L+ATF LD+ GRRPLLLTS+GGMV +L+ LG+ LT+++H+ E++ WAV ++I   L++VA
Sbjct  291  LIATFLLDRVGRRPLLLTSLGGMVVSLSGLGLGLTMVEHTEERLVWAVTLSILAVLSFVA  350

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             +S+G GPITWVYSSEIFPL+LRA G S+G  +NRV +G +SMTFISLY AI+IGG+FF+
Sbjct  351  FYSVGLGPITWVYSSEIFPLRLRAQGASMGVAVNRVMNGTISMTFISLYNAITIGGAFFM  410

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  130
            +  I+ + W+FFF L PET+G+ LEE E +F        R  E    K  N + + MG
Sbjct  411  FGGISILAWLFFFFLCPETRGRPLEEMEEVFSKKI-IDERTIEDSISKMINTNVVVMG  467



>ref|XP_010905473.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=523

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT+IDH  + ++PWA+ + IA  LA+V
Sbjct  346  LVATFLLDRVGRRPLLLSSQGGMIVSLAGLGLGLTIIDHHPNGQLPWAIGLCIASILAFV  405

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GP+  VY SEIFPL+LRA G S+G  +NRVTSGV++MTF+SLYKAI+IGGSFF
Sbjct  406  AFFSIGMGPMPSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFLSLYKAITIGGSFF  465

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  205
            LYA IAAVGWVFFFT + ET+GKTLEE E LFGT
Sbjct  466  LYAGIAAVGWVFFFTYLKETRGKTLEEMENLFGT  499



>gb|ACN26310.1| unknown [Zea mays]
Length=483

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WAVA+ IA TL+Y+
Sbjct  305  LVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPDTKVAWAVALCIASTLSYI  364

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL KAI+IGGSFF
Sbjct  365  AFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVISMTFLSLSKAITIGGSFF  424

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAAV WVFFFT +PET+G+TLEE   LFG
Sbjct  425  LYSGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  457



>ref|NP_001132062.1| proton myo-inositol cotransporter [Zea mays]
 gb|ACF80747.1| unknown [Zea mays]
 tpg|DAA63327.1| TPA: proton myo-inositol cotransporter [Zea mays]
Length=513

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WAVA+ IA TL+Y+
Sbjct  335  LVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPDTKVAWAVALCIASTLSYI  394

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL KAI+IGGSFF
Sbjct  395  AFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVISMTFLSLSKAITIGGSFF  454

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAAV WVFFFT +PET+G+TLEE   LFG
Sbjct  455  LYSGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  487



>ref|XP_010446763.1| PREDICTED: probable polyol transporter 6 [Camelina sativa]
Length=494

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 122/171 (71%), Gaps = 9/171 (5%)
 Frame = -1

Query  657  ATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAF  478
            ATF LDK GRR LLLTSVGGMV  L  LG  LT+  +S  K+ WA+ ++I    ++VA F
Sbjct  331  ATFLLDKVGRRKLLLTSVGGMVIALTTLGFGLTMAQNSGGKLAWALVLSIVAAYSFVAVF  390

Query  477  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  298
            SIG GPITWVYSSE+FPLKLRA G SLG  +NR+ +  VSM+F+SL +AI+ GG+FF++A
Sbjct  391  SIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRIMNATVSMSFLSLSRAITTGGAFFMFA  450

Query  297  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
             +AAV W FFF LMPET+GK+LEE EALF         QR+ D  +  NNS
Sbjct  451  GVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDKVRGENNS  492



>gb|ACG35144.1| proton myo-inositol cotransporter [Zea mays]
Length=513

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WAVA+ IA TL+Y+
Sbjct  335  LVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPDTKVAWAVALCIASTLSYI  394

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+SL KAI+IGGSFF
Sbjct  395  AFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVISMTFLSLSKAITIGGSFF  454

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  208
            LY+ IAAV WVFFFT +PET+G+TLEE   LFG
Sbjct  455  LYSGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  487



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 136/179 (76%), Gaps = 5/179 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRR LLL SV G++ +L  LG+SLTV+DHS   + WAV ++IA  L+YVA
Sbjct  336  LVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQTTLNWAVGLSIAAVLSYVA  395

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTF+SL  AI+IGG+FFL
Sbjct  396  TFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIAMTFLSLQNAITIGGAFFL  455

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  127
            +A +AAV W+F +TL+PET+GKTLEE E  FG F R    +  +D     +N ++Q+ T
Sbjct  456  FAGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCRKPKAEEGLD-----DNVEIQLKT  509



>ref|XP_009109331.1| PREDICTED: probable polyol transporter 6 [Brassica rapa]
Length=506

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 122/172 (71%), Gaps = 9/172 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA
Sbjct  341  LTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVA  400

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL +AI+ GG+FF+
Sbjct  401  VFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTRAITTGGAFFM  460

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            +A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  461  FAGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDNKTKGEN  503



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 125/177 (71%), Gaps = 1/177 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVA-MAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS GGMV +L  L  +L  ID   E    ++A ++IA  L +V
Sbjct  348  LVATFFLDRVGRRPLLLTSAGGMVVSLVTLASALRAIDRLPEGQATSLAGVSIAAVLTFV  407

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG ++M+FISLYKAI+  GSF+
Sbjct  408  ASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVMSGTITMSFISLYKAITFAGSFY  467

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  136
            LYA IAA GW+F F  +PET+G  LE+TE LFG       ++   DA+K+   S  Q
Sbjct  468  LYAGIAAAGWLFMFFFLPETRGSNLEDTEKLFGGGDHDEDKEDGHDAQKSTELSSSQ  524



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GRRPLLL+SVGGM+ +L  L   LT+++HS EKV WA+A+ I   L +VA
Sbjct  342  LVATFLLDRMGRRPLLLSSVGGMILSLLGLASGLTIVNHSEEKVGWAIALCILTVLTFVA  401

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
            +FSIG GPI WVYSSEIFPL+LRA G SL  G+NR+ SG++  TF+SLYKAI+I GSFF+
Sbjct  402  SFSIGLGPIAWVYSSEIFPLRLRAQGGSLAAGVNRMMSGIIVTTFLSLYKAITIEGSFFM  461

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  190
            +A IA V WVF +  +PET+G+TLEE E LF    +WR
Sbjct  462  FAGIATVTWVFIYVFLPETRGRTLEEMEVLFS---KWR  496



>emb|CDY24775.1| BnaA08g15350D [Brassica napus]
Length=506

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 122/172 (71%), Gaps = 9/172 (5%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            L ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA
Sbjct  341  LTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVA  400

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL +AI+ GG+FF+
Sbjct  401  VFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTRAITTGGAFFM  460

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            +A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  461  FAGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDNKTKGEN  503



>ref|XP_010095276.1| putative polyol transporter 6 [Morus notabilis]
 gb|EXB59122.1| putative polyol transporter 6 [Morus notabilis]
Length=501

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            LVATF LD+ GR+ LLLTS GGM+  L  LG  LT+++HS E++ WA+ ++IA    +VA
Sbjct  328  LVATFWLDRIGRKRLLLTSTGGMIVALTGLGFCLTMVEHSKEELVWALGLSIASVYVFVA  387

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             FSIG GPITWVYSSEIFPL+LRA G S+G  +NRV +  VSMTFIS+YKAI+IGG+FF+
Sbjct  388  FFSIGLGPITWVYSSEIFPLRLRAQGMSIGVAVNRVMNATVSMTFISIYKAITIGGTFFM  447

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQ  136
            +A IA + W FF+  +PET+G+TLEE E LF    R   +   VD +    N  +Q
Sbjct  448  FAGIAVLAWGFFYFFLPETKGRTLEEMETLFS---RNGKKSGNVDIEIQRRNGYVQ  500



>emb|CDY35469.1| BnaC03g61910D [Brassica napus]
Length=507

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 122/171 (71%), Gaps = 9/171 (5%)
 Frame = -1

Query  660  VATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAA  481
            +ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA 
Sbjct  343  IATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVAV  402

Query  480  FSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLY  301
            FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL +AI+ GG+FF++
Sbjct  403  FSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTRAITTGGAFFMF  462

Query  300  AAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
            A +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  463  AGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDNKTKGEN  504



>emb|CDX75588.1| BnaA01g01140D [Brassica napus]
Length=481

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 121/170 (71%), Gaps = 9/170 (5%)
 Frame = -1

Query  657  ATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAF  478
            ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA F
Sbjct  318  ATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVAVF  377

Query  477  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  298
            SIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++A
Sbjct  378  SIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMFA  437

Query  297  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
             +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  438  GVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDHKVRGEN  478



>ref|XP_007156029.1| hypothetical protein PHAVU_003G252500g [Phaseolus vulgaris]
 gb|ESW28023.1| hypothetical protein PHAVU_003G252500g [Phaseolus vulgaris]
Length=495

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  484
            ++A F LD+ GRR LL  S GGM+  L LLG SLT++DHS EK+ WA++++I  T AYVA
Sbjct  329  VMALFLLDRVGRRRLLQVSTGGMICGLTLLGFSLTMVDHSSEKLLWALSLSIVATYAYVA  388

Query  483  AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  304
             F+IG GP+TWVYSSEIFPL+LRA G S+G  +NR  + VVSM+FIS+YKAI+IGGSFF+
Sbjct  389  FFNIGLGPVTWVYSSEIFPLRLRAQGASIGVAVNRTMNAVVSMSFISVYKAITIGGSFFM  448

Query  303  YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK  163
            +AA++ + W FF+  +PET+G  LEE E LF   F  ++  ++ D +
Sbjct  449  FAAVSILAWFFFYFFLPETKGVPLEEMEMLFTKVFSGQNVVKKTDPR  495



>emb|CDY67098.1| BnaCnng53530D [Brassica napus]
Length=481

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 121/170 (71%), Gaps = 9/170 (5%)
 Frame = -1

Query  657  ATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAF  478
            ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA F
Sbjct  318  ATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVAVF  377

Query  477  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  298
            SIG GPITWVYS+E+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++A
Sbjct  378  SIGLGPITWVYSAEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMFA  437

Query  297  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
             +AAV W FFF LMPET+GK+LEE EALF         QR+ D K    N
Sbjct  438  GVAAVAWNFFFFLMPETKGKSLEEIEALF---------QRDGDHKVRGEN  478



>ref|XP_006285274.1| hypothetical protein CARUB_v10006648mg [Capsella rubella]
 gb|EOA18172.1| hypothetical protein CARUB_v10006648mg [Capsella rubella]
Length=493

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 122/171 (71%), Gaps = 9/171 (5%)
 Frame = -1

Query  657  ATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAF  478
            ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I     +VA F
Sbjct  331  ATFLLDKVGRRKLLLTSVGGMVIALTMLGFGLTMAQNSGGKLAWALVLSIVSAYGFVAVF  390

Query  477  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  298
            SIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++A
Sbjct  391  SIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMFA  450

Query  297  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  145
             +AAV W FFF L+PET+GK+LEE EALF         QR+ D  +  N++
Sbjct  451  GVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDKVRGENSA  492



>ref|XP_006411974.1| hypothetical protein EUTSA_v10024974mg [Eutrema salsugineum]
 gb|ESQ53427.1| hypothetical protein EUTSA_v10024974mg [Eutrema salsugineum]
Length=503

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 121/170 (71%), Gaps = 9/170 (5%)
 Frame = -1

Query  657  ATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAF  478
            ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA F
Sbjct  340  ATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVAVF  399

Query  477  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  298
            SIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++A
Sbjct  400  SIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMFA  459

Query  297  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
             +AAV W FFF L+PET+GK+LEE EALF         QR+ D K    N
Sbjct  460  GVAAVAWNFFFFLLPETKGKSLEEIEALF---------QRDGDNKVRGEN  500



>dbj|BAK00091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 124/178 (70%), Gaps = 5/178 (3%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LVATF LD+ GRRPLLLTS  GM+  L  LG  LTV+D H   K+PWA+A+ I   LAYV
Sbjct  348  LVATFQLDRIGRRPLLLTSTAGMLACLIGLGTGLTVVDRHPDTKIPWAIALCIVSVLAYV  407

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            + FS G GP+T VY+SE+FPL++RA G +LG   NRVTS  VSM+F+SL KAI+IGGSFF
Sbjct  408  SFFSTGLGPLTSVYTSEVFPLRVRALGFALGASCNRVTSAAVSMSFLSLSKAITIGGSFF  467

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  133
            LYA IAA+GW+FFFT +PET+G  LEE   LFG     + R  E D    +    ++M
Sbjct  468  LYAGIAALGWIFFFTFIPETRGLPLEEIGKLFG----MKDRVVEEDTATKDKVKVVEM  521



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -1

Query  663  LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWAVAMAIAMTLAYV  487
            LV+TF +DKFGRR LLLTS GG+V +L  L + LTVID H  EK+  AVA+     L+ V
Sbjct  326  LVSTFNIDKFGRRILLLTSTGGLVCSLLGLAIGLTVIDQHPTEKLTGAVAVCFFCVLSSV  385

Query  486  AAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFF  307
            A FS+G GP+ WVYSSEIFPL+LRA G  L   +NR+ SGV+ MTFISLYKAI+IGG+FF
Sbjct  386  ATFSMGMGPVAWVYSSEIFPLRLRALGSGLAAAMNRLVSGVILMTFISLYKAITIGGAFF  445

Query  306  LYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKK  160
            L+A IA V ++FFFTL+PETQG+ LEE E +FGTFF+WRS  RE++ +K
Sbjct  446  LFAGIAFVAFIFFFTLLPETQGRGLEEMEEMFGTFFKWRSTVRELEERK  494



>ref|XP_009142783.1| PREDICTED: LOW QUALITY PROTEIN: probable polyol transporter 6 
[Brassica rapa]
Length=506

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 120/170 (71%), Gaps = 9/170 (5%)
 Frame = -1

Query  657  ATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAF  478
            ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+ ++I    ++VA F
Sbjct  343  ATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWALVLSIVSAYSFVAVF  402

Query  477  SIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFLYA  298
            SIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL KAI+ GG+FF++A
Sbjct  403  SIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSLTKAITTGGAFFMFA  462

Query  297  AIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  148
             +AAV W FFF LMPET+GK+LEE E LF         QR+ D K    N
Sbjct  463  GVAAVAWNFFFFLMPETKGKSLEEIEVLF---------QRDGDHKVRGEN  503



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140