BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022N08

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               335   6e-109   
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    334   7e-109   Solanum tuberosum [potatoes]
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    334   7e-109   Solanum lycopersicum
ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    332   8e-108   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    332   1e-107   Nicotiana sylvestris
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    328   3e-106   Theobroma cacao [chocolate]
ref|NP_001047064.2|  Os02g0541300                                       317   8e-106   
ref|XP_010108654.1|  Histidine decarboxylase                            325   3e-105   Morus notabilis
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               323   2e-104   
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     323   3e-104   Eucalyptus grandis [rose gum]
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               322   3e-104   Nelumbo nucifera [Indian lotus]
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                322   3e-104   Erythranthe guttata [common monkey flower]
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          323   3e-104   Sorghum bicolor [broomcorn]
emb|CDP11372.1|  unnamed protein product                                318   8e-104   Coffea canephora [robusta coffee]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            321   1e-103   
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               320   2e-103   Nelumbo nucifera [Indian lotus]
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            320   4e-103   Setaria italica
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            319   5e-103   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86197.1|  hypothetical protein OsI_07573                          318   8e-103   Oryza sativa Indica Group [Indian rice]
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   318   1e-102   Citrus sinensis [apfelsine]
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    318   1e-102   Citrus sinensis [apfelsine]
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  318   1e-102   Elaeis guineensis
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  317   2e-102   Brachypodium distachyon [annual false brome]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             317   2e-102   Citrus clementina [clementine]
ref|XP_002306690.1|  serine decarboxylase family protein                317   3e-102   Populus trichocarpa [western balsam poplar]
gb|KDP43008.1|  hypothetical protein JCGZ_25194                         317   3e-102   Jatropha curcas
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  317   3e-102   Brachypodium distachyon [annual false brome]
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    317   4e-102   Fragaria vesca subsp. vesca
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               316   6e-102   Populus euphratica
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             317   6e-102   Eutrema salsugineum [saltwater cress]
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               315   8e-102   Populus euphratica
gb|KJB16470.1|  hypothetical protein B456_002G231300                    316   1e-101   Gossypium raimondii
gb|KJB16469.1|  hypothetical protein B456_002G231300                    315   1e-101   Gossypium raimondii
gb|KJB16468.1|  hypothetical protein B456_002G231300                    315   1e-101   Gossypium raimondii
gb|KHG24953.1|  Histidine decarboxylase                                 315   1e-101   Gossypium arboreum [tree cotton]
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             315   2e-101   
ref|XP_002533017.1|  group II plp decarboxylase, putative               315   2e-101   Ricinus communis
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             315   2e-101   Prunus persica
emb|CBI18554.3|  unnamed protein product                                313   2e-101   Vitis vinifera
dbj|BAE07183.1|  putative serine decarboxylase                          315   2e-101   Beta vulgaris [beet]
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             317   2e-101   
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             315   3e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS66281.1|  serine decarboxylase                                    313   3e-101   Genlisea aurea
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    315   3e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               315   3e-101   Tarenaya hassleriana [spider flower]
ref|XP_002302186.1|  serine decarboxylase family protein                314   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    314   6e-101   Vitis vinifera
gb|AFK28264.1|  putative serine decarboxylase                           305   6e-101   Helianthus paradoxus
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            313   8e-101   Prunus mume [ume]
ref|XP_004140972.1|  PREDICTED: histidine decarboxylase-like isof...    313   1e-100   Cucumis sativus [cucumbers]
ref|XP_004140971.1|  PREDICTED: histidine decarboxylase-like isof...    313   1e-100   
gb|KJB59412.1|  hypothetical protein B456_009G253400                    312   2e-100   Gossypium raimondii
gb|AFK28277.1|  putative serine decarboxylase                           304   2e-100   Helianthus petiolaris
ref|NP_175036.1|  serine decarboxylase 1                                312   2e-100   Arabidopsis thaliana [mouse-ear cress]
emb|CAN70523.1|  hypothetical protein VITISV_034634                     312   2e-100   Vitis vinifera
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               312   3e-100   Brassica rapa
gb|KJB59411.1|  hypothetical protein B456_009G253400                    312   3e-100   Gossypium raimondii
gb|KHG04394.1|  Histidine decarboxylase                                 311   3e-100   Gossypium arboreum [tree cotton]
gb|KJB59410.1|  hypothetical protein B456_009G253400                    311   4e-100   Gossypium raimondii
emb|CDY41717.1|  BnaA09g15450D                                          311   4e-100   Brassica napus [oilseed rape]
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               312   4e-100   Brassica rapa
gb|AFK28270.1|  putative serine decarboxylase                           303   4e-100   Helianthus deserticola
gb|AFK28253.1|  putative serine decarboxylase                           303   5e-100   Helianthus argophyllus
gb|AFK28279.1|  putative serine decarboxylase                           303   5e-100   Helianthus petiolaris
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               311   5e-100   Camelina sativa [gold-of-pleasure]
gb|AFK28256.1|  putative serine decarboxylase                           303   6e-100   Helianthus annuus
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               311   6e-100   Camelina sativa [gold-of-pleasure]
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      311   8e-100   
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      311   8e-100   Cucumis melo [Oriental melon]
gb|AFK28260.1|  putative serine decarboxylase                           302   9e-100   Helianthus annuus
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  311   9e-100   Phoenix dactylifera
gb|AFK28281.1|  putative serine decarboxylase                           302   1e-99    Helianthus debilis [cucumberleaf sunflower]
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            310   1e-99    
emb|CDX80723.1|  BnaC08g05570D                                          311   1e-99    
dbj|BAA78331.1|  serine decarboxylase                                   311   1e-99    Brassica napus [oilseed rape]
gb|AFK28257.1|  putative serine decarboxylase                           302   1e-99    Helianthus annuus
ref|XP_002893962.1|  EMB1075                                            310   2e-99    
gb|AFK28271.1|  putative serine decarboxylase                           302   2e-99    Helianthus anomalus
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             312   2e-99    
gb|AFK28261.1|  putative serine decarboxylase                           302   2e-99    Helianthus annuus
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    310   2e-99    Camelina sativa [gold-of-pleasure]
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    308   2e-99    
gb|AFK28262.1|  putative serine decarboxylase                           301   2e-99    Helianthus annuus
gb|AFK28273.1|  putative serine decarboxylase                           301   2e-99    Helianthus anomalus
gb|AFK28254.1|  putative serine decarboxylase                           301   3e-99    Helianthus argophyllus
gb|AFK28287.1|  putative serine decarboxylase                           301   3e-99    Helianthus bolanderi
emb|CDY48944.1|  BnaA08g04700D                                          310   3e-99    Brassica napus [oilseed rape]
gb|AFK28267.1|  putative serine decarboxylase                           301   5e-99    Helianthus deserticola
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    310   5e-99    Tarenaya hassleriana [spider flower]
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            309   7e-99    Zea mays [maize]
gb|AFK28272.1|  putative serine decarboxylase                           300   8e-99    Helianthus anomalus
gb|AFK28291.1|  putative serine decarboxylase                           300   1e-98    Helianthus niveus
emb|CDY59264.1|  BnaC09g51700D                                          307   1e-98    Brassica napus [oilseed rape]
gb|AFK28269.1|  putative serine decarboxylase                           299   2e-98    Helianthus deserticola
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               306   3e-98    
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               306   3e-98    Pyrus x bretschneideri [bai li]
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               306   7e-98    Arabis alpina [alpine rockcress]
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    306   7e-98    Brassica rapa
gb|AFK39410.1|  unknown                                                 300   7e-98    Medicago truncatula
ref|XP_003593129.1|  Histidine decarboxylase                            306   1e-97    Medicago truncatula
emb|CDY30753.1|  BnaC05g51500D                                          305   1e-97    Brassica napus [oilseed rape]
ref|XP_006854520.1|  hypothetical protein AMTR_s00030p00012550          305   2e-97    Amborella trichopoda
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            304   3e-97    Malus domestica [apple tree]
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             303   3e-97    Prunus persica
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 304   3e-97    Malus domestica [apple tree]
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               304   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    304   4e-97    Cicer arietinum [garbanzo]
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             304   5e-97    Phaseolus vulgaris [French bean]
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            303   6e-97    Prunus mume [ume]
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             302   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             302   2e-96    Nelumbo nucifera [Indian lotus]
gb|ACJ85197.1|  unknown                                                 301   5e-96    Medicago truncatula
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    300   6e-96    Glycine max [soybeans]
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    300   8e-96    Glycine max [soybeans]
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    301   8e-96    
gb|KHN39188.1|  Histidine decarboxylase                                 300   9e-96    Glycine soja [wild soybean]
ref|NP_001241244.1|  uncharacterized protein LOC100795577               297   2e-94    Glycine max [soybeans]
gb|KHN26720.1|  Histidine decarboxylase                                 297   3e-94    Glycine soja [wild soybean]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 296   5e-94    Glycine max [soybeans]
gb|AFA36595.1|  putative serine decarboxylase                           284   3e-92    Lolium perenne [perennial ryegrass]
gb|AFK28252.1|  putative serine decarboxylase                           282   4e-92    Helianthus agrestis
ref|XP_001761266.1|  predicted protein                                  287   7e-91    
ref|XP_001754291.1|  predicted protein                                  278   2e-87    
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             277   7e-87    
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               276   9e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               276   1e-86    
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             276   2e-86    
gb|EMT14427.1|  Histidine decarboxylase                                 270   5e-84    
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             267   7e-83    Brachypodium distachyon [annual false brome]
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               259   1e-79    Solanum lycopersicum
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            258   1e-79    Solanum tuberosum [potatoes]
gb|KEH26769.1|  serine decarboxylase                                    248   3e-79    Medicago truncatula
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    256   7e-79    
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    256   9e-79    
ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            256   1e-78    Nicotiana sylvestris
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    256   1e-78    Nicotiana sylvestris
gb|AES76141.2|  serine decarboxylase                                    249   1e-78    Medicago truncatula
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            255   3e-78    Solanum lycopersicum
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            254   5e-78    Nicotiana tomentosiformis
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            254   6e-78    Nicotiana tomentosiformis
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    254   1e-77    Solanum tuberosum [potatoes]
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    254   1e-77    Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    253   1e-77    
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            252   2e-77    Solanum lycopersicum
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            253   3e-77    Solanum tuberosum [potatoes]
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            252   4e-77    Solanum tuberosum [potatoes]
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 252   4e-77    Solanum lycopersicum
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            252   4e-77    
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            251   9e-77    Solanum tuberosum [potatoes]
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                251   1e-76    Solanum lycopersicum
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            250   1e-76    
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            250   2e-76    Solanum tuberosum [potatoes]
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    249   3e-76    Sesamum indicum [beniseed]
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               250   3e-76    
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    250   3e-76    Sesamum indicum [beniseed]
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            249   4e-76    Solanum lycopersicum
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            248   8e-76    Solanum tuberosum [potatoes]
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            245   1e-74    Solanum lycopersicum
gb|KHN16991.1|  Histidine decarboxylase                                 244   2e-74    Glycine soja [wild soybean]
ref|XP_003619923.1|  L-tyrosine decarboxylase                           243   2e-74    
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            246   2e-74    
gb|EMS49846.1|  Histidine decarboxylase                                 241   2e-74    Triticum urartu
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            243   3e-74    
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            243   6e-74    
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            243   6e-74    Glycine max [soybeans]
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            242   2e-73    Solanum tuberosum [potatoes]
ref|XP_003607344.1|  Serine decarboxylase                               234   2e-73    
gb|AES89541.2|  serine decarboxylase                                    234   3e-73    Medicago truncatula
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               242   3e-73    Sesamum indicum [beniseed]
gb|ACU18860.1|  unknown                                                 231   3e-73    Glycine max [soybeans]
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            240   1e-72    Oryza brachyantha
gb|KCW44086.1|  hypothetical protein EUGRSUZ_L02502                     233   1e-72    Eucalyptus grandis [rose gum]
gb|EAY77466.1|  hypothetical protein OsI_32510                          240   1e-72    Oryza sativa Indica Group [Indian rice]
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            240   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003607341.1|  Embryo defective 1075-like protein                 239   2e-72    
ref|XP_003592126.1|  Histidine decarboxylase                            238   8e-72    
gb|AHG12639.1|  histidine decarboxylase                                 234   2e-70    Nicotiana tabacum [American tobacco]
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            234   2e-70    Nicotiana sylvestris
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    233   3e-70    Nicotiana tomentosiformis
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     233   4e-70    Nicotiana tabacum [American tobacco]
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    233   6e-70    
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    232   9e-70    
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            232   9e-70    Nicotiana sylvestris
ref|NP_001242861.1|  uncharacterized protein LOC100792053               232   1e-69    
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                229   2e-69    Erythranthe guttata [common monkey flower]
ref|XP_002953989.1|  serine decarboxylase                               231   7e-69    Volvox carteri f. nagariensis
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            229   2e-68    Cicer arietinum [garbanzo]
ref|XP_001689659.1|  serine decarboxylase                               225   7e-68    Chlamydomonas reinhardtii
ref|XP_011401256.1|  Histidine decarboxylase                            228   8e-68    Auxenochlorella protothecoides
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              228   8e-68    Chlorella variabilis
ref|XP_003592128.1|  Embryo defective 1075-like protein                 227   1e-67    
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            225   4e-67    Nicotiana tomentosiformis
gb|EYU40386.1|  hypothetical protein MIMGU_mgv1a026369mg                219   2e-66    Erythranthe guttata [common monkey flower]
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            222   6e-66    
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            222   6e-66    
gb|KDD76585.1|  hypothetical protein H632_c172p0                        223   8e-66    Helicosporidium sp. ATCC 50920
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               221   1e-65    
ref|XP_006362640.1|  PREDICTED: histidine decarboxylase-like            218   3e-65    
gb|EMS65243.1|  Histidine decarboxylase                                 218   4e-65    Triticum urartu
gb|KEH43660.1|  serine decarboxylase                                    221   1e-64    Medicago truncatula
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                218   1e-64    Erythranthe guttata [common monkey flower]
gb|AES62380.2|  serine decarboxylase                                    218   2e-64    Medicago truncatula
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            218   2e-64    Solanum lycopersicum
ref|XP_003592129.1|  Serine decarboxylase                               218   2e-64    
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                218   3e-64    Erythranthe guttata [common monkey flower]
gb|KIZ00141.1|  histidine decarboxylase                                 218   1e-63    Monoraphidium neglectum
gb|EEC76705.1|  hypothetical protein OsI_14710                          215   2e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          216   4e-63    Sorghum bicolor [broomcorn]
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            214   5e-63    Solanum lycopersicum
gb|EEE60437.1|  hypothetical protein OsJ_13648                          210   2e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            213   3e-62    Oryza brachyantha
ref|XP_005646136.1|  serine decarboxylase                               210   5e-62    Coccomyxa subellipsoidea C-169
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 211   1e-61    Solanum lycopersicum
ref|XP_003592132.1|  FAR1-related protein                               220   1e-61    
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            211   1e-61    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001234136.1|  histidine decarboxylase                            207   2e-60    
gb|AEW07461.1|  hypothetical protein 0_2106_01                          197   7e-60    Pinus radiata
gb|AFG54679.1|  hypothetical protein 0_2106_01                          196   4e-59    Pinus taeda
ref|XP_009609584.1|  PREDICTED: histidine decarboxylase-like            197   5e-58    
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             201   1e-57    Phaseolus vulgaris [French bean]
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             201   3e-57    Phaseolus vulgaris [French bean]
ref|XP_002292250.1|  histidine decarboxylase                            191   1e-54    Thalassiosira pseudonana CCMP1335
ref|XP_002178784.1|  predicted protein                                  188   1e-53    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_004364837.2|  serine decarboxylase                               190   3e-52    Capsaspora owczarzaki ATCC 30864
gb|KJE90702.1|  serine decarboxylase                                    190   4e-52    Capsaspora owczarzaki ATCC 30864
ref|XP_002679079.1|  predicted protein                                  184   2e-51    Naegleria gruberi strain NEG-M
ref|XP_003593127.1|  Histidine decarboxylase                            163   7e-47    
ref|WP_026730962.1|  histidine decarboxylase                            157   8e-42    
ref|WP_040468965.1|  histidine decarboxylase                            146   1e-39    
ref|WP_017312078.1|  histidine decarboxylase                            152   1e-39    Fischerella sp. PCC 9339
ref|WP_015112001.1|  Histidine decarboxylase                            151   2e-39    Nostoc sp. PCC 7107
ref|WP_016859640.1|  histidine decarboxylase                            150   7e-39    Fischerella muscicola
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         154   8e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940             147   4e-38    Guillardia theta CCMP2712
ref|WP_016870188.1|  histidine decarboxylase                            147   4e-38    Fischerella muscicola
ref|WP_026721610.1|  histidine decarboxylase                            147   5e-38    Fischerella sp. PCC 9431
ref|WP_009455225.1|  histidine decarboxylase                            146   9e-38    Fischerella thermalis
ref|WP_012408195.1|  histidine decarboxylase                            146   1e-37    Nostoc punctiforme
ref|WP_025665600.1|  histidine decarboxylase                            143   2e-36    Aquimarina megaterium
ref|WP_034238501.1|  histidine decarboxylase                            142   3e-36    Aquimarina atlantica
gb|EZH75803.1|  histidine decarboxylase                                 142   3e-36    Aquimarina atlantica
gb|KCW71157.1|  hypothetical protein EUGRSUZ_F04254                     133   8e-36    Eucalyptus grandis [rose gum]
ref|WP_035090976.1|  histidine decarboxylase                            140   1e-35    Aquimarina macrocephali
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                  140   2e-35    
ref|WP_026731780.1|  histidine decarboxylase                            139   3e-35    
ref|WP_003516909.1|  histidine decarboxylase                            139   6e-35    Hungateiclostridium thermocellum
ref|WP_020457998.1|  histidine decarboxylase                            139   6e-35    Hungateiclostridium thermocellum
ref|WP_023062889.1|  histidine decarboxylase                            139   6e-35    Hungateiclostridium thermocellum
ref|WP_003514849.1|  histidine decarboxylase                            139   6e-35    Hungateiclostridium thermocellum
ref|NP_001176002.1|  Os10g0105700                                       135   7e-35    
ref|WP_017497877.1|  histidine decarboxylase                            137   2e-34    Flavobacterium sp. WG21
ref|WP_014680621.1|  histidine decarboxylase                            136   5e-34    Solitalea canadensis
ref|WP_004156018.1|  histidine decarboxylase                            135   1e-33    Microscilla marina
ref|WP_027411177.1|  histidine decarboxylase                            135   2e-33    Aquimarina muelleri
ref|WP_034760693.1|  histidine decarboxylase                            134   3e-33    Chryseobacterium sp. OV259
gb|EMT14424.1|  Histidine decarboxylase                                 135   4e-33    
ref|WP_024740708.1|  histidine decarboxylase                            134   5e-33    Tenacibaculum maritimum
ref|WP_038505799.1|  histidine decarboxylase                            133   6e-33    Cellulophaga lytica
ref|WP_013621330.1|  histidine decarboxylase                            133   6e-33    Cellulophaga lytica
ref|WP_034646581.1|  histidine decarboxylase                            133   7e-33    Cellulophaga
gb|EYU24758.1|  hypothetical protein MIMGU_mgv1a026373mg                131   8e-33    Erythranthe guttata [common monkey flower]
ref|WP_042506313.1|  histidine decarboxylase                            132   2e-32    Algibacter lectus
ref|WP_043706361.1|  histidine decarboxylase                            131   4e-32    
ref|WP_007138876.1|  histidine decarboxylase                            130   1e-31    Flavobacterium frigoris
dbj|BAH97114.1|  amino acid decarboxylase                               129   1e-31    Naegleria fowleri [brain-eating amoeba]
ref|WP_015192440.1|  Histidine decarboxylase                            131   1e-31    Stanieria cyanosphaera
ref|WP_014680343.1|  histidine decarboxylase                            130   2e-31    Solitalea canadensis
ref|WP_038006112.1|  histidine decarboxylase                            129   2e-31    Tenacibaculum sp. 47A_GOM-205m
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                  129   3e-31    Rhodobacter sp. SW2
ref|WP_036288070.1|  histidine decarboxylase                            129   3e-31    
ref|WP_040295065.1|  hypothetical protein                               128   4e-31    
ref|WP_026632650.1|  histidine decarboxylase                            128   5e-31    Dyadobacter alkalitolerans
gb|KIX22111.1|  histidine decarboxylase                                 128   5e-31    Flavobacterium sp. 316
ref|WP_013663956.1|  histidine decarboxylase                            128   5e-31    Sphingobacterium sp. 21
gb|KFF73912.1|  histidine decarboxylase                                 128   5e-31    Chryseobacterium sp. P1-3
ref|WP_026815498.1|  histidine decarboxylase                            128   5e-31    
gb|EIJ41099.1|  PLP-dependent enzyme, glutamate decarboxylase           128   6e-31    Beggiatoa alba B18LD
ref|WP_037437993.1|  histidine decarboxylase                            127   9e-31    Pedobacter antarcticus
ref|WP_025146293.1|  histidine decarboxylase                            127   1e-30    Pedobacter jeongneungensis
ref|WP_029274788.1|  histidine decarboxylase                            127   1e-30    
ref|WP_019504461.1|  hypothetical protein                               128   1e-30    
ref|WP_042499973.1|  histidine decarboxylase                            127   2e-30    
ref|WP_039116802.1|  histidine decarboxylase                            127   2e-30    
ref|WP_028889574.1|  histidine decarboxylase                            126   2e-30    
ref|XP_008620940.1|  histidine decarboxylase                            126   4e-30    
ref|WP_041885112.1|  histidine decarboxylase                            125   4e-30    
gb|AFY36874.1|  Histidine decarboxylase                                 128   5e-30    
ref|WP_039472909.1|  histidine decarboxylase                            125   6e-30    
ref|WP_041764715.1|  hypothetical protein                               125   9e-30    
ref|WP_009963501.1|  histidine decarboxylase                            124   1e-29    
ref|WP_014201338.1|  histidine decarboxylase                            124   2e-29    
ref|WP_011142216.1|  histidine decarboxylase                            124   2e-29    
ref|WP_040574889.1|  hypothetical protein                               123   2e-29    
gb|KDO21825.1|  hypothetical protein SPRG_12642                         124   2e-29    
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          124   3e-29    
ref|WP_010473064.1|  histidine decarboxylase                            124   4e-29    
ref|WP_026362388.1|  histidine decarboxylase                            122   4e-29    
ref|WP_012166190.1|  histidine decarboxylase                            124   5e-29    
ref|WP_038239506.1|  histidine decarboxylase                            122   6e-29    
ref|WP_041881750.1|  histidine decarboxylase                            122   7e-29    
ref|WP_036146264.1|  histidine decarboxylase                            122   9e-29    
ref|WP_038863593.1|  histidine decarboxylase                            121   2e-28    
gb|KGR35339.1|  histidine decarboxylase                                 120   3e-28    
ref|WP_005427952.1|  histidine decarboxylase                            120   3e-28    
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                  120   3e-28    
ref|WP_038170807.1|  histidine decarboxylase                            120   3e-28    
gb|KHN17002.1|  Histidine decarboxylase                                 121   4e-28    
ref|WP_038528108.1|  histidine decarboxylase                            120   4e-28    
ref|WP_012127831.1|  histidine decarboxylase                            119   7e-28    
ref|WP_038890337.1|  histidine decarboxylase                            119   9e-28    
ref|WP_005533429.1|  histidine decarboxylase                            119   9e-28    
ref|WP_010913856.1|  histidine decarboxylase                            119   1e-27    
ref|WP_018151708.1|  hypothetical protein                               119   1e-27    
ref|WP_033002296.1|  histidine decarboxylase                            119   1e-27    
ref|WP_010647516.1|  histidine decarboxylase                            118   2e-27    
ref|WP_017055794.1|  histidine decarboxylase                            118   2e-27    
gb|AGT16577.1|  histidine decarboxylase-like protein                    118   2e-27    
ref|WP_013995757.1|  histidine decarboxylase                            117   3e-27    
gb|EIJ36795.1|  Pyridoxal-dependent decarboxylase                       117   3e-27    
ref|WP_016529303.1|  histidine decarboxylase                            117   4e-27    
ref|WP_038267770.1|  histidine decarboxylase                            117   5e-27    
ref|WP_028892147.1|  histidine decarboxylase                            116   9e-27    
ref|WP_020977926.1|  histidine decarboxylase                            115   2e-26    
ref|WP_011154645.1|  histidine decarboxylase                            115   3e-26    
ref|WP_009841733.1|  histidine decarboxylase                            115   3e-26    
ref|XP_009600053.1|  PREDICTED: histidine decarboxylase-like            112   4e-26    
ref|WP_004737502.1|  histidine decarboxylase                            114   4e-26    
ref|WP_010181748.1|  histidine decarboxylase                            114   5e-26    
gb|KDW84254.1|  hypothetical protein AC70_4802                          109   7e-26    
dbj|GAJ47127.1|  histidine decarboxylase                                113   8e-26    
gb|ABR25820.1|  histidine decarboxylase                                 107   9e-26    
ref|WP_013661870.1|  histidine decarboxylase                            113   1e-25    
gb|KIP17071.1|  histidine decarboxylase                                 113   1e-25    
ref|WP_042585292.1|  histidine decarboxylase                            113   1e-25    
ref|WP_043144304.1|  histidine decarboxylase                            112   2e-25    
ref|WP_042467211.1|  histidine decarboxylase                            113   2e-25    
ref|WP_034524496.1|  histidine decarboxylase                            112   2e-25    
gb|EQC02399.1|  histidine decarboxylase                                 112   2e-25    
gb|ABO92295.1|  histidine decarboxylase                                 112   2e-25    
ref|WP_034281999.1|  histidine decarboxylase                            112   2e-25    
ref|WP_040841268.1|  hypothetical protein                               112   2e-25    
gb|EHI50832.1|  histidine decarboxylase                                 112   2e-25    
emb|CCJ09762.1|  putative histidine decarboxylase-like                  105   3e-25    
emb|CAN84646.1|  histidine decarboxylase                                112   4e-25    
ref|WP_042556656.1|  histidine decarboxylase                            111   7e-25    
ref|WP_004863422.1|  histidine decarboxylase                            110   1e-24    
ref|WP_012069347.1|  histidine decarboxylase                            110   2e-24    
ref|WP_010521317.1|  histidine decarboxylase                            110   2e-24    
ref|WP_043592636.1|  histidine decarboxylase                            110   2e-24    
ref|WP_043639836.1|  histidine decarboxylase                            110   2e-24    
gb|EFA28401.1|  histidine decarboxylase                                 106   2e-24    
ref|WP_022551512.1|  Histidine decarboxylase                            109   2e-24    
ref|WP_005788362.1|  histidine decarboxylase                            109   2e-24    
ref|WP_036985757.1|  histidine decarboxylase                            109   2e-24    
ref|WP_031316740.1|  histidine decarboxylase                            108   3e-24    
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase              108   4e-24    
ref|WP_005692801.1|  histidine decarboxylase                            108   4e-24    
ref|WP_026037108.1|  histidine decarboxylase                            108   5e-24    
ref|WP_029661164.1|  hypothetical protein                               108   6e-24    
ref|WP_034119545.1|  histidine decarboxylase                            108   6e-24    
ref|WP_026948110.1|  hypothetical protein                               108   7e-24    
ref|WP_039045861.1|  histidine decarboxylase                            107   1e-23    
ref|WP_010864579.1|  histidine decarboxylase                            107   1e-23    
ref|WP_005301029.1|  histidine decarboxylase                            107   1e-23    
dbj|BAE94285.1|  histidine decarboxylase                                107   1e-23    
ref|WP_022610851.1|  Histidine decarboxylase                            107   2e-23    
ref|WP_022589616.1|  Histidine decarboxylase                            107   2e-23    
dbj|GAD76103.1|  hypothetical protein VAZ01S_036_00470                  107   2e-23    
ref|WP_030334778.1|  histidine decarboxylase                            107   2e-23    
ref|WP_004401828.1|  histidine decarboxylase                            107   2e-23    
ref|WP_033003777.1|  histidine decarboxylase                            107   2e-23    
gb|KJF87341.1|  histidine decarboxylase                                 104   2e-23    
ref|WP_025468757.1|  histidine decarboxylase                            103   5e-23    
gb|EMU06553.1|  histidine decarboxylase                                 103   5e-23    
ref|WP_018788874.1|  histidine decarboxylase                            105   8e-23    
ref|WP_002058887.1|  histidine decarboxylase                            105   1e-22    
ref|WP_005138337.1|  histidine decarboxylase                            104   1e-22    
ref|WP_011533709.1|  histidine decarboxylase                            104   1e-22    
ref|WP_032037888.1|  histidine decarboxylase                            104   1e-22    
ref|WP_005131724.1|  histidine decarboxylase                            104   1e-22    
ref|WP_018788565.1|  histidine decarboxylase                            103   2e-22    
ref|WP_023221881.1|  histidine decarboxylase                            103   2e-22    
ref|WP_023248740.1|  histidine decarboxylase                            103   3e-22    
ref|WP_001750840.1|  histidine decarboxylase                            103   3e-22    
ref|WP_020302734.1|  histidine decarboxylase                            103   3e-22    
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase              103   3e-22    
ref|WP_019817102.1|  histidine decarboxylase                            103   3e-22    
ref|WP_005196164.1|  histidine decarboxylase                            103   3e-22    
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...    103   3e-22    
gb|AAA25071.1|  histidine decarboxylase                                 103   3e-22    
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase              103   4e-22    
ref|WP_036558522.1|  histidine decarboxylase                            103   4e-22    
ref|WP_000603877.1|  histidine decarboxylase                            102   5e-22    
ref|WP_024436628.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000603871.1|  histidine decarboxylase                            102   5e-22    
ref|WP_011859800.1|  histidine decarboxylase                            102   5e-22    
gb|KJG27749.1|  histidine decarboxylase                                 102   5e-22    
ref|WP_030424673.1|  histidine decarboxylase                            102   5e-22    
ref|WP_033847713.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603865.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603872.1|  histidine decarboxylase                            102   6e-22    
ref|WP_039759067.1|  histidine decarboxylase                            102   6e-22    
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase              102   6e-22    
ref|WP_004746555.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032027924.1|  histidine decarboxylase                            102   6e-22    
ref|WP_017815795.1|  histidine decarboxylase                            102   6e-22    
ref|WP_024433575.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032060642.1|  histidine decarboxylase                            102   6e-22    
ref|WP_031965236.1|  histidine decarboxylase                            102   6e-22    
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase              102   6e-22    
ref|WP_000603880.1|  histidine decarboxylase                            102   6e-22    
ref|WP_043188769.1|  histidine decarboxylase                            102   6e-22    
ref|WP_031955420.1|  histidine decarboxylase                            102   6e-22    
ref|WP_031995260.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032017576.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603869.1|  histidine decarboxylase                            102   6e-22    
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase              102   6e-22    
ref|WP_032058746.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603861.1|  histidine decarboxylase                            102   6e-22    
ref|WP_044101067.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032045777.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032001354.1|  histidine decarboxylase                            102   6e-22    
ref|WP_023896388.1|  Histidine decarboxylase                            102   6e-22    
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase              102   6e-22    
ref|WP_016653750.1|  histidine decarboxylase                            102   6e-22    
ref|WP_031993225.1|  histidine decarboxylase                            102   6e-22    
ref|WP_004840538.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000927250.1|  histidine decarboxylase                            102   6e-22    
ref|WP_031978061.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603876.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603882.1|  histidine decarboxylase                            102   6e-22    
ref|WP_039098800.1|  histidine decarboxylase                            102   6e-22    
ref|WP_021511013.1|  histidine decarboxylase                            102   6e-22    
gb|KJG35078.1|  histidine decarboxylase                                 102   6e-22    
ref|WP_005109677.1|  histidine decarboxylase                            102   6e-22    
ref|WP_038349211.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032009129.1|  histidine decarboxylase                            102   7e-22    
ref|WP_032004531.1|  histidine decarboxylase                            102   8e-22    
ref|WP_005073362.1|  histidine decarboxylase                            102   8e-22    
gb|AAO65983.1|  putative pyridoxal 5' phosphate-dependent histidi...    102   8e-22    
ref|WP_002132193.1|  histidine decarboxylase                            102   8e-22    
dbj|BAE94284.1|  histidine decarboxylase                                102   8e-22    
ref|WP_002046800.1|  histidine decarboxylase                            102   8e-22    
ref|WP_000603881.1|  histidine decarboxylase                            102   8e-22    
ref|WP_000603863.1|  histidine decarboxylase                            102   8e-22    
ref|WP_002126558.1|  histidine decarboxylase                            102   8e-22    
ref|WP_031948968.1|  histidine decarboxylase                            102   8e-22    
ref|WP_000603864.1|  histidine decarboxylase                            102   9e-22    
ref|WP_004639823.1|  histidine decarboxylase                            102   9e-22    
ref|WP_032035746.1|  histidine decarboxylase                            102   9e-22    
ref|WP_032058148.1|  histidine decarboxylase                            102   1e-21    
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase              102   1e-21    
ref|WP_032063040.1|  histidine decarboxylase                            102   1e-21    
ref|WP_031976591.1|  histidine decarboxylase                            102   1e-21    
ref|WP_032874071.1|  histidine decarboxylase                            102   1e-21    
ref|WP_032866759.1|  histidine decarboxylase                            102   1e-21    
ref|WP_017725496.1|  histidine decarboxylase                            102   1e-21    
ref|WP_005128217.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603873.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603866.1|  histidine decarboxylase                            102   1e-21    
ref|WP_009507303.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603868.1|  MULTISPECIES: histidine decarboxylase              102   1e-21    
emb|CBV42710.1|  histidine decarboxylase                                102   1e-21    
ref|WP_000603867.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603875.1|  histidine decarboxylase                            101   1e-21    
ref|WP_000603862.1|  histidine decarboxylase                            101   1e-21    
gb|KJG15285.1|  histidine decarboxylase                                 101   1e-21    
ref|WP_036788792.1|  histidine decarboxylase                            101   1e-21    
ref|WP_041602526.1|  histidine decarboxylase                            101   1e-21    
ref|WP_013289227.1|  histidine decarboxylase                            101   1e-21    
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein            101   1e-21    
ref|WP_000603884.1|  histidine decarboxylase                            101   1e-21    
ref|WP_025152530.1|  histidine decarboxylase                            101   1e-21    
ref|WP_031380129.1|  histidine decarboxylase                            101   1e-21    
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase              101   1e-21    
ref|WP_024474395.1|  histidine decarboxylase                            101   1e-21    
ref|WP_024439211.1|  histidine decarboxylase                            101   1e-21    
ref|WP_032068226.1|  histidine decarboxylase                            101   1e-21    
ref|WP_033851982.1|  histidine decarboxylase                            101   2e-21    
ref|WP_031961008.1|  histidine decarboxylase                            101   2e-21    
ref|WP_000603883.1|  histidine decarboxylase                            101   2e-21    
ref|WP_000603878.1|  histidine decarboxylase                            101   2e-21    
ref|WP_000603885.1|  histidine decarboxylase                            101   2e-21    
ref|WP_032000503.1|  histidine decarboxylase                            101   2e-21    
gb|AII01327.1|  histidine decarboxylase                                 101   2e-21    
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...    101   2e-21    
emb|CBJ48808.1|  conserved unknown protein                              101   2e-21    
gb|KGF60681.1|  histidine decarboxylase                                 100   2e-21    
ref|WP_035278364.1|  hypothetical protein                               100   2e-21    
gb|EWC64176.1|  Siderophore biosynthesis L-2,4-diaminobutyrate de...    100   3e-21    
gb|EEP75303.1|  histidine decarboxylase                                 100   3e-21    
gb|ERB65931.1|  hypothetical protein N779_07570                       99.0    3e-21    
ref|WP_031964057.1|  histidine decarboxylase                            100   4e-21    
ref|WP_032043772.1|  histidine decarboxylase                            100   4e-21    
ref|WP_032055342.1|  histidine decarboxylase                            100   5e-21    
ref|WP_018828666.1|  histidine decarboxylase                            100   5e-21    
ref|WP_000603870.1|  histidine decarboxylase                            100   5e-21    
gb|KGY51676.1|  histidine decarboxylase                                 100   6e-21    
ref|WP_042005730.1|  histidine decarboxylase                          99.8    6e-21    
ref|WP_000603874.1|  histidine decarboxylase                          99.8    6e-21    



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  311  SVSVSGHKFVGCPMPCGVQLTRLQHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  370

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  371  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  430

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             NM+HVVVMPSVTVEKLD FL+E+IQ RS+WY+ GN  PPCLA D+G +NC C LHK
Sbjct  431  GNMAHVVVMPSVTVEKLDFFLNEIIQGRSIWYKDGNVHPPCLAADIGSNNCSCALHK  487



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   334 bits (857),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  308  SVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  367

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKDEEFVR+WQLACE
Sbjct  368  RKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRKWQLACE  427

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            RNM+HVVVMPSVTV+KLD FLDEL++ARS+WY+  + KPPCLA D+G  NCCC  H+
Sbjct  428  RNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGSKNCCCPHHR  484



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   334 bits (857),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKDEEFVR+WQLACE
Sbjct  367  RKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRKWQLACE  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            RNM+HVVVMPSVTV+KLD FLDEL++ARS+WY+  + KPPCLA D+G  NCCC  H
Sbjct  427  RNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGSKNCCCPQH  482



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   332 bits (850),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW TLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWCTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKDEEFVR+WQLACE
Sbjct  367  RKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRKWQLACE  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            RNMSHVVVMPSVTVEKLD FLDEL++ARS+WY+  N KPPCLA D+G  NCCC  H+
Sbjct  427  RNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVKPPCLAADIGSQNCCCPQHR  483



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW TLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWCTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L GAGIS MLNELSSTVVFERPKDEEFVR+WQLACE
Sbjct  367  RKGYKGFQKEVQKCLRNAHYLKDRLIGAGISGMLNELSSTVVFERPKDEEFVRKWQLACE  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
            RNMSHVVVMPSVTVEKLD FLDEL++ARS+WY+  N  PPCLA D+G  NCCC  H+ CN
Sbjct  427  RNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVNPPCLAADIGSRNCCCPQHRGCN  486

Query  191  N  189
            +
Sbjct  487  S  487



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  315  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  374

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  375  RKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  434

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FLDEL++ RS WY+  + +PPC+A DVG  NC C LHK
Sbjct  435  GNIAHVVVMPNVTIEKLDLFLDELVEKRSTWYQEEHDQPPCIAADVGKENCACALHK  491



>ref|NP_001047064.2| Os02g0541300 [Oryza sativa Japonica Group]
 dbj|BAF08978.2| Os02g0541300, partial [Oryza sativa Japonica Group]
Length=207

 Score =   317 bits (811),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  30   SVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  89

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  90   RKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  149

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG  NC C +HK
Sbjct  150  GNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIHK  206



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  308  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  367

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERP DEEF+RRWQLAC+
Sbjct  368  RKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPLDEEFIRRWQLACQ  427

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             NM+HVVVMP+VT+EKLD FL+ELI+ RS WY+  N +PPCLA ++G  NC C LH
Sbjct  428  GNMAHVVVMPNVTIEKLDVFLNELIEERSAWYQDENVQPPCLAAEIGAENCACKLH  483



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+DHINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  301  SVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  360

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERP +EEFVRRWQLACE
Sbjct  361  RKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSEEEFVRRWQLACE  420

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCLA D+G  NCCC LHK
Sbjct  421  GNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALHK  477



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+DHINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  341  SVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  400

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERP +EEFVRRWQLACE
Sbjct  401  RKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSEEEFVRRWQLACE  460

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCLA D+G  NCCC LHK
Sbjct  461  GNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALHK  517



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQITRLEHINTLSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  367  RKGYRGFQKEVQKCLRNAHYLKDRLRAAGIGAMLNELSSTVVFERPQDEEFVRRWQLACQ  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T+EKLD FL+ELIQ R  W++ G S+PPC+A DVG  NC CVLHK
Sbjct  427  GNIAHVVVMPNITIEKLDNFLNELIQKRLTWFQDGKSQPPCIAADVGKENCACVLHK  483



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCG+Q+TRL HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  311  SVSVSGHKFVGCPMPCGIQITRLRHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  370

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVR WQLACE
Sbjct  371  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRMWQLACE  430

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             NM+H+VVMP+VTVEKLD FL+EL + R++WY+ G  +PPCLA DVG+ NC C +HK
Sbjct  431  GNMAHIVVMPNVTVEKLDYFLNELAKGRAIWYKDGKEQPPCLAVDVGIENCSCAVHK  487



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  318  SVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  377

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AG+ AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  378  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGVGAMLNELSSTVVFERPKDEEFVRRWQLACE  437

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A DVGV NC C LHK
Sbjct  438  GNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVENCLCGLHK  494



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   318 bits (816),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  220  SVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  279

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVR+WQLAC+
Sbjct  280  RKGYKGFQKEVQKCLRNAHYLKDRLRQAGISAMLNELSSTVVFERPRDEEFVRQWQLACQ  339

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             NM+HVVVMP+VT+EKL+ FLD LI+ RS+WY+    KPPCLA ++G  NC C LHK
Sbjct  340  GNMAHVVVMPNVTIEKLEGFLDALIEGRSIWYKDDKGKPPCLAAEIGSGNCSCPLHK  396



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  318  SVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  377

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  378  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  437

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A DVGV +C C LHK
Sbjct  438  GNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVESCLCGLHK  494



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  367  RKGYRGFQKEVQKCLRNAHYLKDRLRSAGIGAMLNELSSTVVFERPQDEEFVRRWQLACQ  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMP++TVEKLD FL+ELI  RS W++ G S+PPC+A DVG  NC CV+HK
Sbjct  427  GSIAHVVVMPNITVEKLDDFLNELIGKRSTWFQDGKSQPPCIAADVGKENCACVMHK  483



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  313  SVSVSGHKFVGCPMPCGVQITRLEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  372

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  373  RKGYVGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  432

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV ++KLD FL EL++ R+ WY+ G SKPPCLA D+GV NC C LHK
Sbjct  433  GNIAHVVVMPSVNIDKLDYFLTELVEKRATWYQDGISKPPCLARDLGVENCLCGLHK  489



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  305  SVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  364

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  365  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  424

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG  NC C +HK
Sbjct  425  GNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIHK  481



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   318 bits (816),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  367  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG  NC C +HK
Sbjct  427  GNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIHK  483



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  300  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  359

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  360  RKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQ  419

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT++KLD FL+ELI+ RS WYE G  +PPC+A D+G  NC C  HK
Sbjct  420  GNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK  476



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  300  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  359

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  360  RKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQ  419

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT++KLD FL+ELI+ RS WYE G  +PPC+A D+G  NC C  HK
Sbjct  420  GNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK  476



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HI  LSSNVEYLASRD+TIMGSRNGHAPIFLWYTLN
Sbjct  298  SVSVSGHKFVGCPMPCGVQITRLEHIKVLSSNVEYLASRDSTIMGSRNGHAPIFLWYTLN  357

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AG+ AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  358  RKGYRGFQKEVQKCLRNAHYLKDRLKAAGVGAMLNELSSTVVFERPKDEEFVRRWQLACE  417

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++H+VVMP+VT+EKLD FL+ELIQ RS WYEGG    PCLA D+G  NC C LH+
Sbjct  418  GNIAHIVVMPNVTIEKLDTFLNELIQKRSSWYEGGKIPSPCLAADIGDENCLCSLHQ  474



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  293  SVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  352

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L  AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  353  RKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  412

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT++KLD FL EL++ R+VWY+ G  +PPC+A DVG  +C C LHK
Sbjct  413  GNIAHVVVMPSVTIDKLDYFLRELVEKRAVWYKDGICQPPCIARDVGEKSCFCSLHK  469



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  300  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  359

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  360  RKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQ  419

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT++KLD FL+ELI  RS WYE G  +PPC+A D+G  NC C  HK
Sbjct  420  GNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGSENCVCAAHK  476



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI+ LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  297  SVSVSGHKFVGCPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  356

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP DEEFVRRWQLAC+
Sbjct  357  RKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQLACQ  416

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT+EKLD FL+EL++ RS+WY  G  +PPC+A DVG  NC C LHK
Sbjct  417  GNIAHVVVMPSVTIEKLDDFLNELVEKRSIWYRDGGVQPPCIAADVGCENCACALHK  473



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HIN LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  308  SVSVSGHKFVGCPMPCGVQLTRLEHINVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  367

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  368  RKGYRGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPRDEEFVRRWQLACQ  427

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMP+VT+EKLD FL+ELI+ RS WY+ G  + PC+A DVG  NC C LHK
Sbjct  428  GSIAHVVVMPNVTIEKLDNFLNELIEKRSTWYQDGQLQSPCIATDVGSENCACALHK  484



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HINAL+SNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  292  SVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNGHAPIFLWYTLN  351

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  352  RKGYRGFQKEVQKCLRNAHYLKDRLRNAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  411

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N+SHVVVMPSVT+ KLD FL+EL++ R  WY+ G  + PC+A DVG  NC C +HK
Sbjct  412  GNISHVVVMPSVTINKLDSFLNELVEKRVTWYQEGICQSPCIAGDVGQHNCLCTMHK  468



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LS+NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  300  SVSVSGHKFVGCPMPCGVQITRLEHINVLSNNVEYLASRDATIMGSRNGHAPIFLWYTLN  359

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  360  RKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQ  419

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV+V+KLD FL+EL++ RS WY+ G  +PPC+A DVG  NC C  HK
Sbjct  420  GNIAHVVVMPSVSVDKLDDFLNELVEKRSTWYKDGKVQPPCIAADVGSENCVCGRHK  476



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI+ LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  297  SVSVSGHKFVGCPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  356

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP DEEFVRRWQLAC+
Sbjct  357  RKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQLACQ  416

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT+EKLD FL+EL++ RS WY  G  +PPC+A DVG  NC C LHK
Sbjct  417  GNIAHVVVMPSVTIEKLDDFLNELVEKRSTWYRDGGVQPPCIAADVGCENCACALHK  473



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   317 bits (811),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  314  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  373

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  374  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  433

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCLA+DVG +NC C  HK
Sbjct  434  GDIAHVVVMPSVTIEKLDHFLKDLVEHRSVWYEDG-SQPPCLAKDVGTNNCICPTHK  489



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   315 bits (808),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  287  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  346

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNA+YLKD+LR AGISAMLNELSSTVVFERP DE+FVRRWQLAC+
Sbjct  347  RKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPIDEDFVRRWQLACQ  406

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT+EKLD F++EL++ RS WY+   ++PPC+A DVG  NC C LHK
Sbjct  407  GNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKARPPCIAADVGSQNCSCDLHK  463



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  364  RKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LHK
Sbjct  424  GNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALHK  479



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  302  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  362  RKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LHK
Sbjct  422  GNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALHK  477



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  303  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  362

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  363  RKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  422

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LHK
Sbjct  423  GNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALHK  478



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  303  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  362

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  363  RKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  422

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LHK
Sbjct  423  GNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALHK  478



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR  HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  302  SVSVSGHKFVGCPMPCGVQITRSKHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGIS MLNELSSTVVFERPKDEEFVR+WQLACE
Sbjct  362  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGISVMLNELSSTVVFERPKDEEFVRQWQLACE  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT++KLD FL+EL++ RS WY+ GN  PPC+A D+G  NCCC LH+
Sbjct  422  GNIAHVVVMPNVTIDKLDSFLNELLRHRSCWYQEGNISPPCIAADIGEENCCCALHR  478



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  295  SVSVSGHKFVGCPMPCGVQITRMEHINVLSKNVEYLASRDATIMGSRNGHAPIFLWYTLN  354

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQK+VQKCLRNAHYLK +LR AGISAMLNELSSTVV ERPKDEEFVRRWQLAC+
Sbjct  355  RKGYKGFQKDVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVLERPKDEEFVRRWQLACQ  414

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVVMPSVT+EKLD FLDEL++ RS WY+ G  + PC+A DVG  NC C LH
Sbjct  415  GNIAHVVVMPSVTIEKLDNFLDELVKKRSTWYQDGQVQSPCIAADVGSENCACALH  470



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  364  KKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV ++KLD FL+EL++ RS WY     +PPC+A DVG  NC C  HK
Sbjct  424  GNIAHVVVMPSVNIDKLDDFLNELVEKRSTWYNDEKVQPPCIAADVGTENCACGQHK  480



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  262  SVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  321

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D+EFVRRWQLAC+
Sbjct  322  RKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRRWQLACQ  381

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FLDELI+ R+ W+     +PPC+A D+G  NC C LHK
Sbjct  382  GNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDLHK  438



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  311  SVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  370

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR  GISAMLNELSSTVVFERP DEEF+RRWQLAC+
Sbjct  371  RKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELSSTVVFERPLDEEFIRRWQLACQ  430

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T++KL+ FLDEL++ RS W++ G +KPPC+A D+G  NC C +HK
Sbjct  431  GNIAHVVVMPNITIDKLESFLDELVEKRSTWFKDGTNKPPCVASDIGQENCVCPMHK  487



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  368  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  427

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  428  RKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQ  487

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT++KLD FL+ELI  RS WYE G  +PPC+A D+G  NC C  HK
Sbjct  488  GNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGSENCVCAAHK  544



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  302  SVSVSGHKFVGCPMPCGVQITRLKHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKC+RNAHYLKD+L+ AGI AMLNELSSTVVFERPKD+EFVRRWQLACE
Sbjct  362  RKGYRGFQKEVQKCVRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDDEFVRRWQLACE  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+V ++KLD FL+EL Q RS WY+ G   PPC+A D+G  NC CVLHK
Sbjct  422  GNIAHVVVMPNVNIDKLDSFLEELFQKRSCWYQDGKMPPPCIAADIGQDNCFCVLHK  478



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HINALS +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  251  SVSVSGHKFVGCPMPCGVQITRLRHINALSRDVEYLASRDATIMGSRNGHAPIFLWYTLN  310

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGF+KEVQKCLRNAHYL  +LR AGISAMLNELSSTVVFERP+DEEFVRRWQLACE
Sbjct  311  RKGYKGFRKEVQKCLRNAHYLNHRLREAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  370

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +M+HVVVMP+VTV KLD FLDELI++RSVWYE G  +PPCLA D+G  NC C LHK
Sbjct  371  GSMAHVVVMPNVTVGKLDQFLDELIESRSVWYEDG-VEPPCLAADIGTENCSCPLHK  426



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  311  SVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  370

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR  GISAMLNELSSTVVFERP DEEF+RRWQLAC+
Sbjct  371  RKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELSSTVVFERPLDEEFIRRWQLACQ  430

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T++KL+ FLDEL++ RS W+  G +KPPC+A D+G  NC C +HK
Sbjct  431  GNIAHVVVMPNITIDKLESFLDELVEKRSTWFRDGTNKPPCVASDIGQENCVCPMHK  487



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI ALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  314  SVSVSGHKFVGCPMPCGVQITRMEHIKALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  373

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  374  RKGYKGFQKEVQKCLRNAHYLKDRLRKAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  433

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT+EKLD FLDEL++ RSVWY+ G S+  C+A DVGV NC C  HK
Sbjct  434  GNIAHVVVMPSVTIEKLDYFLDELVEQRSVWYKDG-SQALCIASDVGVENCICPAHK  489



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  287  SVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  346

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNA+YLKD+LR AGISAMLNELSSTVVFERP DE+FVRRWQLAC+
Sbjct  347  RKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPIDEDFVRRWQLACQ  406

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT+EKLD F++EL++ RS WY+    +PPC+A D+G  NC C LHK
Sbjct  407  GNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKVRPPCIAADIGSQNCSCDLHK  463



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   314 bits (804),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  306  SVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  365

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D+EFVRRWQLAC+
Sbjct  366  RKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRRWQLACQ  425

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FLDELI+ R+ W+     +PPC+A D+G  NC C LHK
Sbjct  426  GNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDLHK  482



>gb|AFK28264.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28265.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28266.1| putative serine decarboxylase, partial [Helianthus paradoxus]
Length=239

 Score =   305 bits (782),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L GAGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTGAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   313 bits (803),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  364  KKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV ++KLD FL+EL++ RS WY+    +PPC+A DVG  NC C  H+
Sbjct  424  GNIAHVVVMPSVNIDKLDDFLNELVEKRSTWYKDEKVQPPCIAVDVGTENCACGQHQ  480



>ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L   GISAMLNELSSTVVFERP+DEEF+RRWQLACE
Sbjct  364  RKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRDEEFIRRWQLACE  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV+ EKLD FL +L++ RS WY+G N +PPC+A ++G  +C C LH+
Sbjct  424  GNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGNESCACKLHR  480



>ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
 ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
Length=486

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  309  SVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L   GISAMLNELSSTVVFERP+DEEF+RRWQLACE
Sbjct  369  RKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRDEEFIRRWQLACE  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV+ EKLD FL +L++ RS WY+G N +PPC+A ++G  +C C LH+
Sbjct  429  GNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGNESCACKLHR  485



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  289  SVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQLACE
Sbjct  349  RKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQLACE  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LHK
Sbjct  409  GNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGKENCACPLHK  463



>gb|AFK28277.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ RSVWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRSVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  367  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ R +WYE G S+PPCLA +VG +NC C  HK
Sbjct  427  GDIAHVVVMPSVTIEKLDNFLKDLVKHRLIWYEDG-SQPPCLASEVGTNNCICPAHK  482



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  297  SVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  356

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D+EFVRRWQLAC+
Sbjct  357  RKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPXDDEFVRRWQLACQ  416

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FLD LI+ R+ W+     +PPC+A D+G  NC C LHK
Sbjct  417  GNIAHVVVMPNVTIEKLDYFLDXLIEKRNTWFLDKKVQPPCVAADIGSENCLCDLHK  473



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTL+
Sbjct  302  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLS  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  362  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCL +DVG+ NC C  HK
Sbjct  422  GDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDG-SQPPCLVKDVGIKNCICPAHK  477



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  301  SVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  360

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQLACE
Sbjct  361  RKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQLACE  420

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LHK
Sbjct  421  GNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGKENCACPLHK  475



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  302  SVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQLACE
Sbjct  362  RKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQLACE  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LHK
Sbjct  422  GNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EQQPPCIAADIGKENCACPLHK  476



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  302  SVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQLACE
Sbjct  362  RKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQLACE  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LHK
Sbjct  422  GNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGKENCACPLHK  476



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTL+
Sbjct  292  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLS  351

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  352  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  411

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCL +DVG+ NC C  HK
Sbjct  412  GDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDG-SQPPCLVKDVGIKNCICPAHK  467



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  315  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  374

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQLAC+
Sbjct  375  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQLACQ  434

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVTVEKLD FL +L++ R VWYE G SKPPCL +DVG++NC C  HK
Sbjct  435  GDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SKPPCLVKDVGINNCICPAHK  490



>gb|AFK28270.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28253.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28255.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28258.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28259.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28263.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28268.1| putative serine decarboxylase, partial [Helianthus deserticola]
 gb|AFK28274.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28275.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28276.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28278.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28280.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28284.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28285.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28286.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28288.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28289.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28290.1| putative serine decarboxylase, partial [Helianthus neglectus]
Length=239

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28279.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  310  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  369

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  370  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  429

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD F+ +L++ RSVWYE G ++PPCL  +VG +NC C  HK
Sbjct  430  GDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDG-TQPPCLVSEVGTNNCICPAHK  485



>gb|AFK28256.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  306  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  365

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  366  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  425

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD F+ +L++ RSVWYE G ++PPCL  +VG +NC C  HK
Sbjct  426  GDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDG-TQPPCLVSEVGTNNCLCPAHK  481



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   311 bits (796),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEF+RRWQLACE
Sbjct  364  RKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRDEEFIRRWQLACE  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSV+ EKLD FL EL++ RS WY+  N +PPC+A ++G  +C C LH+
Sbjct  424  GSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGNESCACKLHR  480



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   311 bits (797),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  309  SVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEF+RRWQLACE
Sbjct  369  RKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRDEEFIRRWQLACE  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSV+ EKLD FL EL++ RS WY+  N +PPC+A ++G  +C C LH+
Sbjct  429  GSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGNESCACKLHR  485



>gb|AFK28260.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   302 bits (774),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY  G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYRDGKRKPPCVASDIGRANCLCEL  239



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   311 bits (796),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HI  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  298  SVSVSGHKFVGCPMPCGVQITRLEHIKVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  357

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AG+SAMLNELSSTVVFERPKD EFVRRWQLACE
Sbjct  358  RKGYRGFQKEVQKCLRNAHYLKDRLKAAGVSAMLNELSSTVVFERPKDGEFVRRWQLACE  417

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VTVEKLD FL+ELIQ RS  YE GN   PC+A D+G  NC C LH+
Sbjct  418  GNIAHVVVMPNVTVEKLDTFLNELIQNRSSCYEDGNIPFPCIAADIGDENCLCSLHQ  474



>gb|AFK28281.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28282.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28283.1| putative serine decarboxylase, partial [Helianthus debilis]
Length=239

 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRGVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  289  SVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  349  RKGYRGFQKEVQKCLRNAHYLKDRLREAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE-GGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMP+VT++KLD FL+EL + R+ WY+ GG  + PC+A DVG  +C C LHK
Sbjct  409  GSIAHVVVMPNVTIDKLDYFLNELREKRATWYQDGGMCQAPCIARDVGQDSCLCSLHK  466



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  314  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  373

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQLAC+
Sbjct  374  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQLACQ  433

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVTVEKLD FL +L++ R VWYE G S+PPCL +DVG++NC C  HK
Sbjct  434  GDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SQPPCLVKDVGINNCICPAHK  489



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  315  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  374

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQLAC+
Sbjct  375  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQLACQ  434

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVTVEKLD FL +L++ R VWYE G S+PPCL +DVG++NC C  HK
Sbjct  435  GDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SQPPCLVKDVGINNCICPAHK  490



>gb|AFK28257.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++E I+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNEFIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  287  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  346

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  347  RKGYKGFQKEVQKCLRNAHYLKDRLCEAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  406

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCLA +VG +NC C  HK
Sbjct  407  GDIAHVVVMPSVTIEKLDNFLKDLVKHRSVWYEDG-SQPPCLASEVGTNNCICPTHK  462



>gb|AFK28271.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRVVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  367  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  426

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKDKLR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  427  RKGYKGFQKEVQKCLRNAHYLKDKLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  486

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ R VWYE G ++PPCLA +VG +NC C  HK
Sbjct  487  GDIAHVVVMPSVTIEKLDDFLKDLVKHRLVWYEDG-TQPPCLASEVGTNNCICPAHK  542



>gb|AFK28261.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HV VMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVAVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  315  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  374

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  375  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  434

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ R VWYE G ++PPCL  +VG +NC C  HK
Sbjct  435  GDIAHVVVMPSVTIEKLDNFLKDLVKHRLVWYEDG-TQPPCLVSEVGTNNCICPAHK  490



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL++INALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  230  SVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  289

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDE FVRRWQLACE
Sbjct  290  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEVFVRRWQLACE  349

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N+ HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A  VG  NC C  HK
Sbjct  350  GNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARVVGFENCLCGRHK  406



>gb|AFK28262.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRD TIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDTTIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28273.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI  R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIGKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28254.1| putative serine decarboxylase, partial [Helianthus argophyllus]
Length=239

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS N EYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNXEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28287.1| putative serine decarboxylase, partial [Helianthus bolanderi]
Length=239

 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVV+P++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVVPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  315  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  374

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQLAC+
Sbjct  375  RKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKEEEFVRRWQLACQ  434

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVTVEKLD FL +L++ R VWYE G  KPPCL +DVG++NC C  HK
Sbjct  435  GDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-CKPPCLVKDVGINNCICPAHK  490



>gb|AFK28267.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++K D F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKSDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LS NVEYLASRDATIMGSRNGHAP+FLWYTL+
Sbjct  323  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSRNVEYLASRDATIMGSRNGHAPLFLWYTLS  382

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  383  QKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  442

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++ KLD FL+EL++ RS+WY+   S+PPC+A DVG  NC C  HK
Sbjct  443  GNIAHVVVMPSVSIGKLDSFLNELVEQRSLWYK-DESQPPCVASDVGTENCICPTHK  498



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   309 bits (791),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL++INALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  313  SVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  372

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDE FVRRWQLACE
Sbjct  373  RKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEVFVRRWQLACE  432

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N+ HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A  VG  NC C  HK
Sbjct  433  GNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARVVGFENCLCGRHK  489



>gb|AFK28272.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   300 bits (768),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQTTRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI A LNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGATLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNITHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28291.1| putative serine decarboxylase, partial [Helianthus niveus]
Length=239

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI A LNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGATLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T+++LD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDRLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTL+
Sbjct  294  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLS  353

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  354  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRRWQLACQ  413

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L++ RSVWYE   S+ PCL +DVG+ NC C  HK
Sbjct  414  GDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEEYGSQLPCLVKDVGIKNCICPAHK  470



>gb|AFK28269.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  207
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPP +A D+G +NC C L
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPRVASDIGQANCLCEL  239



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  364  KKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV +EKLD FL EL++ RS WY+    +PPC+A DVG  NC C  HK
Sbjct  424  GNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYD-EKVQPPCIAADVGTENCSCGQHK  479



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  364  KKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV +EKLD FL EL++ RS WY+    +PPC+A DVG  NC C  HK
Sbjct  424  GNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYD-EKVQPPCIAADVGTENCSCGQHK  479



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   306 bits (784),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  314  SVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLN  373

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+L  +GISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  374  RKGYKGFQKEVQKCLRNAHYLKDRLCESGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  433

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT+EKLD FL +L+Q RSVWY  G S+PPCL  +VG  NC C  HK
Sbjct  434  GDIAHVVVMPSVTIEKLDSFLKDLVQHRSVWYADG-SQPPCLVSEVGTHNCICPAHK  489



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  297  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  356

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  357  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  416

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
              ++HVVVMPSVT+EKLD FL +L++ RS+W + G S+ PCLA+DVG +NC C  HK
Sbjct  417  GEIAHVVVMPSVTIEKLDHFLKDLVEHRSIWCKDG-SQTPCLAKDVGTNNCVCPAHK  472



>gb|AFK39410.1| unknown [Medicago truncatula]
Length=320

 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVE LASRDATIMGSRNGHAPIFLWYTLN
Sbjct  144  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRNGHAPIFLWYTLN  203

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  204  RKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  263

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  HK
Sbjct  264  GNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  320



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  310  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  369

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  370  RKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  429

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  HK
Sbjct  430  GNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  486



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HI  LSSNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  297  SVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLN  356

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  357  RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  416

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMPSVT++KLD FL +L++ RS+W + G S+ PCLA+DVG +NC C  HK
Sbjct  417  GDIAHVVVMPSVTIKKLDHFLKDLVEHRSIWCKDG-SQTPCLAKDVGTNNCVCPAHK  472



>ref|XP_006854520.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRLDHINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  312  SVSVSGHKFVGCPMPCGVQITRLDHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  371

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYLKD LR  GISAMLNELSSTVVFERP+DEEFVRRWQLAC+
Sbjct  372  RKGYRGFQKEVQKCLRNAHYLKDCLRSEGISAMLNELSSTVVFERPQDEEFVRRWQLACQ  431

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++H VVMP++T+EKLD F+ EL   RS W++ G ++ PC+A+++G  NC C  H
Sbjct  432  GNIAHAVVMPNITIEKLDDFVKELTAKRSTWFKDGKAQAPCIADEIGAENCACARH  487



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHK VGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY GFQKEVQKCLRNAHYLK +LR A ISAMLNELSSTVVFERPKDEEFVR+WQLAC+
Sbjct  364  KKGYTGFQKEVQKCLRNAHYLKGRLRDARISAMLNELSSTVVFERPKDEEFVRKWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD FL+EL++ RS WY+  N +PPCLA DVG  NC C  HK
Sbjct  424  GNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYD-ENVQPPCLAADVGTENCSCRQHK  479



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  281  SVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  340

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GFQKEVQKCL+NAHYLKD+LR AGI AMLNELSSTVVFERP++EEFVR+WQLAC+
Sbjct  341  RKGYGGFQKEVQKCLKNAHYLKDRLREAGIGAMLNELSSTVVFERPQEEEFVRKWQLACQ  400

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HV+VMP++T+EKLD FL EL+Q R+ W++ G  + PC+A DVG  NC C  HK
Sbjct  401  GNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCASHK  457



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKDEEFVRRWQLAC+
Sbjct  364  KKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV +EKLD FL+EL++ RS WY+    + PC+A DVG  NC C  HK
Sbjct  424  GNIAHVVVMPSVNIEKLDDFLNELVEKRSTWYD-EKVQAPCIAADVGTENCSCGQHK  479



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHK VGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  304  SVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY GFQKEVQKCLRNAHYLK  LR AGISAMLNELSSTVVFERPKDEEFVR+WQLAC+
Sbjct  364  KKGYTGFQKEVQKCLRNAHYLKGHLRDAGISAMLNELSSTVVFERPKDEEFVRKWQLACQ  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPCLA DVG  NC C  HK
Sbjct  424  GNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYD-EKVQPPCLAADVGTENCSCRQHK  479



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  309  SVSVSGHKFVGCPMPCGVQITRLEHINALSQNVEYLASRDATIMGSRNGHAPIFLWYTLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+RRWQLAC+
Sbjct  369  RKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVVFERPHDEEFIRRWQLACK  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT++KLD FL+EL + R+ W+E G  +P C+A DVG ++C C LHK
Sbjct  429  GNIAHVVVMPNVTIQKLDDFLNELKEKRAAWFEDGKYQPYCIASDVGENHCLCALHK  485



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRLD++NALS +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQITRLDYVNALSRDVEYLASRDATIMGSRNGHAPIFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+RRWQLAC+
Sbjct  367  RKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVVFERPHDEEFIRRWQLACK  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG  NC C LHK
Sbjct  427  GNIAHVVVMPNITIEKLDDFLNELLEKRTTWFQDGKDQPYCISADVGEKNCLCALHK  483



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HIN LSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  281  SVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  340

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY GFQKEVQKCL NAHYLKD+LR AGI AMLNELSSTVVFERP++EEFVR+WQLAC+
Sbjct  341  RKGYGGFQKEVQKCLENAHYLKDRLREAGIGAMLNELSSTVVFERPQEEEFVRKWQLACQ  400

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HV+VMP++T+EKLD FL EL+Q R+ W++ G  + PC+A DVG  NC C  HK
Sbjct  401  GNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCASHK  457



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HINAL+SNVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  296  SVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNGHAPLFLWYTLN  355

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GF+KEVQKCLRNAHYL+D+L  AG+ AMLN LSSTVVFERPKDE FVRRWQLACE
Sbjct  356  RKGYRGFRKEVQKCLRNAHYLRDRLMAAGVGAMLNPLSSTVVFERPKDEGFVRRWQLACE  415

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMPSVT+EKLD FLDEL+  RS WY   +   PC+A ++G  NC C +HK
Sbjct  416  GNIAHVVVMPSVTIEKLDDFLDELVAGRSAWYRDRSRPSPCIAAEIGQENCHCSMHK  472



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S SVSGHKFVGCPMPCGV++TRL+HINALS NVEYLASRDATIMGSRNGH PIFLWYTLN
Sbjct  309  SASVSGHKFVGCPMPCGVEITRLEHINALSRNVEYLASRDATIMGSRNGHTPIFLWYTLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKGFQKEVQKCL NA YLKD+LR AG+ AMLNE SSTVVFERP+DEEFVRRW LAC+
Sbjct  369  QKGYKGFQKEVQKCLSNAFYLKDRLRAAGVGAMLNEFSSTVVFERPQDEEFVRRWHLACQ  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS-KPPCLAEDVGVSNCCCVLHK  201
             +++HVVVMP+VT+EKLD F+DEL+Q RS W+  G   +PPC+A DVG  NC C+LHK
Sbjct  429  GDIAHVVVMPNVTIEKLDVFVDELMQKRSAWFRNGRILQPPCIAADVGNENCACILHK  486



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVE LASRDATIMGSRNGHAPIFLWYTLN
Sbjct  310  SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRNGHAPIFLWYTLN  369

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  370  RKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  429

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  HK
Sbjct  430  GNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  486



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLWY+LN
Sbjct  282  SVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLN  341

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQLAC+
Sbjct  342  MKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQ  401

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH+
Sbjct  402  GNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  458



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLWY+LN
Sbjct  292  SVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLN  351

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQLAC+
Sbjct  352  MKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQ  411

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH+
Sbjct  412  GNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  468



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLWY+LN
Sbjct  309  SVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQLAC+
Sbjct  369  MKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQ  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH+
Sbjct  429  GNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  485



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLWY+LN
Sbjct  309  SVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQLAC+
Sbjct  369  MKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQ  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH+
Sbjct  429  GNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  485



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  307  SVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLWYTLN  366

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  367  RKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  426

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG  NC C LHK
Sbjct  427  GNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCALHK  483



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  309  SVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLWYTLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  369  RKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG  NC C LHK
Sbjct  429  GNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCALHK  485



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  309  SVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLWYTLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  369  RKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP++T+EKLD FL+EL+  R+ W++ G  +P C++ DVG  NC C LHK
Sbjct  429  GNIAHVVVMPNITIEKLDDFLNELLDKRATWFQDGKDQPYCISSDVGEKNCLCALHK  485



>gb|AFA36595.1| putative serine decarboxylase, partial [Lolium perenne]
Length=245

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  95   SVSVSGHKFVGCPMPCGVQVTRLKHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  154

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY+GFQKEVQKCLRNAHYLKD+L  AGI AMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  155  QKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKDEEFVRRWQLACE  214

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVW  279
             N++HVVVMPSV ++KLD FL EL++ R+VW
Sbjct  215  GNIAHVVVMPSVNIDKLDYFLRELVEKRAVW  245



>gb|AFK28252.1| putative serine decarboxylase, partial [Helianthus agrestis]
Length=223

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  65   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  124

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQLAC+
Sbjct  125  RKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQ  184

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  255
             N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KP
Sbjct  185  GNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKHKP  223



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCPMPCGVQ TR+ HIN+LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  244  SVSVSGHKFIGCPMPCGVQFTRMKHINSLSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  303

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQK+VQ+CLRNAHYLK++LR A I  MLNELSSTVVFERP DE F+ +WQLAC+
Sbjct  304  RKGYRGFQKDVQRCLRNAHYLKERLREAKIGVMLNELSSTVVFERPLDEAFILKWQLACQ  363

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
              ++H VVMPSVTVEKLD F++ELI+ R   +  GN K PC+ E+VGV NC C LH+   
Sbjct  364  GKIAHAVVMPSVTVEKLDNFVEELIEVRKRSFPEGNVKIPCIVEEVGVQNCACSLHRGAG  423

Query  191  NNP  183
              P
Sbjct  424  TIP  426



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR+ HIN LS NVEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  232  SVSVSGHKFVGCPMPCGVQITRMKHINVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  291

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQ+CLRNA+YLK++LR A +  +LNELSSTVVFERP DE F+ +WQLAC+
Sbjct  292  RKGYRGFQKEVQRCLRNAYYLKERLREANVGVLLNELSSTVVFERPLDEAFILKWQLACQ  351

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
              ++H VVMPSVTVEKLD F++ELI+ R+  +  G+   PC+ E+VG  NC C +H+
Sbjct  352  GKIAHAVVMPSVTVEKLDDFVEELIEVRNRAFPDGDVVVPCIVEEVGPENCACSVHR  408



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   277 bits (709),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCG+Q+TR++HIN LS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  293  SVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  352

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GF+KEV+KCL NAHYL   LR +G  AMLNELSSTVVFERP+DE FVR+WQLAC+
Sbjct  353  RKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQDEAFVRKWQLACQ  412

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
              ++H VVMPSVTV+KL  FL ELI++RS  +  G    PC+AE++G  NC CV H  C+
Sbjct  413  GKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVAEELGAKNCACVKHSSCS  472



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   276 bits (706),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCPMPCGVQ+ R  HINALS N+EY+AS+DATI GSRNGH PIFLWY LN
Sbjct  272  SVSVSGHKFLGCPMPCGVQIVRKKHINALSRNIEYIASKDATITGSRNGHTPIFLWYALN  331

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY G QK+VQ C+RNA YLK +L+  G+S MLN+LS+TVVFERP+DEEF+RRWQLACE
Sbjct  332  RKGYHGLQKDVQMCMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQDEEFIRRWQLACE  391

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HV+VMP VT+EKLD FL+EL++ R  W++ G ++PPC+A ++G  NC C LH
Sbjct  392  GNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCPMPCGVQ+ R  HINALS N+EY+AS+DATI GSRNGH PIFLWY LN
Sbjct  272  SVSVSGHKFLGCPMPCGVQIVRKKHINALSRNIEYIASKDATITGSRNGHTPIFLWYALN  331

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY G QK+VQ C+RNA YLK +L+  G+S MLN+LS+TVVFERP+DEEF+RRWQLACE
Sbjct  332  RKGYHGLQKDVQMCMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQDEEFIRRWQLACE  391

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HV+VMP VT+EKLD FL+EL++ R  W++ G ++PPC+A ++G  NC C LH
Sbjct  392  GNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCG+Q+TR++HIN LS NVEYLASRDATIMGSRNGHAP+FLWYTLN
Sbjct  293  SVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRNGHAPLFLWYTLN  352

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GF+KEV+KCL NAHYL   LR +G  AMLNELSSTVVFERP+DE FVR+WQLAC+
Sbjct  353  RKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQDEAFVRKWQLACQ  412

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
              ++H VVMPSVTV+KL  FL ELI++RS  +  G    PC+A+++G  NC CV H  C+
Sbjct  413  GKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVADELGAKNCACVKHSSCS  472



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCP+PCGV +TRL+H+  LS+++EYL+SRDATIMGSRNGHAP+FLWYTLN
Sbjct  306  SVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSRDATIMGSRNGHAPMFLWYTLN  365

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY+G +KEVQKCLRNAH+L ++LR AG+SA LNELSSTVVFERP DE FV +WQLACE
Sbjct  366  KKGYRGIRKEVQKCLRNAHHLANRLREAGVSAYLNELSSTVVFERPHDEAFVHKWQLACE  425

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             +++HVVVMP+V+VEKL+ F++ELI  R  W+EGG  + PC+A+D+G  NC C +H
Sbjct  426  GSIAHVVVMPNVSVEKLNNFVEELIGERPRWHEGGGFRVPCVAKDIGQENCLCGVH  481



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCP+PCGV +TRL H+  LS+++EYL+SRD TIMGSRNGHAPIFLWYTLN
Sbjct  299  SVSISGHKFMGCPVPCGVVITRLAHVKVLSTDIEYLSSRDTTIMGSRNGHAPIFLWYTLN  358

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGY+GF+KEV+KCLRNAHYL ++LR  G+SA LN LSSTVVFERP+D  FV +WQLACE
Sbjct  359  KKGYRGFRKEVRKCLRNAHYLANRLREEGVSASLNMLSSTVVFERPRDVAFVHKWQLACE  418

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
             +++HVVVMP+V+VEKLD F++EL+  RS WY+G     PC+A+D+G  NC C LH   +
Sbjct  419  GSIAHVVVMPNVSVEKLDGFVEELVANRSCWYDGKGHDIPCVAKDIGQDNCLCSLHNTKH  478

Query  191  NNPE  180
             N E
Sbjct  479  KNVE  482



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  289  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  349  AKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  409  KDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTDPPCVGEDIGAQNCACSYHK  465



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  288  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  347

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  348  AKGQIGLQKDVERCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  407

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  408  KDMAHVIVMPGITREMLDNFISELMQQRKVWYQNGKTNPPCVGEDIGAQNCACSYHK  464



>gb|KEH26769.1| serine decarboxylase [Medicago truncatula]
Length=192

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 13/177 (7%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCG+  T L            L  R  +IMGSRNGHAPIFLWYTLN
Sbjct  29   SVSVSGHKFVGCPMPCGMWNTLL------------LGMR-LSIMGSRNGHAPIFLWYTLN  75

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  76   RKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  135

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  HK
Sbjct  136  GNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  192



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  282  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  341

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  342  AKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  401

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  402  KDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYHK  458



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   256 bits (655),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  289  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  349  AKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  409  KDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYHK  465



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLWY+L+
Sbjct  283  SVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  343  AKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T E LD F+++L+Q R  WY+ GN  PPC+AED+G  NC C  HK
Sbjct  403  RDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYHK  459



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLWY+L+
Sbjct  283  SVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AG+S MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  343  SKGQIGLQKDVKRCLDNAKYLKDRLQQAGVSVMLNELSIIVVLERPRDHEFVRRWQLSCV  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T E LD F+++L+Q R  WY+ GN  PPC+AED+G  NC C  HK
Sbjct  403  RDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYHK  459



>gb|AES76141.2| serine decarboxylase [Medicago truncatula]
Length=261

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 13/177 (7%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCG+  T L            L  R  +IMGSRNGHAPIFLWYTLN
Sbjct  98   SVSVSGHKFVGCPMPCGMWNTLL------------LGMR-LSIMGSRNGHAPIFLWYTLN  144

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  145  RKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  204

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  HK
Sbjct  205  GNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  261



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG   IFLWY+L+
Sbjct  289  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTLIFLWYSLS  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  349  AKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  409  KDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTNPPCVGEDIGAQNCACSYHK  465



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLWY+L+
Sbjct  278  SVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLS  337

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  338  AKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  397

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T + LD F+++L+Q R  WY+ GN  PPC+A+D+G  NC C  HK
Sbjct  398  RDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYHK  454



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLWY+L+
Sbjct  278  SVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLS  337

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  338  AKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  397

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T + LD F+++L+Q R  WY+ GN  PPC+A+D+G  NC C  HK
Sbjct  398  RDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYHK  454



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  288  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  347

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  348  AKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  407

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  408  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  288  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  347

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  348  AKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  407

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  408  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  288  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  347

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  348  AKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  407

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  408  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  278  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  337

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD L+ AGIS MLNE+S  VV ERP D EFVRRWQL+C 
Sbjct  338  TKGQIGLQKDVKRCLDNAKYLKDGLQQAGISVMLNEISIIVVLERPHDHEFVRRWQLSCV  397

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HVVVMP +T E LD F+ EL+Q R  WY+GG ++ PC+A+D+G  NC C  HK
Sbjct  398  KDMAHVVVMPGITREMLDNFISELVQQRKHWYQGGKAEAPCVADDIGTQNCACSYHK  454



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  288  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  347

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V+KCL NA YLKD+L  AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  348  AKGQIGLQKDVKKCLDNAKYLKDRLLQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  407

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+A+D+G  NC C  HK
Sbjct  408  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYHK  464



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  285  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  344

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  345  AKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  404

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  405  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  461



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  283  SVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  343  AKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T E LD F+++L+Q R  WY+ G   PPC+A D+G  NC C  HK
Sbjct  403  RDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYHK  459



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  301  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  360

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V+KCL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  361  AKGQIGLQKDVKKCLDNAKYLKDRLQQEGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  420

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+A+D+G  NC C  HK
Sbjct  421  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYHK  477



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  283  SVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  343  AKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T E LD F+ +L+Q R  WY+ G   PPC+A D+G  NC C  HK
Sbjct  403  RDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYHK  459



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLWY+++
Sbjct  283  SVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSIS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  343  AKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T E LD F+++L+Q R  WY+ G   PPC+A D+G  NC C  HK
Sbjct  403  RDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVANDIGAQNCACSYHK  459



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  274  SVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTPIFLWYSLS  333

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  334  AKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCM  393

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+++L+Q R +WY+ G    PC+A+D+G  NC C  HK
Sbjct  394  KDMAHVIVMPGITRETLDNFVNDLVQQRKLWYQHGRVTTPCIADDIGAQNCSCSYHK  450



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  288  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  347

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  348  AKGQIGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  407

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  408  KDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCGV +TR  +I+ +S N+EY+AS D TI GSRNGH+P+F+WY LN
Sbjct  284  SVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHSPVFMWYVLN  343

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG++G +++VQKCLRNA YL+ +L+ AGIS+MLNE+S TVVFERP D EFVR WQL C 
Sbjct  344  LKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEFVRHWQLQCL  403

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             NM+HVVVMP VTVE L+ FL +LI+ R+ WY  G  +PPCLAED+G+ NC C +H
Sbjct  404  ENMAHVVVMPHVTVEMLERFLSDLIRKRNTWY--GKVQPPCLAEDIGICNCACPVH  457



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  289  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLK++L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  349  AKGQVGLQKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY  G ++ PC+ ED+G  NC C  HK
Sbjct  409  KDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYHK  465



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCGV +TR  +I+ +S N+EY+AS D TI GSRNGH+P+F+WY LN
Sbjct  286  SVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHSPVFMWYVLN  345

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG++G +++VQKCLRNA YL+ +L+ AGIS+MLNE+S TVVFERP D EFVR WQL C 
Sbjct  346  LKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEFVRHWQLQCL  405

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             NM+HVVVMP VTVE L+ FL +LI+ R+ WY  G  +PPCLAED+G+ NC C +H
Sbjct  406  ENMAHVVVMPHVTVEMLERFLSDLIRKRNTWY--GKVQPPCLAEDIGICNCACPVH  459



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  289  SVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLS  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLK++L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  349  AKGQVGLQKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            ++M+HV+VMP +T E LD F+ EL+Q R  WY  G ++ PC+ ED+G  NC C  HK
Sbjct  409  KDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYHK  465



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  283  SVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GFQK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  343  AKGQIGFQKDVKRCLDNAIYLKDRLQKAGISVMLNELSIIVVLERPRDHEFVRRWQLSCV  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HV+VMP +T E LD F+ +L+Q R  WY+ G    PC+A D+G  NC C  HK
Sbjct  403  RDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISAPCVASDIGAQNCACSYHK  459



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP+PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  PI LWY+L+
Sbjct  275  SVTISGHKFIGCPIPCGVQITRKSHIGYLSRNVEYIASMDATISGSRNGLTPILLWYSLS  334

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++V++CL NA YL+D+L+ A IS MLNELS+ VV ERP D EF R WQL+C 
Sbjct  335  SKGQIGIQQDVKRCLNNARYLRDRLKQANISVMLNELSTIVVLERPHDHEFTRHWQLSCV  394

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            ++++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC C LH
Sbjct  395  KDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCACALH  450



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+GCP PCGV +TRL++IN L+ NVEY+ASRD TI GSR+GHAPIFLWY L 
Sbjct  236  SITISGHKFLGCPFPCGVLITRLEYINTLAKNVEYIASRDVTITGSRSGHAPIFLWYALK  295

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +G  G Q EVQKC+ +A YL+ +LR A I AMLNE S+TVVFERP+D++F R+W LAC+
Sbjct  296  ERGSVGLQNEVQKCIISARYLQHRLREAKIGAMLNEFSNTVVFERPQDDDFARKWSLACK  355

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE-GGNSKPPCLAEDVGVSNCCCVLHK  201
            +N++H VVM  VTVE LD F++E IQ R +W++  G   P CLA D+GV NC C+LH+
Sbjct  356  KNIAHGVVMQHVTVEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDIGVGNCACILHE  413



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 136/177 (77%), Gaps = 19/177 (11%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+HIN LS NVEYLASRDATI                 
Sbjct  227  SVSVSGHKFVGCPMPCGVQITRLEHINGLSRNVEYLASRDATI-----------------  269

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
               + GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  270  --DHGGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  327

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  HK
Sbjct  328  GNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  384



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP+PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  PI LWY+L+
Sbjct  275  SVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASMDATISGSRNGLTPILLWYSLS  334

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ A IS MLNELS+ VV ERP D EF R WQL+C 
Sbjct  335  SKGQIGIQKDVKRCLNNARYLKDRLQQANISVMLNELSTIVVLERPHDHEFTRHWQLSCV  394

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            R+++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC C  H
Sbjct  395  RHIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCSCAFH  450



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCP+PCGV +TRL+H+  LS+++EYL+SRDATIMGSRNGHAP++LWYTLN
Sbjct  178  SVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSRDATIMGSRNGHAPMYLWYTLN  237

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKG +KEVQKCLRNAH+L ++L+  G+SA LNELSSTVVFERP+DE FV +WQLACE
Sbjct  238  KKGYKGIRKEVQKCLRNAHHLANRLKEMGVSASLNELSSTVVFERPQDETFVHKWQLACE  297

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAED  237
             +++HVVVMP++ VEKLD F++EL+ AR  W+E       C+A++
Sbjct  298  SSIAHVVVMPNIDVEKLDDFVEELV-ARRAWHERKVFDILCVAKE  341



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCPMPCG+Q+ R  H++ LS N+EY+AS DATI GSR GHAPIFLWY+L+
Sbjct  240  SVSVSGHKFLGCPMPCGIQIARKKHVDILSRNIEYIASIDATISGSRGGHAPIFLWYSLS  299

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +K +   Q + ++C++NA YLKD LR +GISAMLNE S TVVFERP ++EF+ +WQL+CE
Sbjct  300  KKCHTTLQDDAKRCIQNARYLKDSLRNSGISAMLNEHSITVVFERPLEQEFIHKWQLSCE  359

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS-KPPCLAEDVGVSNCCCVLHK  201
            R+M+HVVVMP VT + LD F+ E  + R +WY+ GN  +PPCLA D+G+ NC C  HK
Sbjct  360  RDMTHVVVMPGVTTQMLDNFVSEFAKKRLIWYQDGNKVQPPCLANDIGMHNCVCPHHK  417



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+GCP PCGV +TRL++IN L+ NVEY+ASRD TI GSR GHAPIFLWY L 
Sbjct  246  SITISGHKFLGCPFPCGVLITRLEYINTLAKNVEYIASRDVTITGSRRGHAPIFLWYALK  305

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +G  G Q EVQKC+ +A YL+ +LR A I AMLNE S+TVVFERP+D++F R+W LAC+
Sbjct  306  ERGSVGLQNEVQKCIISARYLQHRLREAKIGAMLNEFSNTVVFERPQDDDFARKWSLACK  365

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE-GGNSKPPCLAEDVGVSNCCCVLHK  201
            +N++H VVM  VTVE LD F++E IQ R +W++  G   P CLA D+GV NC C+LH+
Sbjct  366  KNIAHGVVMQHVTVEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDIGVGNCACILHE  423



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP+PCG+ +TRL +INALS +VEY+ SRD TI GSR GHAPIFLWY + 
Sbjct  281  SVAISGHKFLGCPIPCGIVITRLRYINALSRDVEYIGSRDVTITGSRCGHAPIFLWYAIK  340

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKG  G Q EV+KC+ NAHYL+ +LR AGI AMLN  SSTVVF+RP DEEF RRW LAC+
Sbjct  341  RKGLIGLQNEVRKCIMNAHYLQSRLRNAGIGAMLNRFSSTVVFKRPLDEEFTRRWNLACK  400

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVVM  VT+E LD F+ E +Q RS+W+E    +  C+A+D+G  NC C +H
Sbjct  401  GNIAHVVVMQHVTIEMLDSFVAEFLQKRSIWFEDEQFQHVCIAKDIGSGNCGCSMH  456



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP+PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  PI LWY+L+
Sbjct  275  SVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASMDATISGSRNGLTPILLWYSLS  334

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             K   G Q++V++CL NA YLKD+L+ A IS MLNELS+ VV ERP D EF R WQL+C 
Sbjct  335  SKNQIGIQQDVKRCLYNARYLKDRLQQANISVMLNELSTIVVLERPLDHEFTRHWQLSCV  394

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            R+++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC C LH
Sbjct  395  RDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCACALH  450



>ref|XP_003607344.1| Serine decarboxylase [Medicago truncatula]
Length=207

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHAPIFLWY L 
Sbjct  26   SVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHAPIFLWYALK  85

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F RRW LA  
Sbjct  86   KRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHFTRRWNLASN  145

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG  NC C +H
Sbjct  146  GNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVGSRNCACSIH  201



>gb|AES89541.2| serine decarboxylase [Medicago truncatula]
Length=228

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHAPIFLWY L 
Sbjct  47   SVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHAPIFLWYALK  106

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F RRW LA  
Sbjct  107  KRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHFTRRWNLASN  166

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG  NC C +H
Sbjct  167  GNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVGSRNCACSIH  222



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCGV LTR  +I  +S N+EY+A+ D+TI GSRNGH+PIF+WY LN
Sbjct  282  SVSISGHKFLGCPMPCGVLLTRRKYIKLISRNIEYIATCDSTIAGSRNGHSPIFMWYVLN  341

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG+KG +++V+KCL+NA YL+  L+ AGIS+MLNE S TVVFERP+D EF+R WQL C 
Sbjct  342  IKGWKGLKQDVEKCLKNARYLRHHLKKAGISSMLNETSVTVVFERPQDSEFIRHWQLQCL  401

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             +M+HVVVMP VT+E LD FL +LI+ R++W+  G   PPCLAED+G+ NC C +H
Sbjct  402  GSMAHVVVMPHVTIEMLDRFLYDLIRKRNIWH--GTLHPPCLAEDMGICNCACPVH  455



>gb|ACU18860.1| unknown [Glycine max]
Length=152

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  19   SVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLWYTLN  78

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+
Sbjct  79   RKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACK  138

Query  371  RNMSHV  354
             N++HV
Sbjct  139  GNIAHV  144



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMPCGV +TRL+H   LS++VEY+ASRD+TI GSRNGHAPIFLWYTLN
Sbjct  277  SISVSGHKFMGCPMPCGVVITRLEHAKVLSTDVEYIASRDSTITGSRNGHAPIFLWYTLN  336

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKG  KEVQ CL NA YL+  L+  GISA     S+ VVFERPKDE+FV RWQLACE
Sbjct  337  KKGYKGILKEVQMCLGNARYLEVLLKQVGISASCATTSNIVVFERPKDEKFVCRWQLACE  396

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++H+VVMP+VT EK+  F++E  + R  WY+      PCLA D+G  NC C LH
Sbjct  397  GNLAHIVVMPNVTFEKIIVFVEEFAKKRRDWYQDKGFNIPCLAVDIGKENCYCNLH  452



>gb|KCW44086.1| hypothetical protein EUGRSUZ_L02502 [Eucalyptus grandis]
Length=239

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  605  IMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVV  426
            I   RNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVV
Sbjct  105  IEAVRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVV  164

Query  425  FERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCL  246
            FERP +EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCL
Sbjct  165  FERPSEEEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCL  224

Query  245  AEDVGVSNCCCVLHK  201
            A D+G  NCCC LHK
Sbjct  225  AVDIGAENCCCALHK  239



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHAPIFLWYTL+
Sbjct  283  SISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLWYTLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKG  KEV  C+ NA YL+  L+  GISA  N LS+ VVFERPKDE  V RWQLACE
Sbjct  343  KKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKDERIVCRWQLACE  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++H+VVMP+VT EKL  F++EL + R+ WY+      PCLA D+G  NC C LH
Sbjct  403  GNLAHIVVMPNVTFEKLTVFVEELAEKRNDWYQDKGFDIPCLAVDIGKENCYCNLH  458



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHAPIFLWYTL+
Sbjct  283  SISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLWYTLS  342

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KGYKG  KEV  C+ NA YL+  L+  GISA  N LS+ VVFERPKDE  V RWQLACE
Sbjct  343  KKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKDERIVCRWQLACE  402

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++H+VVMP+VT EKL  F++EL + R  WY+      PCLA D+G  NC C LH
Sbjct  403  GNLAHIVVMPNVTFEKLTVFVEELAEKRKDWYQDKGFDIPCLAVDIGKENCYCNLH  458



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHAPI LWY L 
Sbjct  271  SVTISGHKFLGCPSPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHAPILLWYALK  330

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F RRW LA  
Sbjct  331  KRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHFTRRWNLASN  390

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVV+  +T+E LD F+ E IQ RS+W + G+ +PPC+A DVG  NC C +H
Sbjct  391  ENIAHVVVLKHITIEMLDTFVHEFIQKRSIWSKDGHFQPPCIASDVGSKNCACSIH  446



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+GCP+PCGV LTRL+HIN L  +VE + SRD TI GSR+GHAPIFLWY L 
Sbjct  277  SITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHAPIFLWYALQ  336

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G Q EV KC+ NA YL+ KLR AGI  MLNE S+TVVFE+P D EF+R+W LA +
Sbjct  337  KRGIIGLQNEVHKCMMNARYLQRKLRDAGIGTMLNEFSNTVVFEKPLDIEFIRKWSLAYQ  396

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVVM  VT+E LD F+DE  + R++W++ G  KP CLA+++G  NC C LH
Sbjct  397  GNIAHVVVMQHVTIEMLDSFVDEFTKKRAIWFQYGLRKPICLADEIGAENCICSLH  452



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLWY+L 
Sbjct  267  SVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLWYSLC  326

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQL+C 
Sbjct  327  MKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQLSCT  386

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC C   K
Sbjct  387  RDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQK  443



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLWY+L 
Sbjct  267  SVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLWYSLC  326

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQL+C 
Sbjct  327  MKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQLSCT  386

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC C   K
Sbjct  387  RDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQK  443



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I++LS+ +EY+AS DATI GSRNG API LWY+L 
Sbjct  229  SVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIASTDATISGSRNGLAPILLWYSLC  288

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C+ NA YLK +L  AGISAMLNE S  VVFERP D +F+R+WQL+C 
Sbjct  289  MKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSIIVVFERPNDHKFIRQWQLSCT  348

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
            R+M+H VVMP +T E +D F  +L+  R  WY  G + PPCLA+D+   NC C  HK C+
Sbjct  349  RDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDIASQNCLCCCHKMCH  408



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLWY+L 
Sbjct  278  SVTISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLWYSLC  337

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQL+C 
Sbjct  338  MKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQLSCT  397

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC C   K
Sbjct  398  RDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQK  454



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I++LS+ +EY+AS DATI GSRNG API LWY+L 
Sbjct  269  SVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIASTDATISGSRNGLAPILLWYSLC  328

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C+ NA YLK +L  AGISAMLNE S  VVFERP D +F+R+WQL+C 
Sbjct  329  MKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSIIVVFERPNDHKFIRQWQLSCT  388

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  192
            R+M+H VVMP +T E +D F  +L+  R  WY  G + PPCLA+D+   NC C  HK C+
Sbjct  389  RDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDIASQNCLCCCHKMCH  448



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I +LS+ +EY+AS DATI GSRNG APIFLWY+L 
Sbjct  265  SVSISGHKFLGCPMPCGIQITRKGYITSLSTKIEYIASVDATISGSRNGLAPIFLWYSLC  324

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C  NA YLK +L  AGI+AMLNE S  VVFERP D +F+R WQL+C 
Sbjct  325  MKGRAGLQQDAKMCNENARYLKGRLHKAGINAMLNECSIIVVFERPNDPKFIRHWQLSCT  384

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HVV+MP +T E +D F  +L+Q R  WY+ G + PPCLA+D+G  NC C   K
Sbjct  385  RDMAHVVIMPGITRETIDSFFKDLMQERXKWYQVGTTVPPCLADDIGSQNCICSKQK  441



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLWY+L 
Sbjct  267  SVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLWYSLC  326

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQL+C 
Sbjct  327  MKGRAGLQQDAKMCNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQLSCT  386

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HVVVMP +T E +D F ++L+Q R  WY+ G   PPCLA+D+G  NC C   K
Sbjct  387  RDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTIVPPCLADDIGSQNCLCSKQK  443



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLWY+LN
Sbjct  309  SVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLN  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQLAC+
Sbjct  369  MKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQ  428

Query  371  RNMSHV  354
             N++HV
Sbjct  429  GNVAHV  434



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVS HK +G  +PCGV ++R  H+   S+N+EY+A++D TI GSRNGH PIF+WY LN
Sbjct  200  SVSVSAHKLLGSSIPCGVFISRKMHMTDFSTNIEYIATQDTTISGSRNGHTPIFIWYGLN  259

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GFQKEV+ CL NA YL+D L+ AGISAMLNE S  VVFERP D EFV  WQL+  
Sbjct  260  MKGRIGFQKEVKSCLTNARYLRDGLKEAGISAMLNESSIVVVFERPLDREFVDFWQLSFL  319

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             NM+HVV+MP VTV+ LD FL +L+Q R +WY  G  +P CLAE++GVSNC C +H
Sbjct  320  DNMAHVVLMPHVTVKMLDDFLSDLVQKREIWYGSGEVRPVCLAEEIGVSNCACSIH  375



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVG P+PCGV +TR  H+ ALSS+VEYL SRDATIMGSRNGHAPI+LWYTL 
Sbjct  302  SVSVSGHKFVGAPVPCGVVITRFKHVMALSSDVEYLNSRDATIMGSRNGHAPIYLWYTLT  361

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+G +++V++C+RNAH LK  L  AGI  MLNELS+TVVFERPK+E FVR+WQLACE
Sbjct  362  RKGYEGMRRDVERCMRNAHVLKQMLESAGIRTMLNELSNTVVFERPKEEAFVRKWQLACE  421

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             +++HVVVMP++TVEKL+ F+ + +Q+R+
Sbjct  422  GDIAHVVVMPNITVEKLEEFVADYVQSRA  450



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL +IN LS +VE +ASRDATI GSR GHAPI LWY L 
Sbjct  268  SVTISGHKFLGCPSPCGVVITRLKYINELSRDVEIIASRDATITGSRCGHAPILLWYALK  327

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG  G + EV +C+ NA YL D+LR AGI AMLNE S+ VVFE+P D+ F RRW LA +
Sbjct  328  KKGLIGLKNEVHECIINARYLLDQLRDAGIGAMLNEFSNIVVFEKPLDDNFTRRWNLATK  387

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVV+  VT E LD F+ E IQ RS+WY+ G+ +P C+A  VG +NC C +HK
Sbjct  388  GNIAHVVVLMHVTKEMLDTFVREFIQKRSIWYKHGHFQPLCIANHVGSTNCVCSIHK  444



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVG P+PCGV +TR  ++ ALSS+VEYL SRDATIMGSRNGHAP++LWYTL 
Sbjct  228  SVSVSGHKFVGAPVPCGVIITRFKYVMALSSDVEYLNSRDATIMGSRNGHAPVYLWYTLT  287

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY G +++V+KC+RNAH L+  L  AGI  MLNELS+TVVFERPK+E FVR+WQLACE
Sbjct  288  RKGYDGMRRDVEKCMRNAHVLQQMLESAGIRTMLNELSNTVVFERPKEEAFVRKWQLACE  347

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQAR  288
              ++HVVVMP++TVEKL+ F+ + +Q+R
Sbjct  348  GEIAHVVVMPNITVEKLEEFVADYVQSR  375



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVG P+PCGV +TRL HI ALS++VEYL SRDATIMGSRNGHAPI++WYT  
Sbjct  309  SVSVSGHKFVGAPVPCGVVMTRLKHIQALSTDVEYLNSRDATIMGSRNGHAPIYMWYTFT  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+G +K+V++CLRNAH L+  L  AG+   LNELSSTVVFERP DE+FVRRWQLAC+
Sbjct  369  RKGYEGLRKDVERCLRNAHLLRSMLERAGVVTSLNELSSTVVFERPADEDFVRRWQLACQ  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             +++HVVVMP++TV KL+ F+ ELI  R+
Sbjct  429  GDIAHVVVMPNITVAKLERFVTELIAVRA  457



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKFVG P+PCGV +TRL +I  +SS+VEYL SRDATIMGSRNGHAPI++WYT  
Sbjct  298  SISVSGHKFVGSPVPCGVVMTRLRYIKGVSSDVEYLNSRDATIMGSRNGHAPIYMWYTFT  357

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+G +K+V+KCLRNAH LK  L  AG+  MLNELSSTVVFERP++E FVR+WQLACE
Sbjct  358  RKGYEGLRKDVEKCLRNAHLLKSMLDTAGVRTMLNELSSTVVFERPREESFVRKWQLACE  417

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             +++HVVVMP++T+ KL+ F+ EL+++R+
Sbjct  418  GDIAHVVVMPNITIRKLETFVQELVESRA  446



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL ++NALS +V+ +ASRDATI GSR GHAPIFLWY L 
Sbjct  270  SVTISGHKFLGCPSPCGVLITRLKYMNALSRDVDIIASRDATITGSRCGHAPIFLWYALK  329

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G + EV +C+  AHYL + LR AGI AMLN+ S+ VVFERP D+ F RRW LA  
Sbjct  330  KRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNKFSNIVVFERPLDDHFTRRWNLASN  389

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            +N +HVVV+  VTVE LD F+ E  + +S+WY+    +PPC+A DVG  NC C +H
Sbjct  390  KNTAHVVVLKHVTVEMLDSFVREFTEKQSIWYKDEQFQPPCIANDVGSRNCACSIH  445



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCG+Q+TR  +I +LS+ +EY+AS DATI GSRNG APIFLWY+L 
Sbjct  267  SVSISGHKFLGCPMPCGIQITRKSYITSLSTKIEYIASVDATISGSRNGLAPIFLWYSLC  326

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G Q++ + C  NA YLK +L  AGIS MLNE S  VVFERP   +F+R WQL+C 
Sbjct  327  MKGRAGLQQDAKMCNENARYLKGQLHKAGISTMLNESSIIVVFERPNVPKFIRHWQLSCT  386

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R+M+HVVVMP +T E +D F  +L+Q R  WY+ G   PPCLA+D+G  NC C   K
Sbjct  387  RDMAHVVVMPGITRETIDNFFKDLMQERKKWYQVGIIVPPCLADDIGSQNCLCSKQK  443



>gb|EYU40386.1| hypothetical protein MIMGU_mgv1a026369mg, partial [Erythranthe 
guttata]
Length=300

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 125/177 (71%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHI-NALSSNVEYLASRDATIMGSRNGHAPIFLWYTL  555
            S+SVS HK +G  +PCGV +TR   I N LS NVEY+ + D TI GSRNGHAPIF+WY L
Sbjct  122  SISVSAHKLLGSSIPCGVLMTRKGRITNNLSENVEYIDTLDTTISGSRNGHAPIFIWYGL  181

Query  554  NRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
              KG  G   EV KCL NA YL+D  + AGISAMLNE S  VVFERP   EF+  WQL+ 
Sbjct  182  KMKGRSGLHTEVNKCLTNAKYLRDGFKNAGISAMLNESSIVVVFERPLSREFIDYWQLSL  241

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
               M+HVVVMP VTV+ LD FLD+L+Q R +WY  G  +P CLAE++GVSNC C++H
Sbjct  242  LEKMAHVVVMPHVTVKMLDDFLDDLVQNREIWYGNGKVQPLCLAEEIGVSNCACLVH  298



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 130/173 (75%), Gaps = 1/173 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+GCPMPCG+Q+TR  ++++LS  +EY+ S DATI GSRNG  PIFLWY L+
Sbjct  244  SISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYINSTDATISGSRNGLTPIFLWYCLS  302

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG+   Q++ + C+ NA YLKD+L  AGISAMLNE S TVVFERP D +F+RRW L   
Sbjct  303  TKGHVRLQQDSKICIENARYLKDRLLEAGISAMLNEFSITVVFERPCDHKFIRRWNLCYL  362

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  213
            R M+HVVVMP +T E +D F ++L+Q R  W++ G ++PPCLA+D G  NC C
Sbjct  363  RGMAHVVVMPGITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMC  415



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+GCPMPCG+Q+TR  ++++LS  +EY+AS D TI GSRNG  PIFLWY LN
Sbjct  266  SISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYIASIDTTISGSRNGLTPIFLWYCLN  324

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG+   Q++   C+ NA YLKD+L  AGISAMLNELS  VVFERP D EF+RRWQL   
Sbjct  325  MKGHARLQQDSITCIENARYLKDRLVKAGISAMLNELSIIVVFERPCDHEFIRRWQLCYL  384

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  213
              M+H+VVMP +T E +D F ++L+Q R  W++ G ++PPCLA+D G  NC C
Sbjct  385  SVMAHIVVMPFITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMC  437



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVG PMPCGV +TRL ++ ALSS VEYL SRDATIMGSRNGHAPI+LWYTL 
Sbjct  309  SVSVSGHKFVGAPMPCGVVMTRLRYVEALSSEVEYLNSRDATIMGSRNGHAPIYLWYTLA  368

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKG  G +K+V++CLRNAH LKD L+ AG+ A LN LSSTVVFERP D  FVRRWQLACE
Sbjct  369  RKGLVGMRKDVERCLRNAHLLKDMLQRAGVGASLNPLSSTVVFERPADPAFVRRWQLACE  428

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             +++HV+VMP++TV KL+ F+ EL+  R+
Sbjct  429  GDIAHVIVMPNITVAKLEKFVKELLACRA  457



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVS+SGHKF+GCPMPCGV LTR  +I+ LS+++EY+A+ D TI GSRNGH+PIFLWY LN
Sbjct  276  SVSISGHKFLGCPMPCGVLLTRKRYIDILSTSIEYIATVDTTIAGSRNGHSPIFLWYVLN  335

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG KG +++V+KCL N+ YL+D+L+ AGI++MLNE+S TVVFERP D EF+R WQL C 
Sbjct  336  IKGQKGLEEDVEKCLINSRYLRDRLKKAGINSMLNEMSITVVFERPPDSEFIRHWQLQCL  395

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWY  276
             NM+HVV+MP VTVE LD FL +L+Q R++WY
Sbjct  396  GNMAHVVIMPHVTVEMLDHFLYDLLQKRNIWY  427



>ref|XP_006362640.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=346

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GC M CGVQ+TR  +I  +S  VEY+AS D TI GSRNG APIFLWY+L+
Sbjct  169  SISVSGHKFLGCSMLCGVQITRKTYIATISKRVEYIASIDNTISGSRNGLAPIFLWYSLS  228

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG+ G Q+  + C  NA YLKD+L  AGISAMLNELS+ VVFERP D++F+RRWQL+C 
Sbjct  229  MKGHVGLQQHAKMCYENARYLKDRLHKAGISAMLNELSNIVVFERPCDDKFIRRWQLSCT  288

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            R+ +HVVVMP  T E +D F  +L+Q R  W   G +  PCLA+D+G  NC C  H
Sbjct  289  RDTAHVVVMPGTTKEIIDNFFKDLMQEREKW--CGITLAPCLADDIGSQNCLCSYH  342



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 121/177 (68%), Gaps = 39/177 (22%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR                                      
Sbjct  219  SVSVSGHKFVGCPMPCGVQITR--------------------------------------  240

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GFQKEVQKCLRNAHYLKD+L+ AGISAMLNELSSTVVFERPKDEEFVRRWQLACE
Sbjct  241  -KGYRGFQKEVQKCLRNAHYLKDRLKDAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  299

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
              +SHVVVMPSV V+KLD FL+EL++ R  WY+ G  + PC+A DVG  NC C LHK
Sbjct  300  GGISHVVVMPSVNVDKLDTFLNELVEKRVTWYQEGKCQSPCIAADVGQENCLCTLHK  356



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL +++A+S +V  +ASRDATI GSR GHAPIFLWY L 
Sbjct  273  SVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRCGHAPIFLWYALK  332

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G + EV +C+  AHYL + LR AGI AMLNE S+ VVFERP D++F R W LAC 
Sbjct  333  KRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLDDDFNRSWNLACS  392

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVV+  V+VE LD F+ E I+ RS+W +    KP C+A DVG  NC C++H
Sbjct  393  GNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGSKNCACLMH  448



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVS HK +G  MPCG+ ++R  H+   S+N+EY+A+ D TI GSRNGH PIF+WY LN
Sbjct  240  SVSVSAHKLLGSSMPCGILISRKMHMTDFSTNIEYIATLDTTISGSRNGHTPIFIWYGLN  299

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QKEV  CL NA YL+D L  AGISAMLNE S  VVFERP D EF+  WQL+  
Sbjct  300  LKGRIGLQKEVNNCLTNAKYLRDGLNKAGISAMLNESSIVVVFERPLDREFIDYWQLSFL  359

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
              M+HVV+MP VT++ LD FL +L++ R +WY  G  +P CLAE++G SNC C +H+
Sbjct  360  GKMAHVVLMPHVTMKMLDDFLSDLVRKREIWYGSGEVRPVCLAEEIGASNCACSIHR  416



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+GCP+PCGV LTRL+HIN L  +VE + SRD TI GSR+GHA IF+WY L 
Sbjct  263  SITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHASIFIWYALQ  322

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG  G + EV KC+ NA YLK KLR AGI  MLNE S+TVVFE+P D EF+R+W LA E
Sbjct  323  KKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNTVVFEKPLDCEFIRKWNLAYE  382

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             +++HVVVM  VTVE LD F+DE I+ R         KP CLA+ +G  NC C+LH
Sbjct  383  GDIAHVVVMQHVTVEMLDSFVDEFIKTRL-------RKPLCLADKIGAENCTCILH  431



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GC MPCGVQ+T+  +I  +S  VEY+AS D TI GSRNG APIFLWY+L+
Sbjct  267  SISVSGHKFLGCSMPCGVQITKRTYITTISKQVEYIASIDNTISGSRNGLAPIFLWYSLS  326

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+ + C  NA YLKD+L  AGISAMLNE S+ VVFERP D +F+RRWQL+C 
Sbjct  327  MKGNAGLQKDAKICYENARYLKDRLHKAGISAMLNEFSNIVVFERPCDNKFIRRWQLSCA  386

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  213
            R+ +HVVVMP  T E +D F  +L+Q R  W   G +  PCLA+D+G  NC C
Sbjct  387  RDTAHVVVMPGTTKEIIDNFFKDLVQEREKW--CGITLGPCLADDIGSQNCLC  437



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+GCP+PCGV LTRL+HIN L  +VE + SRD TI GSR+GHA IF+WY L 
Sbjct  287  SITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHASIFIWYALQ  346

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG  G + EV KC+ NA YLK KLR AGI  MLNE S+TVVFE+P D EF+R+W LA E
Sbjct  347  KKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNTVVFEKPLDCEFIRKWNLAYE  406

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             +++HVVVM  VTVE LD F+DE I+ R         KP CLA+ +G  NC C+LH
Sbjct  407  GDIAHVVVMQHVTVEMLDSFVDEFIKTRL-------RKPLCLADKIGAENCTCILH  455



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 127/177 (72%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVS HK +G  MPCGV +TR  HI   S N+EY+A+ D TI GSRNGHAPIF+WY+LN
Sbjct  253  SVSVSAHKLLGSSMPCGVFMTRKRHIADFSRNIEYIATVDNTISGSRNGHAPIFIWYSLN  312

Query  551  RK-GYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
             K G  G QKEV KCL NA YL+D L+ AGIS MLNE +  VVFERP D EF+  WQL+ 
Sbjct  313  MKLGRMGLQKEVNKCLMNARYLRDGLKNAGISVMLNESNILVVFERPLDLEFIYHWQLSV  372

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            +  M+HV+VMP VTV+ LD FL +L + R +WY  G  +  CLAED+G+SNC C +H
Sbjct  373  DGKMAHVIVMPHVTVKMLDDFLSDLTRKREIWYGSGEVRRLCLAEDIGLSNCACSVH  429



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+G P+PCGV +TR  H+ ALSS+VEYL SRDATIMGSRNGHAP++LWYTL 
Sbjct  304  SVSVSGHKFLGAPVPCGVVITRFRHVLALSSDVEYLNSRDATIMGSRNGHAPLYLWYTLT  363

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY G  ++V++C+RNAH LK  L  AG+  MLNELS+TVVFERP++E FVR+WQLACE
Sbjct  364  RKGYAGIARDVERCMRNAHTLKSMLDQAGVKTMLNELSNTVVFERPREEAFVRKWQLACE  423

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             +++HVVVMP++ + KL+ F+ + I +R+
Sbjct  424  GDIAHVVVMPNIDIAKLEEFVQDYISSRA  452



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 130/177 (73%), Gaps = 6/177 (3%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFLWYTL  555
            S+ +SGHKF+GCP+PCGV +TRL  IN  +S+N+EY++S D TI GSRNGHAPIFLWY L
Sbjct  228  SICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYAL  287

Query  554  NRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
             R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERPKDE FVR+WQLAC
Sbjct  288  KRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPKDETFVRKWQLAC  347

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            +  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DVG  NC C LH
Sbjct  348  QGKIAHVVVMPNVSLERINMFLEEFTKSRITLHQD-----KCVAGDVGQENCLCSLH  399



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+GCP+PCGV +TR +H   LS++V+Y++SRDATI GSRNGHAP+FLW  LN
Sbjct  295  SVSVSGHKFLGCPVPCGVVITRREHAAVLSTDVDYISSRDATITGSRNGHAPLFLWCALN  354

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAM-LNELSSTVVFERPKDEEFVRRWQLAC  375
             KG +G + +V +CLRNA +L  +LR AG+SA  LN LS TVV ERP+DE FVR+WQL+C
Sbjct  355  AKGRRGIRDDVHRCLRNARFLARRLRDAGVSAARLNPLSITVVLERPRDEAFVRKWQLSC  414

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS--KPPCLAEDVGVSNCCC  213
            +  ++HVVVMP+V V+K+  F+++L   R +WY  G      PC+A+D+G  NC C
Sbjct  415  QGGVAHVVVMPNVGVDKIASFVEDLAAKRRIWYPHGEGLRVGPCVAKDIGQENCLC  470



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMPCG+Q+TR  +++ LS  +EY+AS D TI GSR G  PIFLWY LN
Sbjct  265  SISVSGHKFLGCPMPCGIQITRKTYVSTLSK-IEYIASIDTTISGSRYGLTPIFLWYYLN  323

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG+ G Q++   C+ NA YLKDKL  AGI AMLNE S  VVFERP D +F+ RWQL   
Sbjct  324  MKGHAGLQQDSITCIENARYLKDKLVKAGIGAMLNEFSIIVVFERPCDHKFILRWQLCYL  383

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  213
              ++H+VVMP +T E ++ F +EL+Q R  W++ G +KPPCLA++ G  NC C
Sbjct  384  SGLAHIVVMPGITREIINSFFNELMQERKRWFQDGKTKPPCLADEFGSQNCMC  436



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFLWYTL  555
            S+ +SGHKF+GCP+PCGV +TRL  IN  +S+N+EY++S D TI GSRNGHAPIFLWY L
Sbjct  155  SICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYAL  214

Query  554  NRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
             R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERP DE FVR+WQLAC
Sbjct  215  KRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPNDETFVRKWQLAC  274

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            +  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DV   NC C LH
Sbjct  275  QGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQ-----DKCVAGDVSQENCLCSLH  326



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFLWYTL  555
            S+SVSGHK +GCP PCGV + RL  IN  +S+N+EY+ASRDATI GSRNGHAPI +WYTL
Sbjct  263  SISVSGHKLLGCPTPCGVVVNRLKDINLVMSTNIEYVASRDATITGSRNGHAPIIMWYTL  322

Query  554  NRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
               GY G + +V  C+R A YL+  L+  G+S +LN  SSTV+FERPKDE FVR+WQLAC
Sbjct  323  KCLGYNGIRMKVTTCIRKAEYLEFLLKKKGVSTLLNPGSSTVIFERPKDEVFVRKWQLAC  382

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            E N++HVVVMP+V++  L  F+DEL + R +         PC+A D+G  NC C LH
Sbjct  383  EGNLAHVVVMPNVSIRHLFRFVDELAENRYIMLHDKEISTPCVAADIGPGNCMCNLH  439



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKF+G P+PCGV +TR  ++ ALS++VEYL SRDATIMGSRNGHAPI++W+TL 
Sbjct  204  SVSVSGHKFIGAPVPCGVVITRQKYVAALSNDVEYLNSRDATIMGSRNGHAPIYMWFTLT  263

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            RKGY+G +K+V++CLRNA  LK  L  AG+  MLNELSSTVVFERP++E FVR+WQLACE
Sbjct  264  RKGYEGMRKDVERCLRNALVLKSMLEQAGVKVMLNELSSTVVFERPREEAFVRKWQLACE  323

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
              ++HVVVMP+V +  L+ F+ +LI +R+
Sbjct  324  GEVAHVVVMPNVHMAILEEFVADLIASRT  352



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+GCPMPCG+Q+TR  +++   S +EY+ S DATI GSRNG  PIFLWY L+
Sbjct  266  SISISGHKFLGCPMPCGIQITRKTYVST-HSKIEYINSTDATISGSRNGFTPIFLWYCLS  324

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG+   Q++   C+ NA YLKD+L  AGIS MLNE S TV+FER  D +F+ RW L   
Sbjct  325  KKGHARLQQDSITCIENARYLKDRLLEAGISVMLNEFSITVIFERSCDHKFIHRWNLCYL  384

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
            R M+HVVVMP +T E +D F  +L+Q R  W++ G ++PPCLA++ G  NC C  +K
Sbjct  385  RGMAHVVVMPGITRETIDSFFKDLMQERKRWFQDGKTQPPCLADEFGSQNCMCSHNK  441



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   220 bits (561),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCP PCGV +TRL +++A+S +V  +ASRDATI GSR GHAPIFLWY L 
Sbjct  289  SVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRCGHAPIFLWYALK  348

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            ++G  G + EV +C+  AHYL + LR AGI AMLNE S+ VVFERP D++F R W LAC 
Sbjct  349  KRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLDDDFNRSWNLACS  408

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
             N++HVVV+  V+VE LD F+ E I+ RS+W +    KP C+A DVG  NC C++H
Sbjct  409  GNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGSKNCACLMH  464



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFLWYTL  555
            S+ +SGHKF+GCP+PCGV +TRL  IN  +S+N+EY++S D TI GSRNGHAPIFLWY L
Sbjct  267  SICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYAL  326

Query  554  NRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
             R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERP DE FVR+WQLAC
Sbjct  327  KRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPNDETFVRKWQLAC  386

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  204
            +  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DV   NC C LH
Sbjct  387  QGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQD-----KCVAGDVSQENCLCSLH  438



>ref|NP_001234136.1| histidine decarboxylase [Solanum lycopersicum]
 sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+GCPM CGVQ+TR  +++ LS  +EY+ S DATI GSRNG  PIFLWY L+
Sbjct  235  SISISGHKFLGCPMSCGVQITRRSYVSTLSK-IEYINSADATISGSRNGFTPIFLWYCLS  293

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG+   Q++   C+ NA YLKD+L  AGIS MLN+ S TVVFERP D +F+RRW L C 
Sbjct  294  KKGHARLQQDSITCIENARYLKDRLLEAGISVMLNDFSITVVFERPCDHKFIRRWNLCCL  353

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSV-WYEGGNSKPPCLAEDVGVSNCCC  213
            R M+HVV+MP +T E +D F  +L+Q R+  WY+   + PPCLA+D+ + NC C
Sbjct  354  RGMAHVVIMPGITRETIDSFFKDLMQERNYKWYQDVKALPPCLADDLAL-NCMC  406



>gb|AEW07461.1| hypothetical protein 0_2106_01, partial [Pinus radiata]
 gb|AFG54678.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54680.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54681.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54683.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54684.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54685.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54688.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54689.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54690.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54691.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54692.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54693.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54694.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HINALS +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  50   SVSVSGHKFVGCPMPCGVQITRIEHINALSRDVEYLASRDATIMGSRNGHAPIFLWYTLN  109

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTV  429
            RKGY+GFQKEVQKCLRNAHYLK + R AGISAMLNELSSTV
Sbjct  110  RKGYRGFQKEVQKCLRNAHYLKGRFRSAGISAMLNELSSTV  150



>gb|AFG54679.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54682.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54686.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54687.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVGCPMPCGVQ+TR++HINALS +VEYLASRDATIMGSRNGHAPIFLWYTLN
Sbjct  50   SVSVSGHKFVGCPMPCGVQITRIEHINALSRDVEYLASRDATIMGSRNGHAPIFLWYTLN  109

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTV  429
            RKGY+GFQKEVQKCLRNAHYLK + R  GISAMLNELSSTV
Sbjct  110  RKGYRGFQKEVQKCLRNAHYLKGRFRSVGISAMLNELSSTV  150



>ref|XP_009609584.1| PREDICTED: histidine decarboxylase-like, partial [Nicotiana tomentosiformis]
Length=269

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SGHKF+GCPMPCGVQ+TR  +IN LS NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  141  SVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTPIFLWYSLS  200

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQL+C 
Sbjct  201  AKGQIGLQKDVKRCLDNAIYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCM  260

Query  371  RNMSHVVVM  345
            ++M+HV+VM
Sbjct  261  KDMAHVIVM  269



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 117/177 (66%), Gaps = 34/177 (19%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVG                                  SRNGHAPIFLWY+LN
Sbjct  312  SVSVSGHKFVG----------------------------------SRNGHAPIFLWYSLN  337

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+G QKEVQKCLRNAHY K +L  AGI AM+NELSSTVVFERP DEEFV +WQLAC+
Sbjct  338  MKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVNELSSTVVFERPHDEEFVHKWQLACQ  397

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKL  FL+EL+Q R  W+  G  +P C+A  VG  NC C +H+
Sbjct  398  GNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDGKCQPRCIASAVGHENCLCFIHR  454



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 117/177 (66%), Gaps = 34/177 (19%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SVSVSGHKFVG                                  SRNGHAPIFLWY+LN
Sbjct  352  SVSVSGHKFVG----------------------------------SRNGHAPIFLWYSLN  377

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+G QKEVQKCLRNAHY K +L  AGI AM+NELSSTVVFERP DEEFV +WQLAC+
Sbjct  378  MKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVNELSSTVVFERPHDEEFVHKWQLACQ  437

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  201
             N++HVVVMP+VT+EKL  FL+EL+Q R  W+  G  +P C+A  VG  NC C +H+
Sbjct  438  GNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDGKCQPRCIASAVGHENCLCFIHR  494



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S++VSGHK +GCPMPCG+ LTR +H+  +   ++YL S D TIMGSRNG A ++LWY+L 
Sbjct  219  SIAVSGHKMLGCPMPCGIALTRKEHVKKVEQKIDYLNSVDTTIMGSRNGQAALYLWYSLR  278

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG  G +++V  C+  A YL+DK+  AG++  LN+LSSTVV ERP D+ F++RWQLACE
Sbjct  279  KKGIAGIKRDVVHCMETAQYLRDKITEAGLTCRLNDLSSTVVLERPMDDAFIKRWQLACE  338

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVW  279
             +++HVVVMP+VT  K+D F++EL++ ++V+
Sbjct  339  EDIAHVVVMPNVTRFKIDKFVEELVECKNVY  369



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S++VSGHK +GCPMPCGV L+R +H+  L  +++YL S D TIMGSRNG A ++LWY+L 
Sbjct  219  SIAVSGHKMLGCPMPCGVALSRKEHVKNLEQHIDYLNSVDTTIMGSRNGQAALYLWYSLR  278

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG  G +++V  C+  A YLKD L   G++  LN+LSSTVV ERP D++ V+RWQLACE
Sbjct  279  KKGIGGIKRDVMHCMETARYLKDALTAKGLTCRLNDLSSTVVLERPMDDDLVKRWQLACE  338

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQ  294
             +++HVVVMP+VT  K+D F++EL+Q
Sbjct  339  EDIAHVVVMPNVTRYKIDLFVEELMQ  364



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMP GV + R D++  +  ++ YL S+D TIMGSRNG AP+F+W T+ 
Sbjct  512  SMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLFMWNTIQ  571

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GF K+  +CL  A  L  +LR AG+S+MLN +S+TVVFERP +  FV++WQLACE
Sbjct  572  LKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKKWQLACE  631

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCV  210
             N++H +VMP++T EK+  F+ EL+ +R    +G   K  C+A  +G +NC C 
Sbjct  632  GNIAHAIVMPNITEEKIVVFVTELLASRKA--QGTCDK--CVAMHIGRANCLCT  681



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMP GV + R D++  +  ++ YL S+D TIMGSRNG AP+F+W T+ 
Sbjct  503  SMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLFMWNTIQ  562

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KG  GF K+  +CL  A  L  +LR AG+S+MLN +S+TVVFERP +  FV++WQLACE
Sbjct  563  LKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKKWQLACE  622

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCV  210
             N++H +VMP++T EK+  F+ EL+ +R    +G   K  C+A  +G +NC C 
Sbjct  623  GNIAHAIVMPNITEEKIVVFVTELLASRKA--QGTCDK--CVAMHIGRANCLCT  672



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 125/175 (71%), Gaps = 9/175 (5%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMPCGV +TR  ++  L S+++YL S D TIMGSRNG A ++LW TL 
Sbjct  265  SISVSGHKFMGCPMPCGVTITRKRYVETLKSHIDYLNSVDTTIMGSRNGQASLYLWLTLR  324

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +KG +GF  + +KCL NA Y+   L+ AG+  +LN+ S+T+V ERP DEEFV++WQLACE
Sbjct  325  KKGTEGFASDARKCLENAKYMIKLLKEAGVGCLLNDHSNTIVLERPMDEEFVKKWQLACE  384

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPP--CLAEDVGVSNCCC  213
              ++H +VMP+V+ +K++ F+++ +++R        S P   C+A+ +G  +C C
Sbjct  385  GTVAHCIVMPNVSKQKIEDFVNDYLESRK-------SHPADLCIAKHIGPVHCLC  432



>ref|XP_003593127.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63378.1| serine decarboxylase [Medicago truncatula]
Length=124

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  536  GFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSH  357
             F+KEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+ N++H
Sbjct  7    SFEKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAH  66

Query  356  VVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  219
            VVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C
Sbjct  67   VVVMPNVTIEKLDDFLNELVQKRATWFEYGTFQPYCIASDVGENSC  112



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+G P+ CGV LTR + +N + ++++Y+ S+D TI+GSRNGHAP+FLWY L 
Sbjct  214  SIAISGHKFIGSPLVCGVVLTRKEFVNKIETSIDYIGSKDTTILGSRNGHAPLFLWYALK  273

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            +K Y+G  KEV+ CL N+ YL + L+      MLN  S+TVVF++P   + V++WQLA +
Sbjct  274  KKDYQGLAKEVEFCLENSQYLFNNLQLLNYPCMLNNFSNTVVFKKPP-IQLVKKWQLATQ  332

Query  371  RNMSHVVVMPSVTVEKLDCFLDEL  300
             + +H+VVM ++   K+D F+ +L
Sbjct  333  GDWAHMVVMQNINRHKIDTFITDL  356



>ref|WP_040468965.1| histidine decarboxylase, partial [Fischerella thermalis]
Length=165

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A +FLWY + 
Sbjct  10   SISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALFLWYAIQ  69

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQLA +
Sbjct  70   TRS-QHFHKEVANCLQNARYLRDRLLELDYHPLLNDFSTTVVFDKPA-IELCRKWQLATQ  127

Query  371  RNMSHVVVMPSVTVEKLDCFLDELI  297
             N++H+VVM  ++ +K+D F+D L+
Sbjct  128  GNIAHIVVMQHISTQKIDQFIDNLL  152



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 109/165 (66%), Gaps = 5/165 (3%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+G P+  G+ LTR  ++N + ++VEY+ S+D TI+GSR+G A + LWY + 
Sbjct  225  SISVSGHKFIGSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRSGIAALLLWYAIQ  284

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             + +  FQKEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQLA E
Sbjct  285  TRSHH-FQKEVASCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKPGI-ELCRKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE---GGNSKPPCL  246
             N +HVVVM  ++ +K+D F+  L+  + +  E    GN K  C+
Sbjct  343  ENFAHVVVMQHISTQKIDLFIQNLLVNKEIENEKVLTGNRKTMCV  387



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 104/145 (72%), Gaps = 2/145 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++SG KF+G P+PCGV LT+   +  + + +EY+ S+D TI+GSRNGH P+ LWY L 
Sbjct  222  SVAISG-KFIGSPIPCGVVLTKKKWVEKVETMIEYIGSKDTTILGSRNGHTPLILWYALK  280

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             KGY+GF +E + C++NA YL  +L+      MLN+ S+TVVF++P ++  +++WQLA  
Sbjct  281  TKGYEGFAQEAKTCIQNAQYLFQQLQLREYPCMLNKFSNTVVFQKP-NQVLIKKWQLATL  339

Query  371  RNMSHVVVMPSVTVEKLDCFLDELI  297
             N +H++VM ++  +K+D F++EL+
Sbjct  340  DNFAHLIVMQNIDRQKIDTFVNELV  364



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 110/169 (65%), Gaps = 5/169 (3%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+G P+  G+ LTR  ++N + ++VEY+ S+D TI+GSR+G   + LWY + 
Sbjct  225  SISVSGHKFIGSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRSGITALLLWYAIQ  284

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +  + FQKEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQLA E
Sbjct  285  TRS-QHFQKEVASCLQNARYLRDRLLERNYHPLLNDFSTTVVFDKP-GIELCRKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGG---NSKPPCLAEDV  234
            +N++H+VVM  ++ +K+D F+  L+  + +  E     N K  C+   V
Sbjct  343  QNLAHIVVMQHISTQKIDLFIQNLLVNKEIGNEKALTENRKTICVINSV  391



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   154 bits (390),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 99/149 (66%), Gaps = 18/149 (12%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINAL-SSNVEYLASRDATIMGSRNGHAPIFLWYTL  555
            S+SVSGHK +GCP PCGV + RL  I+ L S+N+EY+AS D TI GSRNG +PIFLWY L
Sbjct  843  SISVSGHKLLGCPTPCGVVINRLKDIDVLKSTNIEYIASNDVTISGSRNGQSPIFLWYKL  902

Query  554  NRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLAC  375
               GY     EV            +LR  GISA +N  S  V+FE+PKDE F+++WQLAC
Sbjct  903  KSMGY-----EV------------RLRNVGISAFMNSKSIIVIFEKPKDEMFMQKWQLAC  945

Query  374  ERNMSHVVVMPSVTVEKLDCFLDELIQAR  288
              N++HVVVMP V+ E L  F++EL + R
Sbjct  946  AGNVAHVVVMPHVSFEMLGIFVEELAEKR  974



>ref|XP_005840580.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
 gb|EKX53600.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
Length=338

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+++SGHKF+G P PCGV +T     + + + ++Y+ S D TI+GSRNGHAP+FL + + 
Sbjct  189  SIAISGHKFLGTPFPCGVFVTEKKFRSLIENRIDYIDSVDDTILGSRNGHAPLFLKHIIT  248

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             K  KGF+++V +CL  A +L ++++  GI A +N+LS TV+F RP  E  V+RWQLA  
Sbjct  249  VKQNKGFKEDVFRCLYLAQWLVNRMQSLGIDAWMNDLSITVIFPRPA-EIVVKRWQLASN  307

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             N+SHVVVMP VT E L+ FL E +   S
Sbjct  308  GNLSHVVVMPHVTQEMLEVFLKEYLANPS  336



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A + LWY + 
Sbjct  225  SISVSGHKFIGSPITYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALLLWYAIQ  284

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +  + F +EV  CL+NA YL+D+L       +LN+ S+TVVF++P D E  R+WQLA E
Sbjct  285  TRN-QQFHREVATCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKP-DIELCRKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDELI  297
             N++H+VVM  ++ +K+D F+D L+
Sbjct  343  GNLAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 6/158 (4%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+G P+  G+ LTR  ++N + +++EY+ S+D TI+GSR+G A + LWY + 
Sbjct  225  SISVSGHKFIGSPITYGIVLTRQPYVNKIETSIEYIGSQDTTILGSRSGIAALLLWYAI-  283

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            R   + FQKEV  CL+NA YL+D+L       +LN+ S TVVF++P   E  R+WQLA E
Sbjct  284  RTRSQHFQKEVASCLQNARYLRDRLLEINYHPLLNDFSITVVFDKP-GIELCRKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSK  258
             N++HVVVM  ++ +K+D F+  L+  + +    GN K
Sbjct  343  ENLAHVVVMQHISSQKIDLFIRNLLVNKEI----GNEK  376



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A +FLWY + 
Sbjct  225  SISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALFLWYAIQ  284

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQLA +
Sbjct  285  TRS-QHFHKEVANCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKPAI-ELCRKWQLATQ  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDELI  297
             N++H+VVM  ++ +K+D F+D L+
Sbjct  343  GNIAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 98/145 (68%), Gaps = 2/145 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            SV++S  KF+G P+PCGV LT+   +  + + +EY+ S+D TI+GSRNGH P+ LWY + 
Sbjct  222  SVAISA-KFIGSPLPCGVVLTKKKWVEKVETEIEYIGSKDTTILGSRNGHTPLILWYAVQ  280

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +GY G  KE + C+ NA YL  +L+      MLN  S+TVVF++P  +  +++WQLA  
Sbjct  281  TRGYDGLAKEAKTCIHNAQYLFQQLQIREYPCMLNNFSNTVVFQKP-SQRLIKKWQLAVF  339

Query  371  RNMSHVVVMPSVTVEKLDCFLDELI  297
             N +H++VM ++  EK+D F++EL+
Sbjct  340  ENWAHMIVMQNIVREKIDIFINELL  364



>ref|WP_025665600.1| histidine decarboxylase [Aquimarina megaterium]
Length=373

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY + 
Sbjct  224  SISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIK  283

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E + +WQLA E
Sbjct  284  KLGVEGFKKRTEHSLGVASYTENKLKDLGIEAWRNPNAITIVFPAPS-TEIIDKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDEL  300
               SH++ MP+V+ E++D F+ ++
Sbjct  343  NGQSHIICMPNVSYEQIDSFIADI  366



>ref|WP_034238501.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=373

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY + 
Sbjct  224  SISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIK  283

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E + +WQLA E
Sbjct  284  KLGVEGFKKRTEHSLGVASYTENKLKNLGIEAWRNPNAITIVFPAPS-TEIIDKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDEL  300
               SH++ MP+V+ E++D F+ ++
Sbjct  343  NGQSHIICMPNVSYEQIDNFIADI  366



>gb|EZH75803.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=377

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY + 
Sbjct  228  SISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIK  287

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E + +WQLA E
Sbjct  288  KLGVEGFKKRTEHSLGVASYTENKLKNLGIEAWRNPNAITIVFPAPS-TEIIDKWQLATE  346

Query  371  RNMSHVVVMPSVTVEKLDCFLDEL  300
               SH++ MP+V+ E++D F+ ++
Sbjct  347  NGQSHIICMPNVSYEQIDNFIADI  370



>gb|KCW71157.1| hypothetical protein EUGRSUZ_F04254 [Eucalyptus grandis]
Length=85

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  455  MLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY  276
            MLNELSSTVVFERP +EEFVRRWQLA E N++HVVVMPSV++EKLD F++ELI+ RS WY
Sbjct  1    MLNELSSTVVFERPSEEEFVRRWQLAFEGNIAHVVVMPSVSIEKLDVFVNELIEKRSTWY  60

Query  275  EGGNSKPPCLAEDVGVSNCCCVLHK  201
              G  + PCLA D+G  NCCC LHK
Sbjct  61   RDGTVQSPCLAVDIGAENCCCALHK  85



>ref|WP_035090976.1| histidine decarboxylase [Aquimarina macrocephali]
Length=373

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 94/144 (65%), Gaps = 1/144 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S+SGHKF+G PMP GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY + 
Sbjct  224  SISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIK  283

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
            + G +GF+K  +  L  A Y + KL+  GI A  N  + T++F  P   + + +WQLA E
Sbjct  284  KLGIEGFKKRTEHSLAVASYTESKLKNLGIEAWRNPNAITIIFPAPS-PKIINKWQLATE  342

Query  371  RNMSHVVVMPSVTVEKLDCFLDEL  300
               SH++ MP+V+ E++D F+ ++
Sbjct  343  NGQSHIICMPNVSYEQIDNFIADM  366



>ref|WP_008878268.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans]
 emb|CCV09416.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans 
STM 2683]
Length=366

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+S SGHK +G PMPCG+ + R +H+N ++S++ YL S D T+MGSRNGHA I +W  + 
Sbjct  205  SISASGHKMIGTPMPCGILVARRNHVNRIASSISYLRSNDTTLMGSRNGHASIAIWERIV  264

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
              G  GFQ+E Q CL  A  L  +LR  G+  + N+ S T+VF +P D + V+ +QLAC+
Sbjct  265  ELGEDGFQRETQACLARATRLAQRLRQMGVPVLQNKHSLTLVFPKPND-DIVKMYQLACD  323

Query  371  RNMSHVVVMPSVTVEKLDCFLDE  303
              ++H +VMP+V  E ++ F+ +
Sbjct  324  GELAHAIVMPNVNDELINRFIHD  346



>ref|WP_026731780.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=364

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 101/149 (68%), Gaps = 2/149 (1%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S++VSGHKF+G P+  G+ LTR +++  +   +EYL + D TI GSR G   +FLWY + 
Sbjct  218  SIAVSGHKFIGSPIHFGIVLTRREYVQKIGKRIEYLGTDDTTITGSRCGLNALFLWYAIA  277

Query  551  RKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACE  372
             +G K F +EV  CL NA YL+D+L+  G + +LN+ S TV F++P   +   +WQLA E
Sbjct  278  TRGQK-FAREVVTCLENAQYLRDRLQQIGYNPLLNDFSITVAFKKPP-AKVCDKWQLAIE  335

Query  371  RNMSHVVVMPSVTVEKLDCFLDELIQARS  285
             N++HVVVM  ++ +K++  +D+L+QA++
Sbjct  336  GNLAHVVVMQHISTQKINELIDDLLQAQA  364



>ref|WP_003516909.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|EEU01894.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
DSM 2360]
 gb|ADU73661.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
DSM 1313]
 gb|EIC03488.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
YS]
 gb|EIC11668.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
AD2]
Length=398

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFLWYT  558
            S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + LWY 
Sbjct  246  SIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLLWYQ  305

Query  557  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  378
            +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W LA
Sbjct  306  INRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYWSLA  364

Query  377  CERNMSHVVVMPSVTVEKLDCFLDELIQAR  288
            CE + +H+++M  VT E +D F++ L+ ++
Sbjct  365  CEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_020457998.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|ABN54224.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
ATCC 27405]
Length=398

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFLWYT  558
            S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + LWY 
Sbjct  246  SIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLLWYQ  305

Query  557  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  378
            +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W LA
Sbjct  306  INRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYWSLA  364

Query  377  CERNMSHVVVMPSVTVEKLDCFLDELIQAR  288
            CE + +H+++M  VT E +D F++ L+ ++
Sbjct  365  CEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_023062889.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 emb|CDG37515.1| histidine decarboxylase [Ruminiclostridium thermocellum BC1]
Length=398

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFLWYT  558
            S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + LWY 
Sbjct  246  SIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLLWYQ  305

Query  557  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  378
            +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W LA
Sbjct  306  INRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYWSLA  364

Query  377  CERNMSHVVVMPSVTVEKLDCFLDELIQAR  288
            CE + +H+++M  VT E +D F++ L+ ++
Sbjct  365  CEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_003514849.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|EFB37130.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
JW20]
Length=398

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFLWYT  558
            S+++SGHKFVGCPMP G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + LWY 
Sbjct  246  SIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLLWYQ  305

Query  557  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  378
            +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W LA
Sbjct  306  INRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYWSLA  364

Query  377  CERNMSHVVVMPSVTVEKLDCFLDELIQAR  288
            CE + +H+++M  VT E +D F++ L+ ++
Sbjct  365  CEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|NP_001176002.1| Os10g0105700 [Oryza sativa Japonica Group]
 dbj|BAH94730.1| Os10g0105700 [Oryza sativa Japonica Group]
Length=219

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  731  SVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  552
            S+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHAPIFLWYTL+
Sbjct  126  SISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLWYTLS  185

Query  551  RKGYKGFQKEVQKCLRNAHYLK  486
            +KGYKG  KEV  C+ NA YL+
Sbjct  186  KKGYKGLLKEVHICMGNARYLE  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485