BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022O19

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              395   1e-135   
emb|CAD20821.1|  alpha tubulin                                          393   8e-135   Zea mays [maize]
dbj|BAH20267.1|  AT5G19780                                              393   1e-134   Arabidopsis thaliana [mouse-ear cress]
gb|ABR25510.1|  tubulin alpha-1 chain                                   392   1e-134   Oryza sativa Indica Group [Indian rice]
emb|CAL35827.1|  alpha-2 tubulin                                        392   1e-134   Plantago major [cart-track plant]
ref|XP_001777110.1|  predicted protein                                  395   2e-134   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              397   1e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   397   1e-133   Sesamum indicum [beniseed]
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        397   1e-133   Fragaria vesca subsp. vesca
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              397   1e-133   Sesamum indicum [beniseed]
gb|KJB83378.1|  hypothetical protein B456_013G244600                    395   2e-133   Gossypium raimondii
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              396   2e-133   Nelumbo nucifera [Indian lotus]
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   396   2e-133   Nelumbo nucifera [Indian lotus]
emb|CDP17586.1|  unnamed protein product                                396   3e-133   Coffea canephora [robusta coffee]
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   396   3e-133   Populus euphratica
gb|AGG37288.1|  alpha-tubulin 6                                         396   3e-133   Salix arbutifolia
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                395   4e-133   Erythranthe guttata [common monkey flower]
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   395   4e-133   Malus domestica [apple tree]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             395   4e-133   Capsella rubella
tpg|DAA41189.1|  TPA: alpha tubulin5                                    390   4e-133   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          395   4e-133   Amborella trichopoda
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   395   5e-133   Malus domestica [apple tree]
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     393   5e-133   Eucalyptus grandis [rose gum]
ref|XP_007030078.1|  Tubulin alpha-5                                    396   5e-133   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   395   5e-133   Phoenix dactylifera
tpg|DAA63280.1|  TPA: alpha tubulin6                                    390   5e-133   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   395   5e-133   Pyrus x bretschneideri [bai li]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                395   5e-133   Erythranthe guttata [common monkey flower]
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   395   6e-133   Vitis vinifera
emb|CDY44941.1|  BnaA02g04460D                                          395   6e-133   Brassica napus [oilseed rape]
gb|KHN06388.1|  Tubulin alpha-3 chain                                   394   7e-133   Glycine soja [wild soybean]
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     395   7e-133   Populus trichocarpa [western balsam poplar]
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               395   7e-133   Populus trichocarpa [western balsam poplar]
gb|AHJ80821.1|  Tua3                                                    393   7e-133   Eragrostis tef [tef]
gb|AGG37290.1|  alpha-tubulin 8                                         395   7e-133   Salix arbutifolia
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              395   7e-133   Pyrus x bretschneideri [bai li]
gb|AGD80034.1|  alpha-tubulin 1                                         395   7e-133   Hevea brasiliensis [jebe]
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              395   7e-133   Populus euphratica
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         395   8e-133   Jatropha curcas
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             395   8e-133   Citrus clementina [clementine]
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   395   9e-133   Populus euphratica
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              395   9e-133   Elaeis guineensis
ref|XP_010112637.1|  Tubulin alpha-3 chain                              395   9e-133   Morus notabilis
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               394   9e-133   Populus trichocarpa [western balsam poplar]
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              394   9e-133   Malus domestica [apple tree]
gb|ACN40824.1|  unknown                                                 394   1e-132   Picea sitchensis
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              394   1e-132   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI78243.1|  alpha tubulin 5                                         387   1e-132   Caragana korshinskii
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              394   1e-132   Phoenix dactylifera
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             394   1e-132   Gossypium arboreum [tree cotton]
gb|AGG37284.1|  alpha-tubulin 2                                         394   1e-132   Salix arbutifolia
gb|ABO47741.1|  alpha-tubulin                                           394   1e-132   Gossypium hirsutum [American cotton]
gb|ABO47735.1|  alpha-tubulin                                           394   1e-132   Gossypium hirsutum [American cotton]
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    394   1e-132   Tarenaya hassleriana [spider flower]
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             391   1e-132   Anemia phyllitidis
ref|NP_197478.1|  tubulin alpha-3                                       394   1e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AEG74028.1|  alpha-tubulin                                           394   1e-132   Apopellia endiviifolia (species B)
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              394   1e-132   Camelina sativa [gold-of-pleasure]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   394   1e-132   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY42294.1|  BnaC02g09000D                                          394   1e-132   Brassica napus [oilseed rape]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   394   1e-132   Gossypium arboreum [tree cotton]
gb|KHG06861.1|  Tubulin alpha-6 chain                                   394   1e-132   Gossypium arboreum [tree cotton]
emb|CDX88875.1|  BnaA03g07740D                                          394   1e-132   
ref|XP_001777081.1|  predicted protein                                  394   2e-132   
ref|NP_001237301.1|  tubulin A                                          394   2e-132   
gb|KHN47983.1|  Tubulin alpha-3 chain                                   393   2e-132   Glycine soja [wild soybean]
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-132   Eucalyptus grandis [rose gum]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               394   2e-132   Glycine max [soybeans]
gb|AHJ80820.1|  Tua3                                                    392   2e-132   Eragrostis tef [tef]
gb|ABB16994.1|  unknown                                                 394   2e-132   Solanum tuberosum [potatoes]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              394   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-132   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    394   2e-132   Gossypium raimondii
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             394   2e-132   Citrus clementina [clementine]
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    394   2e-132   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-132   Elaeis guineensis
gb|KJB83375.1|  hypothetical protein B456_013G244600                    394   2e-132   Gossypium raimondii
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001782790.1|  predicted protein                                  393   3e-132   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             393   3e-132   Phaseolus vulgaris [French bean]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              393   3e-132   Brassica rapa
ref|XP_002532068.1|  tubulin alpha chain, putative                      393   3e-132   Ricinus communis
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              393   3e-132   Prunus mume [ume]
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              393   3e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             393   3e-132   Prunus persica
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     393   4e-132   Eucalyptus grandis [rose gum]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   393   4e-132   Brassica rapa
dbj|BAJ06363.1|  alpha-tubulin                                          393   4e-132   Alopecurus aequalis
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   393   4e-132   Brachypodium distachyon [annual false brome]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        393   4e-132   Cucumis melo [Oriental melon]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              393   5e-132   Setaria italica
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              393   5e-132   Cucumis sativus [cucumbers]
emb|CAD26886.1|  alpha-tubulin                                          393   5e-132   Miscanthus sinensis
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   393   5e-132   Tarenaya hassleriana [spider flower]
ref|XP_002525416.1|  tubulin alpha chain, putative                      392   5e-132   Ricinus communis
gb|ABD92942.1|  alpha tubulin-1D                                        392   5e-132   Triticum aestivum [Canadian hard winter wheat]
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             392   5e-132   Hordeum vulgare [barley]
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   392   6e-132   Nicotiana tomentosiformis
gb|ABR67425.1|  alpha-tubulin 4                                         392   6e-132   Populus tremuloides
emb|CDP14299.1|  unnamed protein product                                392   6e-132   Coffea canephora [robusta coffee]
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    392   6e-132   Eleusine indica [crabgrass]
ref|NP_001105324.1|  tubulin alpha-5 chain                              392   6e-132   Zea mays [maize]
emb|CAD26891.1|  alpha-tubulin                                          392   6e-132   Miscanthus floridulus
ref|NP_001060075.1|  Os07g0574800                                       392   6e-132   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              392   6e-132   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      392   6e-132   Medicago truncatula
gb|AGY80453.1|  tubulin                                                 392   7e-132   Dendrocalamus latiflorus [sweet bamboo]
ref|NP_001105588.1|  tubulin alpha-6 chain                              392   7e-132   Zea mays [maize]
gb|AGG37286.1|  alpha-tubulin 4                                         392   8e-132   Salix arbutifolia
emb|CAD24765.1|  alpha-tubulin                                          392   8e-132   Miscanthus sinensis
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              392   8e-132   Populus euphratica
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              392   9e-132   Oryza brachyantha
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     392   9e-132   Populus trichocarpa [western balsam poplar]
gb|ABV55994.1|  alpha-tubulin 6                                         392   1e-131   Populus tremuloides
gb|AFR42026.1|  alpha-tubulin                                           382   1e-131   Populus trichocarpa [western balsam poplar]
gb|AAO63773.2|  alpha-tubulin 2                                         392   1e-131   Populus tremuloides
gb|AFR42020.1|  alpha-tubulin                                           382   1e-131   Populus trichocarpa [western balsam poplar]
emb|CAD24768.1|  alpha-tubulin                                          392   1e-131   Miscanthus floridulus
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             391   2e-131   Prunus persica
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        391   2e-131   Prunus mume [ume]
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         391   2e-131   Jatropha curcas
gb|AFR42035.1|  alpha-tubulin                                           382   2e-131   Populus alba [abele]
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   391   2e-131   Camelina sativa [gold-of-pleasure]
gb|KJB58759.1|  hypothetical protein B456_009G224800                    387   2e-131   Gossypium raimondii
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              391   2e-131   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              391   2e-131   Cucumis sativus [cucumbers]
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            382   3e-131   
gb|ABO47738.1|  alpha-tubulin                                           391   3e-131   Gossypium hirsutum [American cotton]
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              390   3e-131   
ref|XP_007014666.1|  Tubulin alpha-5                                    390   4e-131   Theobroma cacao [chocolate]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             390   5e-131   Capsella rubella
gb|AIC33057.1|  tubulin alpha-1 chain                                   390   5e-131   Panax ginseng [Asiatic ginseng]
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              390   5e-131   Brassica rapa
gb|KIY91712.1|  Tubulin alpha chain                                     382   5e-131   Monoraphidium neglectum
emb|CAD26887.1|  alpha-tubulin                                          390   6e-131   Miscanthus sinensis
ref|XP_003624633.1|  Alpha-tubulin                                      390   6e-131   Medicago truncatula
gb|AFR42036.1|  alpha-tubulin                                           380   7e-131   Populus alba [abele]
gb|AAW57309.1|  alpha-tubulin                                           383   8e-131   Ceratopteris richardii
gb|KJB80786.1|  hypothetical protein B456_013G115100                    389   9e-131   Gossypium raimondii
emb|CAB76917.1|  alpha-tubulin 4                                        384   9e-131   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAW57310.1|  alpha-tubulin                                           382   1e-130   Ceratopteris richardii
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              389   1e-130   Tarenaya hassleriana [spider flower]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    385   2e-130   Gossypium raimondii
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             389   2e-130   Capsella rubella
emb|CAD24766.1|  alpha-tubulin                                          388   3e-130   Miscanthus sinensis
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               379   3e-130   Erythranthe guttata [common monkey flower]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              388   3e-130   Sesamum indicum [beniseed]
ref|XP_008621874.1|  tubulin alpha                                      382   3e-130   Saprolegnia diclina VS20
emb|CAD24767.1|  alpha-tubulin                                          388   3e-130   Miscanthus floridulus
gb|ABD92943.1|  alpha tubulin-1B                                        388   4e-130   Triticum aestivum [Canadian hard winter wheat]
gb|ABE01246.1|  alpha tubulin                                           388   4e-130   Camellia sinensis [black tea]
emb|CAD26890.1|  alpha-tubulin                                          388   4e-130   Miscanthus sinensis subsp. condensatus
gb|AFR42042.1|  alpha-tubulin                                           378   4e-130   Populus fremontii
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              388   4e-130   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              387   5e-130   Eucalyptus grandis [rose gum]
gb|AAW57306.1|  alpha-tubulin                                           380   5e-130   Ceratopteris richardii
gb|AFR42049.1|  alpha-tubulin                                           378   6e-130   Populus fremontii
gb|AFR42054.1|  alpha-tubulin                                           378   6e-130   Populus fremontii
emb|CAJ38386.1|  alpha tubulin                                          380   7e-130   Plantago major [cart-track plant]
emb|CAD26892.1|  alpha-tubulin                                          387   7e-130   Miscanthus floridulus
gb|AGV54500.1|  tubulin A                                               387   8e-130   Phaseolus vulgaris [French bean]
dbj|BAH19954.1|  AT1G50010                                              380   8e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CAD26893.1|  alpha-tubulin                                          387   9e-130   Miscanthus floridulus
ref|NP_176654.1|  tubulin alpha-1 chain                                 387   9e-130   Arabidopsis thaliana [mouse-ear cress]
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                390   1e-129   Erythranthe guttata [common monkey flower]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   383   1e-129   Citrus sinensis [apfelsine]
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              378   2e-129   Solanum lycopersicum
ref|XP_002886753.1|  alpha-1 tubulin                                    386   2e-129   Arabidopsis lyrata subsp. lyrata
ref|XP_002959708.1|  alpha tubulin                                      379   2e-129   Volvox carteri f. nagariensis
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      386   2e-129   Phaseolus vulgaris [French bean]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    384   3e-129   Gossypium raimondii
gb|AHM93474.1|  alpha-tubulin                                           381   3e-129   Camellia chekiangoleosa
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             385   3e-129   Gossypium arboreum [tree cotton]
gb|AHJ80819.1|  Tua1                                                    378   3e-129   Eragrostis tef [tef]
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              385   3e-129   Brassica rapa
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             385   3e-129   Phaseolus vulgaris [French bean]
emb|CAM58978.1|  alpha tubulin 5                                        378   4e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       384   4e-129   
emb|CAD26888.1|  alpha-tubulin                                          385   4e-129   Miscanthus transmorrisonensis
gb|KHN46768.1|  Tubulin alpha-3 chain                                   385   5e-129   Glycine soja [wild soybean]
gb|AEE98361.1|  alpha-tubulin                                           378   5e-129   Deschampsia antarctica
gb|AAW57305.1|  alpha-tubulin                                           380   6e-129   Ceratopteris richardii
gb|KHG20487.1|  Tubulin alpha chain                                     385   6e-129   Gossypium arboreum [tree cotton]
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                385   7e-129   Avena sativa [cultivated oat]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    384   9e-129   
gb|ABL61201.1|  alpha-tubulin                                           379   1e-128   Oxymonadida environmental sample
gb|EKF29047.1|  epsilon tubulin, putative                               376   1e-128   Trypanosoma cruzi marinkellei
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      384   1e-128   Phaseolus vulgaris [French bean]
gb|EKF28172.1|  epsilon tubulin, putative                               377   1e-128   Trypanosoma cruzi marinkellei
prf||1503274A  alpha1 tubulin                                           384   1e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   383   1e-128   Citrus sinensis [apfelsine]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                383   1e-128   Erythranthe guttata [common monkey flower]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    384   1e-128   Gossypium raimondii
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              384   1e-128   Glycine max [soybeans]
gb|ABL61216.1|  alpha-tubulin                                           379   1e-128   Oxymonadida environmental sample
emb|CCD11782.1|  unnamed protein product                                377   1e-128   Trypanosoma congolense IL3000
gb|ADW83724.1|  alpha-tubulin                                           383   2e-128   Musa acuminata AAA Group [Cavendish banana]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     383   2e-128   Vitis vinifera
ref|XP_010093625.1|  Tubulin alpha chain                                384   2e-128   Morus notabilis
ref|XP_007515802.1|  alpha-tubulin                                      382   2e-128   Bathycoccus prasinos
emb|CAA52158.1|  alpha tubulin                                          377   2e-128   Zea mays [maize]
ref|XP_011398411.1|  Tubulin alpha chain                                382   2e-128   Auxenochlorella protothecoides
gb|AAO46127.1|  alpha-tubulin                                           376   2e-128   Streblomastix strix
gb|AFR42047.1|  alpha-tubulin                                           374   2e-128   Populus fremontii
emb|CBH08958.1|  alpha tubulin, (fragment)                              378   2e-128   Trypanosoma brucei gambiense DAL972
gb|ABL61224.1|  alpha-tubulin                                           379   2e-128   Oxymonadida environmental sample
gb|AIX10773.1|  alpha tubulin                                           384   2e-128   Panax notoginseng [san-qi]
gb|AGG37285.1|  alpha-tubulin 3                                         384   2e-128   Salix arbutifolia
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    384   2e-128   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             384   2e-128   Citrus clementina [clementine]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         384   2e-128   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           384   2e-128   Betula pendula [white birch]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    384   2e-128   Gossypium hirsutum [American cotton]
gb|ABO47736.1|  alpha-tubulin                                           384   2e-128   Gossypium hirsutum [American cotton]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        384   2e-128   Cucumis melo [Oriental melon]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              384   2e-128   Medicago truncatula
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         384   2e-128   Jatropha curcas
ref|XP_002522104.1|  tubulin alpha chain, putative                      384   2e-128   Ricinus communis
gb|ABO47739.1|  alpha-tubulin                                           384   2e-128   Gossypium hirsutum [American cotton]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              384   2e-128   Theobroma cacao [chocolate]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     383   2e-128   Eucalyptus grandis [rose gum]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          383   2e-128   Malus domestica [apple tree]
gb|AAB36609.1|  alpha-tubulin                                           381   2e-128   Eucalyptus globulus subsp. bicostata
ref|NP_001289660.1|  tubulin alpha chain-like                           384   2e-128   Eucalyptus grandis [rose gum]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     383   2e-128   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     383   2e-128   Pyrus x bretschneideri [bai li]
gb|AIX10966.1|  tubulin                                                 383   2e-128   Ornithogalum longebracteatum [sea-onion]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 383   2e-128   Populus trichocarpa [western balsam poplar]
gb|ABK92520.1|  unknown                                                 383   2e-128   Populus trichocarpa [western balsam poplar]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   383   2e-128   Populus euphratica
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                383   2e-128   Vitis vinifera
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                383   2e-128   Phoenix dactylifera
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             383   2e-128   Citrus clementina [clementine]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             383   2e-128   Prunus persica
gb|ABO47740.1|  alpha-tubulin                                           383   2e-128   Gossypium hirsutum [American cotton]
gb|ABQ59633.1|  alpha-tubulin 3                                         383   2e-128   Populus tremuloides
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             383   2e-128   Selaginella moellendorffii
ref|XP_001764722.1|  predicted protein                                  383   2e-128   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     383   3e-128   Nelumbo nucifera [Indian lotus]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                383   3e-128   Prunus dulcis [sweet almond]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   383   3e-128   Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     383   3e-128   Phoenix dactylifera
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              383   3e-128   Medicago truncatula
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Phoenix dactylifera
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Elaeis guineensis
ref|XP_002510010.1|  tubulin alpha chain, putative                      383   3e-128   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           383   3e-128   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         383   3e-128   Pseudotsuga menziesii var. menziesii
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Elaeis guineensis
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          383   3e-128   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Pyrus x bretschneideri [bai li]
gb|ABL61212.1|  alpha-tubulin                                           378   3e-128   Oxymonadida environmental sample
gb|KHG18997.1|  Tubulin alpha chain                                     383   3e-128   Gossypium arboreum [tree cotton]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              383   3e-128   Cucumis sativus [cucumbers]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        383   3e-128   Glycine max [soybeans]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Nelumbo nucifera [Indian lotus]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              383   3e-128   
gb|ACN40181.1|  unknown                                                 383   3e-128   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     383   3e-128   Vitis vinifera
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     383   3e-128   Sesamum indicum [beniseed]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     383   3e-128   Carthamus tinctorius
ref|XP_007042689.1|  Tubulin alpha-2 chain                              383   3e-128   Theobroma cacao [chocolate]
gb|ABL61215.1|  alpha-tubulin                                           378   3e-128   Oxymonadida environmental sample
ref|XP_002517492.1|  tubulin alpha chain, putative                      383   3e-128   Ricinus communis
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     383   3e-128   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Cucumis sativus [cucumbers]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     383   3e-128   Vitis vinifera
gb|AGG37283.1|  alpha-tubulin 1                                         383   3e-128   Salix arbutifolia
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             383   3e-128   Phaseolus vulgaris [French bean]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   383   3e-128   Fragaria vesca subsp. vesca
gb|ETM52928.1|  tubulin alpha chain                                     381   3e-128   Phytophthora parasitica
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Elaeis guineensis
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                383   3e-128   Nelumbo nucifera [Indian lotus]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             383   3e-128   Prunus persica
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         383   4e-128   Jatropha curcas
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             383   4e-128   Populus trichocarpa [western balsam poplar]
gb|KHN08201.1|  Tubulin alpha chain                                     383   4e-128   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               383   4e-128   
gb|AEW46684.1|  beta-tubulin                                            383   4e-128   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              383   4e-128   
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             383   4e-128   
ref|XP_010099392.1|  Tubulin alpha chain                                383   4e-128   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             383   4e-128   
gb|EPS62716.1|  alpha-tubulin                                           381   4e-128   
gb|AEQ75493.1|  alpha-tubulin                                           382   5e-128   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     382   5e-128   
gb|AGG37289.1|  alpha-tubulin 7                                         382   5e-128   
ref|XP_005851144.1|  alpha-tubulin                                      382   5e-128   
gb|ABL61202.1|  alpha-tubulin                                           377   6e-128   
gb|ABL61219.1|  alpha-tubulin                                           377   6e-128   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     382   7e-128   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   382   7e-128   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                382   7e-128   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             382   8e-128   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             382   8e-128   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             382   8e-128   
gb|KIZ03400.1|  Tubulin alpha chain                                     382   8e-128   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            378   8e-128   
dbj|BAJ06364.1|  alpha-tubulin                                          382   8e-128   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              382   8e-128   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   382   9e-128   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        382   9e-128   
gb|ADJ00012.1|  tubulin alpha chain                                     374   9e-128   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              382   9e-128   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              384   9e-128   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     382   9e-128   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   382   1e-127   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          382   1e-127   
ref|XP_002508010.1|  alpha tubulin 2                                    382   1e-127   
ref|XP_010104543.1|  Tubulin alpha chain                                382   1e-127   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             382   1e-127   
gb|ABD92937.1|  alpha tubulin-4A                                        382   1e-127   
gb|ABD92936.1|  alpha tubulin-4D                                        382   1e-127   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                382   1e-127   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   382   1e-127   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    382   1e-127   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    382   1e-127   
gb|ABL61227.1|  alpha-tubulin                                           377   1e-127   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             382   1e-127   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   382   1e-127   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    382   1e-127   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     381   1e-127   
gb|ABL61213.1|  alpha-tubulin                                           377   1e-127   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 382   1e-127   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             382   1e-127   
gb|ABL61203.1|  alpha-tubulin                                           376   1e-127   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                381   1e-127   
gb|KEH43997.1|  tubulin beta-1 chain                                    381   1e-127   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                381   1e-127   
gb|AFW67749.1|  alpha tubulin4                                          377   1e-127   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              381   1e-127   
gb|AAO46130.1|  alpha-tubulin                                           374   1e-127   
gb|ABL61217.1|  alpha-tubulin                                           376   1e-127   
gb|ABO47737.1|  alpha-tubulin                                           381   1e-127   
gb|AAO46128.1|  alpha-tubulin                                           374   2e-127   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             381   2e-127   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   381   2e-127   
ref|XP_003058621.1|  alpha tubulin                                      381   2e-127   
gb|ETM53018.1|  tubulin alpha chain                                     374   2e-127   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             376   2e-127   
gb|ETW27380.1|  tubulin alpha chain                                     376   2e-127   
gb|ABL61214.1|  alpha-tubulin                                           375   3e-127   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             380   3e-127   
dbj|BAC24800.1|  alpha tubulin                                          380   3e-127   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             380   3e-127   
ref|XP_005651460.1|  tubulin alpha chain                                380   3e-127   
gb|AFW67748.1|  alpha tubulin4                                          377   3e-127   
ref|XP_005643073.1|  tubulin alpha chain                                380   3e-127   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              380   3e-127   
emb|CAB66336.1|  alpha-tubulin                                          380   3e-127   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             379   3e-127   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             380   3e-127   
ref|XP_007512064.1|  alpha-tubulin                                      380   3e-127   
ref|XP_008877307.1|  tubulin alpha chain                                377   4e-127   
gb|ABL61218.1|  alpha-tubulin                                           375   4e-127   
gb|AFK33477.1|  unknown                                                 377   4e-127   
gb|EJY81124.1|  Alpha tubulin,putative                                  380   4e-127   
gb|ABQ59634.1|  alpha-tubulin 5                                         380   4e-127   
emb|CDW82295.1|  alpha tubulin                                          380   4e-127   
ref|XP_010096739.1|  Tubulin alpha chain                                380   4e-127   
gb|ETM30643.1|  tubulin alpha chain                                     380   4e-127   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                380   4e-127   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             380   4e-127   
gb|ABL61226.1|  alpha-tubulin                                           375   4e-127   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             380   4e-127   
dbj|BAP59012.1|  alpha tubulin                                          380   5e-127   
gb|AAB86649.1|  alpha-tubulin                                           380   5e-127   
gb|ACK76232.1|  alpha-tubulin                                           380   5e-127   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                380   5e-127   
gb|AAX63396.1|  alpha-tubulin                                           380   5e-127   
emb|CDY29334.1|  BnaA05g16010D                                          379   5e-127   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                380   5e-127   
gb|ABL61204.1|  alpha-tubulin                                           374   5e-127   
emb|CCI41153.1|  unnamed protein product                                380   5e-127   
ref|XP_002904195.1|  alpha-tubulin, putative                            380   5e-127   
ref|XP_008900864.1|  tubulin alpha chain                                380   5e-127   
ref|XP_008872990.1|  tubulin alpha chain                                380   5e-127   
gb|EWC76931.1|  tubulin alpha chain                                     375   5e-127   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                380   5e-127   
gb|AGG37287.1|  alpha-tubulin 5                                         380   6e-127   
gb|ETM52951.1|  tubulin alpha chain                                     380   6e-127   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  380   6e-127   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    380   6e-127   
gb|ETO82054.1|  tubulin alpha chain                                     380   6e-127   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    380   6e-127   
ref|XP_009842456.1|  tubulin alpha chain                                380   6e-127   
gb|ETP23198.1|  tubulin alpha chain                                     377   6e-127   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                380   6e-127   
ref|XP_001770881.1|  predicted protein                                  380   7e-127   
gb|ABV55999.1|  alpha-tubulin 7                                         380   7e-127   
gb|ABP65323.1|  alpha tubulin                                           380   7e-127   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      375   7e-127   
gb|ABC59068.2|  alpha tubulin 1                                         379   7e-127   
gb|AAB86648.1|  alpha-tubulin                                           379   7e-127   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                379   7e-127   
emb|CDY66630.1|  BnaCnng51680D                                          379   7e-127   
gb|ABU93324.1|  tubulin alpha subunit                                   379   8e-127   
ref|XP_001419217.1|  predicted protein                                  379   8e-127   
gb|EPY40479.1|  tubulin alpha                                           372   8e-127   
gb|AAT09063.1|  alpha tubulin 1                                         379   8e-127   
ref|XP_002904194.1|  alpha-tubulin                                      379   8e-127   
emb|CAB77671.1|  alpha-tubulin                                          379   8e-127   
gb|AAO46126.1|  alpha-tubulin                                           372   9e-127   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              378   1e-126   
ref|NP_001291325.1|  tubulin alpha chain-like                           379   1e-126   
ref|NP_171974.1|  tubulin alpha-4 chain                                 379   1e-126   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        379   1e-126   
gb|ABU93323.1|  tubulin alpha subunit                                   379   1e-126   
ref|XP_002951007.1|  alpha tubulin                                      379   1e-126   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             379   1e-126   
ref|NP_193232.1|  tubulin alpha-6 chain                                 379   1e-126   
emb|CDP02221.1|  unnamed protein product                                379   1e-126   
emb|CAD20820.1|  alpha tubulin                                          370   1e-126   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           379   1e-126   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               374   1e-126   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           379   1e-126   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             379   1e-126   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          379   1e-126   
gb|ABL61086.1|  alpha-tubulin                                           374   1e-126   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             379   1e-126   
ref|WP_039310890.1|  hypothetical protein                               379   1e-126   
gb|EMT20847.1|  Tubulin alpha-2 chain                                   379   1e-126   
gb|ABD92939.1|  alpha tubulin-5D                                        379   1e-126   
gb|ABD92940.1|  alpha tubulin-5A                                        379   1e-126   
gb|EPY33355.1|  tubulin alpha                                           374   1e-126   
dbj|BAG99724.1|  unnamed protein product                                378   1e-126   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     379   1e-126   
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   379   1e-126   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             379   1e-126   
emb|CDJ60085.1|  tubulin alpha chain, putative                          378   1e-126   
gb|EPR58771.1|  alpha tubulin TUBA1                                     378   1e-126   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                379   1e-126   
gb|AAU10519.1|  alpha tubulin                                           371   1e-126   
ref|XP_007015700.1|  Tubulin alpha-5, putative                          383   1e-126   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              379   1e-126   
ref|XP_001691876.1|  alpha tubulin 1                                    379   2e-126   
gb|AHJ80823.1|  Tua1                                                    379   2e-126   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             379   2e-126   
gb|EPY39349.1|  tubulin alpha                                           373   2e-126   
dbj|BAJ86161.1|  predicted protein                                      379   2e-126   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    379   2e-126   
dbj|BAJ06362.1|  alpha-tubulin                                          379   2e-126   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   379   2e-126   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              379   2e-126   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                379   2e-126   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              379   2e-126   
emb|CAA06619.1|  alpha-tubulin 1                                        379   2e-126   
ref|NP_001167663.1|  tubulin alpha-3 chain                              379   2e-126   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    379   2e-126   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          379   2e-126   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              378   2e-126   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   378   2e-126   
gb|AHJ80815.1|  Tua1                                                    378   2e-126   
gb|ABL61205.1|  alpha-tubulin                                           377   2e-126   
ref|NP_001275271.1|  alpha-tubulin-like protein                         378   2e-126   
gb|ABK92552.1|  unknown                                                 378   2e-126   
ref|XP_004985171.1|  PREDICTED: tubulin alpha-2 chain-like              378   2e-126   
gb|ABL61228.1|  alpha-tubulin                                           373   2e-126   
emb|CAD13176.1|  alpha-tubulin                                          378   2e-126   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             378   3e-126   
gb|ABL61209.1|  alpha-tubulin                                           377   3e-126   
gb|ABL61208.1|  alpha-tubulin                                           377   3e-126   
ref|XP_002465633.1|  hypothetical protein SORBIDRAFT_01g042650          378   3e-126   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              378   3e-126   
gb|AEF79970.1|  alpha-tubulin protein                                   378   3e-126   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              378   3e-126   
gb|ABL61206.1|  alpha-tubulin                                           377   3e-126   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     378   3e-126   
emb|CAL80740.1|  alpha-tubulin                                          378   3e-126   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              378   3e-126   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   378   3e-126   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                378   3e-126   
emb|CCI45804.1|  unnamed protein product                                378   3e-126   
ref|XP_002364807.1|  tubulin alpha chain                                378   3e-126   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              378   3e-126   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           378   3e-126   
tpg|DAA51109.1|  TPA: alpha tubulin                                     378   3e-126   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     378   3e-126   
gb|AAB81352.1|  alpha-tubulin                                           374   3e-126   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   378   3e-126   
gb|ABO47742.1|  alpha-tubulin                                           378   3e-126   
ref|XP_002675196.1|  alpha-tubulin                                      378   3e-126   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          378   3e-126   
gb|ABL61210.1|  alpha-tubulin                                           377   3e-126   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             378   3e-126   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                378   3e-126   
ref|XP_004489692.1|  PREDICTED: tubulin alpha-3 chain-like              378   3e-126   
gb|ABB02631.1|  unknown                                                 378   3e-126   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              378   3e-126   
gb|AAO73546.1|  alpha-tubulin                                           378   3e-126   
gb|ACH68563.1|  alpha-tubulin                                           378   3e-126   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     378   4e-126   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             378   4e-126   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              378   4e-126   
gb|ABP65320.1|  alpha tubulin                                           378   4e-126   
emb|CDJ53173.1|  tubulin alpha chain, putative                          378   4e-126   
gb|AAM69359.1|U65380_1  alpha tubulin                                   373   4e-126   



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   395 bits (1016),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+S+PEITNAVFEPSS
Sbjct  74   SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSS  133

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  134  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  193

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  194  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  253

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  254  AREDLAALEK  263



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   393 bits (1010),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  65   SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  124

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  125  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  184

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  185  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  244

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  245  AREDLAALEK  254



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   393 bits (1010),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  75   SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  134

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  135  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  194

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  195  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  254

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  255  AREDLAALEK  264



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   392 bits (1007),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  46   SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  105

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  106  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  165

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  166  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  225

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  226  AREDLAALEK  235



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   392 bits (1006),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEPSS
Sbjct  40   SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSS  99

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  100  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  159

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  160  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  219

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  220  AREDLAALEK  229



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   395 bits (1015),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  136  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  195

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  196  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  255

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  256  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  315

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  316  AREDLAALEK  325



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   397 bits (1020),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+SVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   395 bits (1014),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEPSS
Sbjct  196  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSS  255

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  256  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  315

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  316  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  375

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  376  AREDLAALEK  385



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSY+PVISS KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYSPVISSEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNS+VATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSSVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+S+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   390 bits (1003),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  111  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  170

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  171  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  230

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  231  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  290

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  291  AREDLAALEK  300



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   395 bits (1016),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   395 bits (1015),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+S+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  173  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  232

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINY+PP
Sbjct  233  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYEPP  292

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  293  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  352

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  353  AREDLAALEK  362



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   396 bits (1018),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEIT+AVFEPSS
Sbjct  274  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITSAVFEPSS  333

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  334  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  393

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  394  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  453

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  454  AREDLAALEK  463



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   395 bits (1015),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   390 bits (1003),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  111  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  170

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  171  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  230

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  231  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  290

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  291  AREDLAALEK  300



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   395 bits (1015),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+S+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   395 bits (1015),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   395 bits (1014),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   394 bits (1012),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  213  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  272

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  273  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  332

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  333  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  392

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  393  AREDLAALEK  402



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   393 bits (1010),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  192  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  251

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  252  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  311

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  312  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  371

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  372  AREDLAALEK  381



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT++VFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSSVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   395 bits (1014),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   395 bits (1014),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   395 bits (1014),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   395 bits (1014),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   395 bits (1014),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   395 bits (1014),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   394 bits (1013),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRID+KFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   394 bits (1013),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKA+HEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGI78243.1| alpha tubulin 5, partial [Caragana korshinskii]
Length=240

 Score =   387 bits (993),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQ+S+PEITNAVFEPSS
Sbjct  51   SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQISIPEITNAVFEPSS  110

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  111  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTKRTVQFVDWCPTGFKCGINYQPP  170

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+V RAVCMISNNTAVAEVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  171  TVVPGGDLAKVMRAVCMISNNTAVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEGEFSE  230

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  231  AREDLAALEK  240



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   391 bits (1004),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEPSS
Sbjct  157  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPSS  216

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  217  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  276

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+K AFVHWYVGEGMEEGEFSE
Sbjct  277  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKLAFVHWYVGEGMEEGEFSE  336

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  337  AREDLAALEK  346



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNT+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  252  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  311

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  312  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  371

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  372  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  431

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  432  AREDLAALEK  441



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  214  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  273

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  274  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  333

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  334  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  393

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  394  AREDLAALEK  403



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINY+PP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYEPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   392 bits (1007),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPE+TNAVFEPSS
Sbjct  191  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEVTNAVFEPSS  250

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDV+PKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  251  MMAKCDPRHGKYMACCLMYRGDVIPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  310

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  311  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  370

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  371  AREDLAALEK  380



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   394 bits (1013),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  259  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  318

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  319  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  378

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  379  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  438

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  439  AREDLAALEK  448



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKA+HEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKT+RTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTRRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGD+VPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDIVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNT+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR VQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVATIKTKRAVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQ+S+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQISIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQ+S+PEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQISIPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   393 bits (1010),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  250  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  309

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINY+PP
Sbjct  310  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYEPP  369

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  370  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  429

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  430  AREDLAALEK  439



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   393 bits (1009),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   393 bits (1009),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   393 bits (1009),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   393 bits (1009),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTESQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   393 bits (1009),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   392 bits (1008),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKA+HEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   392 bits (1008),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   392 bits (1008),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KA+HEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITN+VFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNSVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVP GDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPCGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLS PEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSGPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRID+KFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   382 bits (981),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  2    SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  61

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  62   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  121

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  122  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  181

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  182  AREDLAALEK  191



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAY EQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYREQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   382 bits (981),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  2    SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  61

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  62   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  121

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  122  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  181

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  182  AREDLAALEK  191



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHG+YMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGRYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN++VATIKTKRTVQFVDWCPTGFKCGINY+PP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTVQFVDWCPTGFKCGINYEPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN++VATIKTKRTVQFVDWCPTGFKCGINY+PP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTVQFVDWCPTGFKCGINYEPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQ+S+PEITNAVFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAQKAYHEQISIPEITNAVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   382 bits (981),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  1    SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  60

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  61   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  120

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  121  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  180

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  181  AREDLAALEK  190



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ SVPEIT +VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   387 bits (994),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  131  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  190

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  191  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  250

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  251  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  310

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  311  AREDLAALEK  320



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVF+PSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFDPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISN+TAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVF+PSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFDPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISN+TAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   382 bits (982),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KA+HEQLSV EITN+ FEPSS
Sbjct  8    SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSS  67

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  68   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  127

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  128  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  187

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  188  AREDLAALEK  197



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQ+SVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQISVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
             VVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  AVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ+SVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQISVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+V RAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVMRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   390 bits (1002),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KA+HEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLS+PEIT+AVFEP S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSIPEITSAVFEPGS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQ P
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQAP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAV EVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINV ITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLS+PEITNAVFEP+S
Sbjct  241  SLRFDGAINVAITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSIPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   382 bits (982),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  39   SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  98

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN++VATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  99   MMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPP  158

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TAVAEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  159  TVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  218

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  219  AREDLAALEK  228



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ+SVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQISVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+V RAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVMRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   380 bits (976),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSSM  577
            LRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSSM
Sbjct  1    LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSM  60

Query  576  MAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPPT  397
            MAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPPT
Sbjct  61   MAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPT  120

Query  396  VVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEA  217
            VVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEA
Sbjct  121  VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEA  180

Query  216  REDLAALEK  190
            REDLAALEK
Sbjct  181  REDLAALEK  189



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   383 bits (983),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  56   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  115

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  116  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  175

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  176  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  235

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  236  AREDLAALEK  245



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   389 bits (1000),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQ+SVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR VQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRAVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   384 bits (985),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  79   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSS  138

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  139  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  198

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  199  TVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  258

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  259  AREDLAALEK  268



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   382 bits (982),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  57   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  116

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  117  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  176

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  177  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  236

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  237  AREDLAALEK  246



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKA+HEQLSVPEIT +VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAFHEQLSVPEITTSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  152  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  211

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  212  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  271

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  272  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  331

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  332  AREDLAALEK  341



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ SVPEIT +VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA IKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVANIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIH MLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHLMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKAKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   379 bits (974),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+ E QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN  FEPSS
Sbjct  8    SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNTAFEPSS  67

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  68   MMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  127

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  128  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  187

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  188  AREDLAALEK  197



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITTAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDV PKDVN+AVATIKTKR VQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVAPKDVNTAVATIKTKRAVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARV+RAVCMISNNTAVAEVFSRIDHKFD+MY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVKRAVCMISNNTAVAEVFSRIDHKFDVMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   382 bits (980),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  61   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  120

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMA CLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  121  MMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  180

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISN +A+AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  181  TVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  240

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  241  AREDLAALEK  250



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRG+VVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGNVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGI YQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGIKYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVF RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFLRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITN+VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPK VN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKGVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNT VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTLVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVI + KAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVIPAEKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   378 bits (971),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  753  RFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSSMM  574
            RFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSSMM
Sbjct  1    RFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM  60

Query  573  AKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTV  394
            AKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPPTV
Sbjct  61   AKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV  120

Query  393  VPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAR  214
            VPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAR
Sbjct  121  VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAR  180

Query  213  EDLAALEK  190
            EDLAALEK
Sbjct  181  EDLAALEK  188



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEIT AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITTAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMA CLMYRGDVVPKDVN+AV TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMASCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   387 bits (995),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPS+
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVP GDLA+VQRAVCMISNNTAV EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPSGDLAKVQRAVCMISNNTAVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   380 bits (977),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  47   SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  106

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACC+MYRGDVVPKDVN++VATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  107  MMAKCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPP  166

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T++AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  167  TVVPGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  226

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  227  AREDLAALEK  236



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   378 bits (970),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTN  PYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  2    SLRFDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  61

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  62   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  121

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  122  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  181

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  182  AREDLAALEK  191



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   378 bits (970),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTN  PYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  1    SLRFDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  60

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  61   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  120

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  121  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  180

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  181  AREDLAALEK  190



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   380 bits (977),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+ E QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN  FEPSS
Sbjct  61   SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSS  120

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  121  MMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  180

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  181  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  240

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  241  AREDLAALEK  250



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   387 bits (994),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVI + KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVICAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKD N+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDDNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   387 bits (994),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            S RFDGAINVDITE QTNLVPYP IHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SFRFDGAINVDITEFQTNLVPYPSIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   380 bits (975),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KA+HEQLSV EITN+ FEP+S
Sbjct  39   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPAS  98

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  99   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPP  158

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  159  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  218

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  219  AREDLAALEK  228



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   387 bits (994),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAA EK
Sbjct  421  AREDLAAHEK  430



>ref|NP_176654.1| tubulin alpha-1 chain [Arabidopsis thaliana]
 sp|P11139.1|TBA1_ARATH RecName: Full=Tubulin alpha-1 chain [Arabidopsis thaliana]
 gb|AAD38249.1|AC006193_5 alpha1 tubulin [Arabidopsis thaliana]
 gb|AAA32880.1| alpha-1-tubulin [Arabidopsis thaliana]
 gb|AAL24085.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AAM14311.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AEE34279.1| tubulin alpha-1 chain [Arabidopsis thaliana]
Length=450

 Score =   387 bits (994),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ SVPEIT +VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA IK KRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVAAIKAKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKA+HEQLSVPEITNAVFEPSS
Sbjct  332  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAFHEQLSVPEITNAVFEPSS  391

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  392  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  451

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISNNTAV EVFSRI+HKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  452  TVVPGGDLARVQRAVCMISNNTAVVEVFSRINHKFDLMYAKRAFVHWYVGEGMEEGEFSE  511

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  512  AREDLAALEK  521



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   383 bits (984),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KA+HEQLSV EITN+ FEPSS
Sbjct  145  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSS  204

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  205  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  264

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  265  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  324

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  325  AREDLAALEK  334



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   378 bits (971),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+ E QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  17   SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  76

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLM+RGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  77   MMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  136

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQ+AVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  137  TVVPGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  196

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  197  AREDLAALEK  206



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ SV EIT +VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVSEITTSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA IKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVAAIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAP+IS+ KAYHEQLSV EITNA FEP+S
Sbjct  45   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNAAFEPAS  104

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  105  MMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  164

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+ E+FSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  165  TVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  224

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  225  AREDLAALEK  234



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN++V+ IK KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNASVSNIKAKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  206  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  265

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  266  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  325

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  326  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  385

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  386  AREDLAALEK  395



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   381 bits (979),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+ E QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  118  SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  177

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  178  MMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  237

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  238  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  297

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  298  AREDLAALEK  307



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHE +SVPEIT+ VFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEHISVPEITSVVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR VQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRAVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   378 bits (970),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+ E QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  33   SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  92

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  93   MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  152

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  153  SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  212

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  213  AREDLAALEK  222



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEITNAVFEP+S
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV   + KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGLSRLKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN++V+ IK KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNASVSNIKAKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>emb|CAM58978.1| alpha tubulin 5 [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   378 bits (970),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAP+IS+ KA+HEQ SVPEITN VFEPSS
Sbjct  39   SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAFHEQHSVPEITNTVFEPSS  98

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            +MAKCDPRHGKYMACCLMYRGDVVPKDVNSAV +IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  99   VMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVHSIKTKRTVQFVDWCPTGFKCGINYQPP  158

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+V+RAVCMISNNTAVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  159  TVVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSE  218

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  219  AREDLAALEK  228



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   384 bits (986),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  206  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  265

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  266  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  325

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  326  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  385

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  386  AREDLAALEK  395



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   385 bits (989),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            S+RFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SMRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCL+YRGDVVPKDVN+AVATIKTKRTVQFVDW PTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLIYRGDVVPKDVNAAVATIKTKRTVQFVDWRPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVP GDLA+VQRAVCMISNNTAVAEVF+RID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPAGDLAKVQRAVCMISNNTAVAEVFARIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AEE98361.1| alpha-tubulin [Deschampsia antarctica]
Length=254

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAP+IS+ KA+HEQ SVPEITN+VFEPSS
Sbjct  46   SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAFHEQHSVPEITNSVFEPSS  105

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            +MAKCDPRHGKYMACCLMYRGDVVPKDVN+AV +IKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct  106  VMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVHSIKTKRTVQFVDWCPTGFKCGINYQPP  165

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+V+RAVCMISNNTAVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  166  TVVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSE  225

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  226  AREDLAALEK  235



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   380 bits (975),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  97   SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  156

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  157  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  216

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRA+CMISN+T+VAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSE
Sbjct  217  TVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSE  276

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  277  AREDLAALEK  286



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   385 bits (988),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSV EITN  FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   385 bits (988),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSVPEITNAVFEPSS
Sbjct  241  SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKRTVQFVD CPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVVTIKTKRTVQFVDXCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLA LEK
Sbjct  421  AREDLAXLEK  430



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   384 bits (987),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLARVQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   379 bits (972),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP++
Sbjct  89   SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPAN  148

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  149  MMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  208

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+AEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  209  TVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSE  268

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  269  AREDLAALEK  278



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   376 bits (966),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHF+L+SYAPVIS+ KAYHEQLSV EI+NAVFEP+S
Sbjct  30   SLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPAS  89

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDW PTGFKCGINYQPP
Sbjct  90   MMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPP  149

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMI+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  150  TVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  209

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  210  AREDLAALEK  219



>gb|AGV54497.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=449

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  242  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  301

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN++V+ IK KRTVQFVDWCPTGFKCGINYQPP
Sbjct  302  MMAKCDPRHGKYMACCLMYRGDVVPKDVNASVSNIKAKRTVQFVDWCPTGFKCGINYQPP  361

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISNNTAVAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  362  TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  421

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  422  AREDLAALEK  431



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   377 bits (967),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHF+L+SYAPVIS+ KAYHEQLSV EI+NAVFEP+S
Sbjct  39   SLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPAS  98

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDW PTGFKCGINYQPP
Sbjct  99   MMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPP  158

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMI+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  159  TVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  218

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  219  AREDLAALEK  228



>prf||1503274A alpha1 tubulin
Length=450

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVISSAKAYHEQ SVPEIT +VFEPS+
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSN  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA IK KRT+QFVDWCPTGFKCGINYQ P
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVAAIKAKRTIQFVDWCPTGFKCGINYQQP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  222  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  281

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  282  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  341

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  342  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  401

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  402  AREDLAALEK  411



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   383 bits (983),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  207  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  266

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  267  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  326

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  327  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  386

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  387  AREDLAALEK  396



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSV EITN  FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGAINVDITE QTNLVPYPRIHFMLSSYAPVIS+AKAYHEQLSVPEIT+AVFEPSS
Sbjct  241  SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IK KRTVQFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKAKRTVQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVP GDLA+VQRAVCMISNNTAVAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPAGDLAKVQRAVCMISNNTAVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   379 bits (973),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP++
Sbjct  104  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPAN  163

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  164  MMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  223

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+AEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  224  TVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSE  283

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  284  AREDLAALEK  293



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   377 bits (967),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHF+L+SYAPVIS+ KAYHEQLSV EI+NAVFEP+S
Sbjct  47   SLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPAS  106

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDW PTGFKCGINYQPP
Sbjct  107  MMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPP  166

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMI+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  167  TVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  226

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  227  AREDLAALEK  236



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  213  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  272

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  273  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  332

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  333  SVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  392

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  393  AREDLAALEK  402



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  226  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  285

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  286  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  345

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  346  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  405

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  406  AREDLAALEK  415



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   382 bits (982),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  206  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  265

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  266  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPP  325

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  326  TVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  385

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  386  AREDLAALEK  395



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+ E QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  46   SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  105

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  106  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  165

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            +VVPGGDLA+VQRAVCMISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  166  SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  225

Query  219  AREDLAALEK  190
            AREDL ALEK
Sbjct  226  AREDLRALEK  235



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  185  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  244

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVAT+KTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  245  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPP  304

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  305  TVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  364

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  365  AREDLAALEK  374



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP++
Sbjct  40   SLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPAN  99

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFK GINYQPP
Sbjct  100  MMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPP  159

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  160  TVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  219

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  220  AREDLAALEK  229



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   374 bits (960),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  753  RFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSSMM  574
            RFDGA+NVD+TE QTN  PYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSSMM
Sbjct  1    RFDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM  60

Query  573  AKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTV  394
            AKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPPTV
Sbjct  61   AKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTV  120

Query  393  VPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAR  214
            VPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAR
Sbjct  121  VPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAR  180

Query  213  EDLAALEK  190
            EDLAALEK
Sbjct  181  EDLAALEK  188



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   378 bits (971),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHF+L+SYAPVIS+ KAYHEQLSV EI+NAVFEP+S
Sbjct  93   SLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPAS  152

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDW PTGFKCGINYQPP
Sbjct  153  MMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPP  212

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMI+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  213  TVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  272

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  273  AREDLAALEK  282



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVDITE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP++
Sbjct  104  SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPAN  163

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  164  MMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  223

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+TA+AEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  224  TVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSE  283

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  284  AREDLAALEK  293



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV E TN+ FEPSS
Sbjct  171  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAETTNSAFEPSS  230

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            +MAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  231  LMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  290

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T +AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  291  TVVPGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  350

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  351  AREDLAALEK  360



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   384 bits (985),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEP+S
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -1

Query  759  SLRFDGAINVDITEXQTNLVPYPRIHFMLSSYAPVISSAKAYHEQLSVPEITNAVFEPSS  580
            SLRFDGA+NVD+TE QTNLVPYPRIHFMLSSYAPVIS+ KAYHEQLSV EITN+ FEPSS
Sbjct  241  SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS  300

Query  579  MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPP  400
            MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct  301  MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP  360

Query  399  TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE  220
            TVVPGGDLA+VQRAVCMISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct  361  TVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE  420

Query  219  AREDLAALEK  190
            AREDLAALEK
Sbjct  421  AREDLAALEK  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470