BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022L18

Length=790
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631700.1|  PREDICTED: squalene synthase                       338   4e-111   Nicotiana tomentosiformis
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    336   2e-110   Nicotiana benthamiana
ref|XP_009802568.1|  PREDICTED: squalene synthase                       335   7e-110   Nicotiana sylvestris
gb|AAB08578.1|  squalene synthase                                       335   8e-110   Nicotiana tabacum [American tobacco]
gb|AAY22201.1|  squalene synthase                                       331   2e-108   Datura inoxia [downy thornapple]
gb|AAD20626.1|  squalene synthase                                       332   2e-108   Capsicum annuum
dbj|BAA82093.1|  squalene synthase                                      330   6e-108   Solanum tuberosum [potatoes]
gb|AEX26929.1|  squalene synthase 1-1                                   330   8e-108   Solanum tuberosum [potatoes]
gb|ADW78251.1|  squalene synthase                                       329   1e-107   Withania somnifera [ashwagandha]
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       328   4e-107   Solanum tuberosum [potatoes]
gb|AEX26930.1|  squalene synthase 1-2                                   327   1e-106   Solanum tuberosum [potatoes]
ref|NP_001234716.1|  squalene synthase                                  325   4e-106   
gb|AGS57530.1|  squalene synthase                                       325   6e-106   Solanum nigrum
gb|AEX26932.1|  squalene synthase                                       325   1e-105   Solanum chacoense
ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  315   4e-102   Nicotiana tomentosiformis
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      314   2e-101   
gb|AGB05603.1|  squalene synthase                                       313   3e-101   Camellia oleifera [abura-tsubaki]
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  313   3e-101   
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  312   8e-101   Nicotiana sylvestris
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  311   1e-100   Solanum lycopersicum
gb|ACS66750.1|  squalene synthase                                       311   2e-100   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  311   3e-100   Sesamum indicum [beniseed]
gb|KJB32575.1|  hypothetical protein B456_005G247700                    306   6e-100   Gossypium raimondii
gb|ADG36702.1|  squalene synthase 1                                     309   1e-99    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36707.1|  squalene synthase 1                                     309   2e-99    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36709.1|  squalene synthase 1                                     308   2e-99    Glycyrrhiza uralensis [Chinese licorice]
gb|AFR77735.1|  squalene synthase                                       308   3e-99    Camellia oleifera [abura-tsubaki]
emb|CDP20866.1|  unnamed protein product                                308   3e-99    Coffea canephora [robusta coffee]
gb|ACN69082.1|  squalene synthase                                       308   4e-99    Diospyros kaki [Japanese persimmon]
gb|ADG36705.1|  squalene synthase 1                                     307   6e-99    Glycyrrhiza uralensis [Chinese licorice]
gb|ADC95435.1|  squalene synthase                                       306   1e-98    Withania somnifera [ashwagandha]
gb|KJB32577.1|  hypothetical protein B456_005G247700                    306   1e-98    Gossypium raimondii
gb|ADG36708.1|  squalene synthase 1                                     306   1e-98    Glycyrrhiza uralensis [Chinese licorice]
gb|KJB32578.1|  hypothetical protein B456_005G247700                    306   2e-98    Gossypium raimondii
ref|XP_002266150.1|  PREDICTED: squalene synthase                       306   2e-98    Vitis vinifera
dbj|BAA13083.1|  squalene synthase                                      305   3e-98    Glycyrrhiza glabra
gb|KJB12167.1|  hypothetical protein B456_002G004400                    301   3e-98    Gossypium raimondii
gb|KJB32574.1|  hypothetical protein B456_005G247700                    305   3e-98    Gossypium raimondii
gb|ADG36703.1|  squalene synthase 1                                     305   4e-98    Glycyrrhiza uralensis [Chinese licorice]
gb|ADD54645.1|  squalene synthase                                       305   4e-98    Bruguiera gymnorhiza [Burma mangrove]
gb|AFJ15526.1|  squalene synthase                                       305   4e-98    Azadirachta indica [Indian-lilac]
gb|ACT52826.1|  squalene synthase 1                                     305   4e-98    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36704.1|  squalene synthase 1                                     305   5e-98    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            305   5e-98    Populus euphratica
emb|CAJ77652.1|  squalene synthase 1                                    305   6e-98    Glycyrrhiza uralensis [Chinese licorice]
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                305   6e-98    Erythranthe guttata [common monkey flower]
ref|XP_002313765.1|  squalene synthase family protein                   304   1e-97    Populus trichocarpa [western balsam poplar]
gb|KJB12168.1|  hypothetical protein B456_002G004400                    300   1e-97    Gossypium raimondii
gb|AED99863.1|  squalene synthase                                       304   2e-97    Panax quinquefolius
ref|XP_010066209.1|  PREDICTED: squalene synthase                       303   2e-97    Eucalyptus grandis [rose gum]
gb|KHN25422.1|  Squalene synthase                                       303   2e-97    Glycine soja [wild soybean]
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  303   3e-97    Prunus mume [ume]
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  303   3e-97    Sesamum indicum [beniseed]
gb|AER23670.1|  squalene synthase                                       303   4e-97    Eleutherococcus senticosus
gb|ABX10442.1|  squalene synthase 2                                     303   4e-97    Gossypium hirsutum [American cotton]
emb|CAJ77654.1|  squalene synthase 1                                    302   5e-97    Glycyrrhiza eurycarpa
gb|ADG36699.1|  squalene synthase 1                                     302   7e-97    Glycyrrhiza uralensis [Chinese licorice]
gb|ADC32654.1|  squalene synthase                                       302   7e-97    Aralia elata
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             302   7e-97    
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       301   9e-97    Glycine max [soybeans]
dbj|BAH23428.1|  squalene synthetase                                    301   1e-96    Euphorbia tirucalli
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  301   1e-96    Cicer arietinum [garbanzo]
gb|KHG07441.1|  Squalene synthase                                       301   2e-96    Gossypium arboreum [tree cotton]
gb|ACV88718.1|  squalene synthase                                       301   2e-96    Panax ginseng [Asiatic ginseng]
gb|ACU21003.1|  unknown                                                 301   2e-96    Glycine max [soybeans]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    301   2e-96    Gossypium raimondii
gb|KJB12171.1|  hypothetical protein B456_002G004400                    301   2e-96    Gossypium raimondii
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            301   2e-96    
gb|ACZ71037.1|  squalene synthase                                       300   3e-96    Panax ginseng [Asiatic ginseng]
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       300   3e-96    Eucalyptus grandis [rose gum]
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       300   3e-96    Eucalyptus grandis [rose gum]
gb|ACQ90302.1|  squalene synthase                                       300   3e-96    Gynostemma pentaphyllum [jiaogulan]
gb|AIK21786.1|  squalene synthase                                       300   5e-96    Panax notoginseng [san-qi]
gb|KHG01756.1|  Squalene synthase                                       300   5e-96    Gossypium arboreum [tree cotton]
gb|KDP41726.1|  hypothetical protein JCGZ_26744                         300   6e-96    Jatropha curcas
ref|XP_010109768.1|  hypothetical protein L484_008444                   300   6e-96    Morus notabilis
gb|AFZ93644.1|  squalene synthetase                                     300   6e-96    Euphorbia lathyris
dbj|BAA24289.1|  squalene synthase                                      300   6e-96    Panax ginseng [Asiatic ginseng]
ref|NP_001236365.1|  squalene synthase                                  300   7e-96    
gb|AEA41712.1|  squalene synthase                                       300   7e-96    Eleutherococcus senticosus
gb|ABA29019.1|  squalene synthase                                       300   7e-96    Panax notoginseng [san-qi]
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  299   7e-96    Pyrus x bretschneideri [bai li]
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  299   8e-96    Nelumbo nucifera [Indian lotus]
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                299   9e-96    Erythranthe guttata [common monkey flower]
gb|AFT92039.1|  squalene synthase                                       299   9e-96    Euphorbia pekinensis
gb|ADG36701.1|  squalene synthase 1                                     299   1e-95    Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ58418.1|  squalene synthase                                      299   1e-95    Panax quinquefolius
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    299   1e-95    
gb|ADW27427.1|  squalene synthase                                       299   1e-95    Astragalus membranaceus
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               299   1e-95    Medicago truncatula
gb|ADX01171.1|  putative squalene synthase                              299   1e-95    Bacopa monnieri
gb|ADV57358.1|  squalene synthase                                       298   1e-95    Astragalus membranaceus
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             301   1e-95    
gb|ACA66014.1|  squalene synthase                                       298   1e-95    Panax ginseng [Asiatic ginseng]
dbj|BAC56854.1|  squalene synthase                                      298   2e-95    Lotus japonicus
gb|AGS78117.1|  squalene synthase 1                                     298   3e-95    Malus domestica [apple tree]
gb|AFK36923.1|  unknown                                                 298   3e-95    Medicago truncatula
emb|CAJ58419.1|  squalene synthase                                      298   3e-95    Panax quinquefolius
gb|AGI19256.1|  squalene synthase                                       297   5e-95    Panax notoginseng [san-qi]
gb|AEA41713.1|  squalene synthase                                       297   8e-95    Eleutherococcus senticosus
gb|ACX42423.1|  squalene synthase                                       296   1e-94    Bupleurum chinense
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  296   2e-94    Populus euphratica
gb|KDO43891.1|  hypothetical protein CISIN_1g015087mg                   289   2e-94    Citrus sinensis [apfelsine]
gb|ADG36711.1|  squalene synthase 1                                     296   2e-94    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36706.1|  squalene synthase 1                                     296   2e-94    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_003607040.1|  Squalene synthase                                  296   2e-94    
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  294   6e-94    Pyrus x bretschneideri [bai li]
gb|ACX42425.1|  squalene synthase                                       294   7e-94    Bupleurum chinense
emb|CAN81937.1|  hypothetical protein VITISV_028001                     295   8e-94    Vitis vinifera
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  294   9e-94    Cucumis melo [Oriental melon]
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            295   1e-93    
ref|XP_004150142.1|  PREDICTED: squalene synthase-like                  294   1e-93    
gb|AAR20329.1|  squalene synthase                                       293   2e-93    Artemisia annua [sweet Annie]
gb|ACS66749.1|  squalene synthase                                       293   3e-93    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_006487315.1|  PREDICTED: squalene synthase isoform X2            288   3e-93    
gb|ADG36717.1|  squalene synthase 2                                     293   3e-93    Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36719.1|  squalene synthase 2                                     292   4e-93    Glycyrrhiza uralensis [Chinese licorice]
dbj|BAA13084.1|  squalene synthase                                      292   4e-93    Glycyrrhiza glabra
gb|AAR20328.1|  squalene synthase                                       292   5e-93    Artemisia annua [sweet Annie]
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             292   5e-93    Phaseolus vulgaris [French bean]
gb|AHA84150.1|  squalene synthase                                       292   6e-93    Phaseolus vulgaris [French bean]
gb|AFI33135.3|  squalene synthase                                       292   6e-93    Eriobotrya japonica [loquat]
emb|CAJ77653.1|  squalene synthase 2                                    292   7e-93    Glycyrrhiza uralensis [Chinese licorice]
gb|AAY46017.1|  squalene synthase                                       291   8e-93    Bupleurum falcatum
gb|KJB12169.1|  hypothetical protein B456_002G004400                    291   1e-92    Gossypium raimondii
gb|ABQ96265.1|  squalene synthase                                       291   1e-92    Psammosilene tunicoides
emb|CDX72493.1|  BnaC07g45150D                                          291   3e-92    
ref|NP_001280921.1|  squalene synthase-like                             290   3e-92    Malus domestica [apple tree]
gb|ACT52825.1|  squalene synthase 2                                     290   3e-92    Glycyrrhiza uralensis [Chinese licorice]
gb|AFK29284.1|  putative squalene synthase 2                            290   4e-92    Salvia miltiorrhiza [Chinese salvia]
gb|ACX42426.1|  squalene synthase                                       290   4e-92    Bupleurum chinense
gb|AFK29283.1|  putative squalene synthase 1                            289   7e-92    Salvia miltiorrhiza [Chinese salvia]
gb|AAV58897.1|  squalene synthase                                       289   1e-91    Centella asiatica [Asiatic pennywort]
emb|CAJ77655.1|  squalene synthase 2                                    288   1e-91    Glycyrrhiza eurycarpa
ref|XP_006423444.1|  hypothetical protein CICLE_v10028537mg             283   2e-91    
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             288   2e-91    Eutrema salsugineum [saltwater cress]
gb|ABG66304.1|  squalene synthase                                       288   2e-91    Polygala tenuifolia [Chinese senega-root]
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             288   2e-91    Capsella rubella
gb|AEM42980.1|  squalene synthase                                       288   3e-91    Siraitia grosvenorii [arhat fruit]
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            288   3e-91    
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       288   3e-91    Tarenaya hassleriana [spider flower]
gb|ACR57219.1|  squalene synthase                                       287   3e-91    Salvia miltiorrhiza [Chinese salvia]
emb|CDY17472.1|  BnaC03g65910D                                          288   4e-91    Brassica napus [oilseed rape]
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  287   5e-91    Brassica rapa
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             286   7e-91    Arabidopsis lyrata subsp. lyrata
emb|CDY45322.1|  BnaA03g52950D                                          286   7e-91    Brassica napus [oilseed rape]
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       286   7e-91    Fragaria vesca subsp. vesca
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       286   9e-91    Brassica rapa
gb|AAG14896.2|AF302464_1  squalene synthase                             286   1e-90    Artemisia annua [sweet Annie]
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             283   2e-90    
ref|XP_010432389.1|  PREDICTED: squalene synthase                       285   3e-90    Camelina sativa [gold-of-pleasure]
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    285   4e-90    Arabis alpina [alpine rockcress]
emb|CDX75450.1|  BnaA01g02520D                                          284   4e-90    
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       284   5e-90    Fragaria vesca subsp. vesca
emb|CDX76294.1|  BnaA08g11060D                                          284   6e-90    
emb|CDX69075.1|  BnaC01g03780D                                          283   9e-90    
ref|XP_009110610.1|  PREDICTED: squalene synthase                       283   9e-90    
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  283   1e-89    
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  283   1e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             283   1e-89    
gb|ACX42424.1|  squalene synthase                                       283   2e-89    Bupleurum chinense
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       283   2e-89    Tarenaya hassleriana [spider flower]
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       282   4e-89    Camelina sativa [gold-of-pleasure]
gb|AAB02945.1|  squalene synthase                                       281   4e-89    Nicotiana tabacum [American tobacco]
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  281   1e-88    Camelina sativa [gold-of-pleasure]
gb|AIX97193.1|  squalene synthase                                       280   2e-88    Matricaria chamomilla var. recutita [German chamomile]
ref|NP_195190.1|  Squalene synthase 1                                   280   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  280   2e-88    Solanum tuberosum [potatoes]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  280   4e-88    
ref|XP_010027379.1|  PREDICTED: squalene synthase-like                  273   2e-87    
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  277   2e-87    Nicotiana sylvestris
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       277   3e-87    Solanum lycopersicum
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  275   2e-86    Eucalyptus grandis [rose gum]
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  275   4e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       274   5e-86    Camelina sativa [gold-of-pleasure]
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   273   7e-86    Citrus sinensis [apfelsine]
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   273   8e-86    Citrus sinensis [apfelsine]
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  273   1e-85    Nicotiana sylvestris
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  273   2e-85    Eucalyptus grandis [rose gum]
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       271   3e-85    
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  271   5e-85    Eucalyptus grandis [rose gum]
ref|XP_006841632.1|  hypothetical protein AMTR_s00003p00232080          270   1e-84    Amborella trichopoda
gb|AGN32410.1|  squalene synthase                                       267   3e-83    Dioscorea zingiberensis
emb|CDX69076.1|  BnaC01g03770D                                          267   5e-83    
ref|XP_009110500.1|  PREDICTED: squalene synthase                       265   2e-82    Brassica rapa
emb|CDX75451.1|  BnaA01g02510D                                          264   3e-82    
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       263   6e-82    Phoenix dactylifera
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       263   7e-82    Phoenix dactylifera
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       263   8e-82    Phoenix dactylifera
gb|AFN61199.1|  squalene synthase                                       263   1e-81    Chlorophytum borivilianum
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       263   1e-81    Camelina sativa [gold-of-pleasure]
gb|AAB61927.1|  squalene synthase 2                                     262   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  261   7e-81    Elaeis guineensis
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  260   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  260   1e-80    Camelina sativa [gold-of-pleasure]
gb|AGW25489.1|  squalene synthase                                       259   2e-80    Paris polyphylla var. yunnanensis
ref|XP_002869132.1|  squalene synthase 2                                259   2e-80    
ref|NP_195191.2|  squalene synthase 2                                   259   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  259   3e-80    Musa acuminata subsp. malaccensis [pisang utan]
gb|AHB20141.2|  squalene synthase                                       259   3e-80    Fritillaria thunbergii
dbj|BAJ99680.1|  predicted protein                                      254   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    258   6e-80    Arabis alpina [alpine rockcress]
gb|EAY92248.1|  hypothetical protein OsI_13969                          258   8e-80    Oryza sativa Indica Group [Indian rice]
ref|NP_001051625.1|  Os03g0805100                                       257   1e-79    
gb|EEE60131.1|  hypothetical protein OsJ_13016                          258   1e-79    Oryza sativa Japonica Group [Japonica rice]
gb|AFY63035.1|  squalene synthase                                       256   6e-79    Alisma plantago-aquatica subsp. orientale
dbj|BAJ87710.1|  predicted protein                                      253   5e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       253   7e-78    Camelina sativa [gold-of-pleasure]
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             251   3e-77    
gb|EMT03383.1|  Squalene synthetase                                     253   3e-77    
gb|AFS28708.1|  putative squalene synthase                              243   5e-77    Olea europaea
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  250   5e-77    
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      246   2e-76    
ref|NP_001104839.1|  squalene synthase1                                 248   3e-76    Zea mays [maize]
ref|XP_004981370.1|  PREDICTED: squalene synthase-like                  245   3e-76    
gb|AGI56082.1|  squalene synthase                                       249   3e-76    Dendrobium officinale
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  248   4e-76    Oryza brachyantha
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  246   4e-75    Brachypodium distachyon [annual false brome]
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  246   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN33457.1|  unknown                                                 241   6e-75    Zea mays [maize]
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            243   1e-74    Populus euphratica
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                243   1e-74    Erythranthe guttata [common monkey flower]
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  244   1e-74    Brachypodium distachyon [annual false brome]
tpg|DAA52015.1|  TPA: hypothetical protein ZEAMMB73_299336              239   3e-74    
gb|AIW04729.1|  squalene synthase                                       243   8e-74    Dryopteris fragrans
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          242   8e-74    Sorghum bicolor [broomcorn]
emb|CDX72494.1|  BnaC07g45160D                                          242   1e-73    
ref|NP_001130502.1|  uncharacterized protein LOC100191601               241   4e-73    
gb|EMS67019.1|  Squalene synthase                                       239   7e-73    Triticum urartu
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              239   1e-72    
ref|XP_006658375.1|  PREDICTED: squalene synthase-like                  238   1e-72    
gb|AHI96421.1|  squalene synthase                                       237   1e-71    Pinus massoniana [Chinese red pine]
gb|ABK24732.1|  unknown                                                 235   6e-71    Picea sitchensis
ref|NP_001059129.1|  Os07g0200700                                       234   9e-71    
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             233   6e-70    Capsella rubella
gb|ABI14439.1|  squalene synthase                                       230   5e-69    Taxus cuspidata [ichii]
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       214   2e-63    
gb|AEX58673.1|  squalene synthase                                       211   2e-61    Huperzia serrata [toothed club-moss]
ref|XP_009138586.1|  PREDICTED: squalene synthase-like                  202   5e-60    
ref|XP_001775898.1|  predicted protein                                  203   7e-59    
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       201   5e-58    
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   196   7e-57    Citrus sinensis [apfelsine]
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              197   2e-56    
ref|XP_001773253.1|  predicted protein                                  191   9e-55    
emb|CEF97547.1|  Squalene/phytoene synthase                             186   2e-52    Ostreococcus tauri
gb|EEC81691.1|  hypothetical protein OsI_25282                          178   1e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_001417488.1|  predicted protein                                  176   4e-48    Ostreococcus lucimarinus CCE9901
ref|XP_001756673.1|  predicted protein                                  174   1e-47    
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 173   2e-46    Monoraphidium neglectum
ref|XP_007512409.1|  squalene synthase                                  167   2e-44    Bathycoccus prasinos
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           164   3e-44    Chlamydomonas reinhardtii
gb|AAF71269.1|  squalene synthase                                       157   6e-44    Citrus sinensis [apfelsine]
gb|ADR66127.1|  squalene synthase                                       157   1e-43    Hieracium umbellatum
gb|ADR66128.1|  squalene synthase                                       157   1e-43    Hieracium porrifolium
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           162   1e-43    Coccomyxa subellipsoidea C-169
gb|ADR66122.1|  squalene synthase                                       155   5e-43    Pilosella onegensis
gb|AAM27472.1|  squalene synthase                                       155   9e-42    Nicotiana tabacum [American tobacco]
gb|ACI14294.1|  squalene synthase                                       155   1e-41    Linum usitatissimum
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  158   3e-41    Botryococcus braunii
ref|XP_003058046.1|  predicted protein                                  156   1e-40    Micromonas pusilla CCMP1545
gb|AIX02458.1|  squalene synthase                                       148   3e-40    Andryala atlanticola
ref|XP_629811.1|  farnesyl-diphosphate farnesyltransferase              154   5e-40    Dictyostelium discoideum AX4
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase           152   3e-39    Dictyostelium purpureum
gb|AFP89568.1|  squalene synthase                                       145   3e-39    Hieracium villosum
gb|AFP89474.1|  squalene synthase                                       145   3e-39    Hieracium eriophorum
gb|AFP89476.1|  squalene synthase                                       145   4e-39    Hieracium eriophorum
gb|AFP89454.1|  squalene synthase                                       145   4e-39    Hieracium bupleuroides
gb|AFP89452.1|  squalene synthase                                       145   4e-39    Hieracium bracteolatum
gb|AFP89498.1|  squalene synthase                                       145   4e-39    Hieracium lachenalii
gb|AFP89552.1|  squalene synthase                                       145   4e-39    Hieracium schmidtii
gb|AFP89453.1|  squalene synthase                                       145   4e-39    Hieracium bracteolatum
gb|AFP89445.1|  squalene synthase                                       145   4e-39    Hieracium amplexicaule
gb|AFP89467.1|  squalene synthase                                       145   4e-39    Hieracium canadense
ref|XP_002501456.1|  predicted protein                                  152   4e-39    Micromonas commoda
gb|AFP89448.1|  squalene synthase                                       145   4e-39    Hieracium bifidum
gb|AFP89477.1|  squalene synthase                                       145   4e-39    Hieracium glaucum
gb|AFP89441.1|  squalene synthase                                       145   4e-39    Hieracium alpinum
gb|AFP89469.1|  squalene synthase                                       144   5e-39    Hieracium candidum
gb|AFP89451.1|  squalene synthase                                       144   5e-39    Hieracium bracteolatum
gb|AFP89537.1|  squalene synthase                                       144   5e-39    
gb|AIX02517.1|  squalene synthase                                       144   5e-39    
ref|XP_006115891.1|  PREDICTED: squalene synthase-like                  150   6e-39    
gb|AAD56387.1|AF181557_1  squalene synthase                             143   7e-39    
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              151   1e-38    
gb|AFP89436.1|  squalene synthase                                       144   1e-38    
gb|AIX02457.1|  squalene synthase                                       144   1e-38    
gb|AIX02451.1|  squalene synthase                                       144   1e-38    
gb|AFP89475.1|  squalene synthase                                       144   1e-38    
gb|AIX02452.1|  squalene synthase                                       144   1e-38    
gb|AIX02520.1|  squalene synthase                                       143   1e-38    
gb|AFP89438.1|  squalene synthase                                       143   1e-38    
gb|AFP89501.1|  squalene synthase                                       143   1e-38    
gb|AFP89505.1|  squalene synthase                                       143   2e-38    
gb|AFP89534.1|  squalene synthase                                       143   2e-38    
gb|AFP89457.1|  squalene synthase                                       143   2e-38    
gb|AFP89439.1|  squalene synthase                                       143   2e-38    
ref|XP_002588443.1|  hypothetical protein BRAFLDRAFT_198742             146   2e-38    
gb|ADR66116.1|  squalene synthase                                       143   2e-38    
gb|AFP89468.1|  squalene synthase                                       143   2e-38    
gb|AFC36455.1|  squalene synthase                                       142   2e-38    
gb|ADR66126.1|  squalene synthase                                       143   2e-38    
gb|AFP89455.1|  squalene synthase                                       143   2e-38    
gb|AFP89466.1|  squalene synthase                                       143   2e-38    
gb|KDO43896.1|  hypothetical protein CISIN_1g015087mg                   147   2e-38    
gb|AFP89460.1|  squalene synthase                                       143   2e-38    
gb|ADR66125.1|  squalene synthase                                       142   3e-38    
ref|XP_010200276.1|  PREDICTED: squalene synthase                       147   4e-38    
ref|XP_006008978.1|  PREDICTED: squalene synthase                       148   5e-38    
gb|ADR66120.1|  squalene synthase                                       142   6e-38    
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase                149   6e-38    
gb|ADR66133.1|  squalene synthase                                       142   6e-38    
gb|ADR66118.1|  squalene synthase                                       142   6e-38    
ref|XP_008943984.1|  PREDICTED: squalene synthase                       146   6e-38    
ref|XP_004358616.1|  farnesyl-diphosphate farnesyltransferase           151   7e-38    
ref|XP_010706473.1|  PREDICTED: squalene synthase                       146   8e-38    
gb|ADR66113.1|  squalene synthase                                       141   1e-37    
gb|KFQ22809.1|  Squalene synthase                                       146   1e-37    
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            147   1e-37    
gb|KFP31735.1|  Squalene synthase                                       147   1e-37    
ref|XP_010072080.1|  PREDICTED: squalene synthase                       144   2e-37    
gb|AIX02474.1|  squalene synthase                                       140   2e-37    
gb|ADR66117.1|  squalene synthase                                       140   2e-37    
gb|KDD74507.1|  squalene/phytoene synthase                              145   3e-37    
ref|XP_009465636.1|  PREDICTED: squalene synthase                       144   4e-37    
ref|XP_009094381.1|  PREDICTED: squalene synthase-like                  144   4e-37    
ref|XP_009579009.1|  PREDICTED: squalene synthase                       143   4e-37    
ref|XP_009819304.1|  PREDICTED: squalene synthase                       143   5e-37    
gb|ADR66112.1|  squalene synthase                                       139   5e-37    
gb|KFQ99234.1|  Squalene synthase                                       144   6e-37    
gb|AFP89509.1|  squalene synthase                                       139   7e-37    
gb|ADR66121.1|  squalene synthase                                       139   7e-37    
ref|XP_010286029.1|  PREDICTED: squalene synthase                       144   7e-37    
ref|XP_010021685.1|  PREDICTED: squalene synthase                       144   9e-37    
ref|XP_010119923.1|  PREDICTED: squalene synthase                       143   9e-37    
ref|XP_009940610.1|  PREDICTED: squalene synthase                       143   9e-37    
ref|XP_011395550.1|  Squalene synthase                                  145   1e-36    
gb|KFQ67434.1|  Squalene synthase                                       144   1e-36    
ref|XP_009317975.1|  PREDICTED: squalene synthase                       143   1e-36    
ref|NP_001034383.1|  squalene synthase                                  145   1e-36    
gb|KFQ43993.1|  Squalene synthase                                       143   2e-36    
ref|XP_010581427.1|  PREDICTED: squalene synthase isoform X1            143   2e-36    
ref|XP_010186209.1|  PREDICTED: squalene synthase                       142   2e-36    
gb|KFR16753.1|  Squalene synthase                                       143   2e-36    
gb|KFM13981.1|  Squalene synthase                                       143   2e-36    
gb|KFP42539.1|  Squalene synthase                                       143   2e-36    
ref|XP_008917712.1|  PREDICTED: squalene synthase                       142   2e-36    
ref|XP_009287225.1|  PREDICTED: squalene synthase                       143   2e-36    
ref|XP_009886241.1|  PREDICTED: squalene synthase                       142   2e-36    
gb|KFW64115.1|  Squalene synthase                                       143   2e-36    
ref|XP_010146008.1|  PREDICTED: squalene synthase                       142   2e-36    
gb|ADR66119.1|  squalene synthase                                       137   3e-36    
ref|XP_005028302.1|  PREDICTED: squalene synthase                       143   3e-36    
gb|EOA95205.1|  Squalene synthetase                                     142   3e-36    
ref|XP_009638212.1|  PREDICTED: squalene synthase                       142   3e-36    
ref|XP_005146462.1|  PREDICTED: squalene synthase                       144   3e-36    
gb|KFQ38302.1|  Squalene synthase                                       142   3e-36    
gb|KFQ73762.1|  Squalene synthase                                       142   4e-36    
gb|KGL95687.1|  Squalene synthase                                       142   4e-36    
ref|XP_001685284.1|  putative squalene synthase                         143   4e-36    
ref|XP_009957016.1|  PREDICTED: squalene synthase                       142   4e-36    
ref|XP_010000497.1|  PREDICTED: squalene synthase                       142   4e-36    
gb|KFP16881.1|  Squalene synthase                                       142   5e-36    
ref|XP_010211000.1|  PREDICTED: squalene synthase                       141   5e-36    
ref|XP_010305165.1|  PREDICTED: squalene synthase                       141   5e-36    
ref|XP_010409682.1|  PREDICTED: squalene synthase                       141   6e-36    
ref|XP_009078811.1|  PREDICTED: squalene synthase                       141   7e-36    
ref|XP_004614762.1|  PREDICTED: squalene synthase                       142   7e-36    
gb|KFQ15889.1|  Squalene synthase                                       141   7e-36    
ref|XP_008170096.1|  PREDICTED: squalene synthase                       143   7e-36    
gb|ADR66134.1|  squalene synthase                                       136   7e-36    
ref|XP_009986797.1|  PREDICTED: squalene synthase                       141   8e-36    
gb|KFW77295.1|  Squalene synthase                                       142   8e-36    
gb|KFU93067.1|  Squalene synthase                                       141   8e-36    
ref|XP_008490611.1|  PREDICTED: squalene synthase                       141   9e-36    
ref|XP_006172265.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl-dip...    142   9e-36    
ref|XP_005443614.1|  PREDICTED: squalene synthase                       142   9e-36    
gb|KGL75930.1|  Squalene synthase                                       141   9e-36    
gb|KFW01543.1|  Squalene synthase                                       142   9e-36    
gb|KFO13053.1|  Squalene synthase                                       141   1e-35    
gb|KFV19358.1|  Squalene synthase                                       141   1e-35    
gb|KFP86331.1|  Squalene synthase                                       141   1e-35    
ref|XP_010165413.1|  PREDICTED: squalene synthase                       140   1e-35    
emb|CAJ76132.2|  squalene synthase                                      142   2e-35    
dbj|GAM21817.1|  hypothetical protein SAMD00019534_049920               141   2e-35    
ref|XP_002114185.1|  hypothetical protein TRIADDRAFT_27912              141   2e-35    
ref|XP_003877813.1|  putative farnesyltransferase                       141   2e-35    
ref|XP_006033877.1|  PREDICTED: squalene synthase-like                  140   2e-35    
ref|XP_009906050.1|  PREDICTED: squalene synthase isoform X2            140   2e-35    
ref|XP_009921323.1|  PREDICTED: squalene synthase                       139   2e-35    
gb|KFZ57398.1|  Squalene synthase                                       140   2e-35    
ref|XP_003863390.1|  farnesyltransferase, putative                      141   3e-35    
ref|XP_005513697.1|  PREDICTED: squalene synthase                       140   3e-35    
gb|ACN60238.1|  Squalene synthetase                                     137   3e-35    
gb|KFO99755.1|  Squalene synthase                                       140   4e-35    
ref|XP_005236741.1|  PREDICTED: squalene synthase                       140   4e-35    
ref|XP_007517289.1|  PREDICTED: squalene synthase isoform X2            140   5e-35    
ref|XP_008629248.1|  PREDICTED: squalene synthase                       140   5e-35    
ref|XP_004449107.1|  PREDICTED: squalene synthase                       139   5e-35    
ref|NP_001189454.1|  squalene synthase                                  140   6e-35    
ref|XP_006518610.1|  PREDICTED: squalene synthase isoform X3            137   6e-35    
ref|XP_005528843.1|  PREDICTED: squalene synthase                       140   6e-35    
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                  140   7e-35    
ref|XP_003225597.2|  PREDICTED: squalene synthase                       140   8e-35    
gb|KFV73970.1|  Squalene synthase                                       139   8e-35    
ref|XP_008977275.1|  PREDICTED: squalene synthase isoform X3            138   8e-35    
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1            139   9e-35    
ref|XP_009665209.1|  PREDICTED: squalene synthase                       139   9e-35    
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                  140   9e-35    
gb|EPS74249.1|  hypothetical protein M569_00507                         137   9e-35    
ref|XP_007068989.1|  PREDICTED: squalene synthase-like                  138   1e-34    
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            139   1e-34    
gb|KFV76998.1|  Squalene synthase                                       138   1e-34    
gb|KFO77427.1|  Squalene synthase                                       139   1e-34    
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1            139   1e-34    
ref|XP_005044492.1|  PREDICTED: squalene synthase                       139   1e-34    
emb|CDQ56794.1|  unnamed protein product                                137   1e-34    
ref|XP_007097199.1|  PREDICTED: squalene synthase isoform X1            138   1e-34    
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            139   2e-34    
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    138   2e-34    
ref|XP_001467618.1|  putative farnesyltransferase                       139   2e-34    
ref|XP_008968069.1|  PREDICTED: squalene synthase isoform X2            135   2e-34    
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1            139   2e-34    
ref|NP_001274685.1|  squalene synthase isoform 5                        135   2e-34    
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  139   2e-34    
sp|G0Y287.1|BOSS_BOTBR  RecName: Full=Botryococcus squalene synth...    139   2e-34    
ref|XP_003984893.2|  PREDICTED: squalene synthase                       138   3e-34    
ref|XP_005712480.1|  unnamed protein product                            139   3e-34    
ref|XP_003757973.1|  PREDICTED: squalene synthase                       139   3e-34    
ref|XP_001567320.1|  putative farnesyltransferase                       138   3e-34    
ref|XP_010590633.1|  PREDICTED: squalene synthase                       136   4e-34    
ref|XP_006884953.1|  PREDICTED: squalene synthase isoform X3            137   4e-34    
ref|XP_009025212.1|  hypothetical protein HELRODRAFT_68312              137   4e-34    
ref|XP_005008182.1|  PREDICTED: squalene synthase isoform X2            139   4e-34    
ref|XP_010330374.1|  PREDICTED: squalene synthase isoform X3            136   4e-34    
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1       138   4e-34    
gb|EMP27211.1|  Squalene synthase                                       139   4e-34    
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            138   4e-34    
ref|XP_008070645.1|  PREDICTED: squalene synthase isoform X2            135   6e-34    
gb|EMP27212.1|  Squalene synthase                                       138   6e-34    
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4            138   6e-34    
ref|XP_008703290.1|  PREDICTED: squalene synthase                       136   6e-34    
ref|XP_008148989.1|  PREDICTED: squalene synthase isoform X3            137   6e-34    
ref|XP_009699274.1|  PREDICTED: squalene synthase                       132   7e-34    
ref|XP_008768968.1|  PREDICTED: squalene synthase isoform X1            137   7e-34    
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2            137   7e-34    
ref|XP_010701665.1|  squalene synthase, putative                        137   8e-34    
ref|XP_001915483.1|  PREDICTED: squalene synthase                       137   8e-34    
ref|NP_062111.1|  squalene synthase                                     137   8e-34    
gb|AAF00038.1|  squalene synthase                                       136   9e-34    
gb|EPY33320.1|  farnesyl-diphosphate farnesyltransferase                135   9e-34    
ref|XP_005425026.1|  PREDICTED: squalene synthase                       138   9e-34    
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2            137   9e-34    
dbj|BAG51957.1|  unnamed protein product                                135   1e-33    
dbj|BAE36836.1|  unnamed protein product                                137   1e-33    
ref|XP_003793969.1|  PREDICTED: squalene synthase isoform 3             135   1e-33    
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            137   1e-33    
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            137   1e-33    
ref|XP_008574544.1|  PREDICTED: squalene synthase isoform X1            137   1e-33    
ref|XP_005859689.1|  PREDICTED: squalene synthase                       136   1e-33    
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2            136   1e-33    
ref|XP_003793968.1|  PREDICTED: squalene synthase isoform 2             136   1e-33    
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2            137   1e-33    
ref|NP_034321.2|  squalene synthase                                     136   1e-33    
dbj|BAA06102.1|  squalene synthase                                      136   1e-33    
ref|XP_008070644.1|  PREDICTED: squalene synthase isoform X1            135   1e-33    
ref|XP_005495474.1|  PREDICTED: squalene synthase                       136   1e-33    
ref|XP_002186800.1|  PREDICTED: squalene synthase                       136   2e-33    
gb|ADR66111.1|  squalene synthase                                       130   2e-33    
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1            137   2e-33    
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1            137   2e-33    
ref|XP_008148987.1|  PREDICTED: squalene synthase isoform X1            136   2e-33    
ref|XP_011228676.1|  PREDICTED: squalene synthase isoform X1            136   2e-33    
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1            136   2e-33    
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2             136   2e-33    
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2            136   2e-33    
ref|NP_001274680.1|  squalene synthase isoform 4                        134   2e-33    
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2            136   2e-33    
ref|XP_007882609.1|  PREDICTED: squalene synthase                       135   2e-33    
ref|XP_009486915.1|  PREDICTED: squalene synthase                       130   2e-33    
gb|EPY35876.1|  farnesyltransferase                                     135   2e-33    
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase       134   2e-33    
ref|XP_004046702.1|  PREDICTED: squalene synthase isoform 3             134   3e-33    
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...    134   3e-33    
pdb|3WEI|A  Chain A, Crystal Structure Of The Human Squalene Synt...    134   3e-33    
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...    134   3e-33    
ref|XP_006039244.1|  PREDICTED: squalene synthase-like                  136   3e-33    
dbj|BAH14404.1|  unnamed protein product                                134   3e-33    
ref|XP_007959828.1|  PREDICTED: squalene synthase isoform X3            134   3e-33    
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1             135   3e-33    
ref|NP_001274673.1|  squalene synthase isoform 2                        134   3e-33    
ref|XP_010330373.1|  PREDICTED: squalene synthase isoform X1            136   3e-33    
ref|XP_003271491.1|  PREDICTED: squalene synthase isoform 3             134   3e-33    
ref|XP_007429056.1|  PREDICTED: squalene synthase isoform X4            134   3e-33    
ref|XP_010863270.1|  PREDICTED: squalene synthase                       135   3e-33    
ref|XP_006864385.1|  PREDICTED: squalene synthase isoform X3            135   3e-33    
ref|XP_006797166.1|  PREDICTED: squalene synthase-like                  134   3e-33    
ref|XP_004046701.1|  PREDICTED: squalene synthase isoform 2             134   4e-33    
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         135   4e-33    
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                  135   4e-33    
ref|XP_007936897.1|  PREDICTED: squalene synthase isoform X3            134   4e-33    



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMS
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTM DVYG F
Sbjct  276  ALRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRL++ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDVILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+AL HVEDCLTYMS
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALPHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRT+ DVYG F
Sbjct  276  ALRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRLE+ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLEVILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMS
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG F
Sbjct  276  ALRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRLE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   335 bits (859),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLEELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMS
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG F
Sbjct  276  ALRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRLE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLEELKYEENSV AVQCLNDMVT+ALSHVEDCLTYMS
Sbjct  193  EDINEVPKCRMFWPREIWSKYVNKLEELKYEENSVKAVQCLNDMVTNALSHVEDCLTYMS  252

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTMEDVYG F
Sbjct  253  NLRDPAIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMEDVYGAF  312

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++N P A+KTLK LE +LKTCRDSGTLNKRKSYI+R+E NY+P LI++ 
Sbjct  313  FDFSCMLKSKVNNNGPNATKTLKGLEAVLKTCRDSGTLNKRKSYIIRSERNYSPVLIVII  372

Query  250  fiilailLGYLSGNK  206
            FIILAI+L +LSGN+
Sbjct  373  FIILAIILAHLSGNR  387



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLEELKYEENSV AVQCLNDMVT+ALSHVEDCL YMS
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEELKYEENSVKAVQCLNDMVTNALSHVEDCLIYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAK IDRTRTM DVYG F
Sbjct  276  NLRDPAIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKAIDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRLE ILKTCRDSGTLNKRKSY++++EP Y+P LI V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYVIKSEPTYSPVLIFVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L +LSGN+
Sbjct  396  FIILAIILAHLSGNR  410



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   330 bits (846),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   330 bits (846),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYMS
Sbjct  218  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMS  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFC IPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRTRTM DVYG F
Sbjct  278  NLRDPAIFRFCGIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP ++KTLK+LE ILKTCR+SG LNKRKSY++R+EPNY+P LIIV 
Sbjct  338  FDFSCMLKSKVNNNDPNSTKTLKKLEAILKTCRNSGMLNKRKSYVIRSEPNYSPVLIIVI  397

Query  250  fiilailLGYLSGNK  206
            F+ILA++L  LSGN+
Sbjct  398  FVILAVILSQLSGNR  412



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTY+ 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYLF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDPAIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNEMVTNALSHVEDCLTYMF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDPSIFRFCAIPQ+MAIGTLAMC++NI  FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDPSIFRFCAIPQVMAIGTLAMCHDNIEAFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L DP+IFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLHDPAIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            FDFSCMLKSKV++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R EPNY+P
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRNEPNYSP  389



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKY NKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYANKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMY  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLA+CY+NI +FRGVVKMRRGLTAKVIDRTRT+ DVYG F
Sbjct  276  NLRDPAIFRFCAIPQVMAIGTLAICYDNIELFRGVVKMRRGLTAKVIDRTRTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRLE ILKTCRDSGTLNKRKSY++++EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLEAILKTCRDSGTLNKRKSYVIKSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILARLSGNQ  410



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKY ENSV AVQCLN+MVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYVENSVKAVQCLNEMVTNALSHVEDCLTYMF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDPSIFRFCAIPQ+MAIGTLAMCY+NI VFRGVVKMRRGLTAKVI RT+TM DVYG F
Sbjct  276  NLRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIGRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRL+ ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLDAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+L  LSGN+
Sbjct  396  FIILAIILAQLSGNR  410



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLEELK EENSV AVQCLN+MVT+ALSHVED LTYMS
Sbjct  216  EDINEVPKCRMFWPRQIWSKYVNKLEELKCEENSVKAVQCLNEMVTNALSHVEDSLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLTAKVIDRTR M DVYG F
Sbjct  276  TLRDPAIFRFCAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAKVIDRTRNMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFSC+LKSKV++ DP A+KTL+RLE IL+TC+DSGTLNKRKS+++++ PNY  AL++V 
Sbjct  336  YDFSCILKSKVEYKDPNAAKTLRRLETILRTCKDSGTLNKRKSFVIQSRPNYNSALVVVL  395

Query  250  fiilailLGYLSGNKP  203
             +I+AIL  Y SGN+P
Sbjct  396  VVIIAILSAYQSGNRP  411



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD+NDP A KTL RL++ILKTCRDSG LNKRKSYI++ + NYTP
Sbjct  336  YDFSCMLKAKVDNNDPNAQKTLSRLDLILKTCRDSGVLNKRKSYIIQNQSNYTP  389



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK +ENSV AV+CLNDMVT+AL HVEDCLTYMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKDKENSVKAVECLNDMVTNALIHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV+ +DP A K L RLE I K CR+SGTLNKRKSYI+++EP Y   L+ V 
Sbjct  336  FDFSCMLKSKVNKSDPNAMKALSRLEAIQKICRESGTLNKRKSYIVKSEPRYNSTLVFVL  395

Query  250  fiilailLGYLSGNKP  203
            FIILAIL  YLS N+P
Sbjct  396  FIILAILFAYLSANRP  411



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYV+KLE+LKYEENSV A+QCLN+MVT++LSHVEDCLT++S
Sbjct  216  EDINEVPKCRMFWPRQIWSKYVDKLEDLKYEENSVKAIQCLNEMVTNSLSHVEDCLTFLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLTA+VIDRTR M DVYG F
Sbjct  276  TLRDPAIFRFCAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAQVIDRTRNMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKV++ DP  +KTLKRLE+IL+TC++SGTLNKRKS+++++ PNY    ++V 
Sbjct  336  FDFSCILKSKVEYKDPQVAKTLKRLEVILRTCKNSGTLNKRKSFVIKSGPNYNSTFVVVL  395

Query  250  fiilailLGYLSGNK  206
             +++AILLGY SGN+
Sbjct  396  VVLVAILLGYQSGNR  410



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYV+KLE+LK EENSV AVQCLN+MVT+ALSHVED LTYMS
Sbjct  216  EDINEVPKCRMFWPRQIWSKYVDKLEDLKCEENSVKAVQCLNEMVTNALSHVEDSLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLTAKVIDRTRTM DVYG F
Sbjct  276  TLRDPAIFRFCAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTAKVIDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFSC+LK+KV++ DP A+KTL+RLE IL+TC++SGTLNKRKS+++++ PNY  AL++V 
Sbjct  336  YDFSCILKAKVEYKDPNAAKTLRRLETILRTCKNSGTLNKRKSFVIQSRPNYNSALVVVL  395

Query  250  fiilailLGYLSGNKP  203
             +I+AIL+ YLSGN+P
Sbjct  396  VVIIAILIAYLSGNRP  411



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYV+KLE+LKYEENSV AVQCLN+MVT+ALSH+EDCLT++S
Sbjct  216  EDINEVPKCRMFWPRQIWSKYVDKLEDLKYEENSVKAVQCLNEMVTNALSHIEDCLTFLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQ+MAIGTLA CYNNI VFRGVVKMRRGLT +VIDRTR M DVYG F
Sbjct  276  TLRDPAIFRFCAIPQVMAIGTLAKCYNNIEVFRGVVKMRRGLTTQVIDRTRNMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKV+  DP  +KTLKRLE+IL+TC++SGTLNKRKS+++++ PNY    ++V 
Sbjct  336  FDFSCILKSKVEFKDPHVAKTLKRLEVILRTCKNSGTLNKRKSFVIKSGPNYNSTFVVVL  395

Query  250  fiilailLGYLSGNK  206
             +++AILLGY SGN+
Sbjct  396  VVLVAILLGYQSGNR  410



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS N+
Sbjct  396  VIILSIIFAYLSANR  410



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL+HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALTHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTISDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS MLKSK D NDP A KT + LE ILK CRDSGTLN+RKSYI++++P+Y+P LI+V 
Sbjct  336  YDFSRMLKSKADDNDPNARKTKEFLETILKLCRDSGTLNQRKSYIIQSKPHYSPTLIVVI  395

Query  250  fiilailLGYLSGNKP  203
            FIILAILL YLS  +P
Sbjct  396  FIILAILLAYLSAARP  411



>gb|KJB32575.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=294

 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  98   EDINEIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  157

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  158  ALRDPAIFRFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  217

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  218  YDFSCMLKAKVDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  271



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNK+E+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKIEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E  Y+  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTYSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK +ENSV AV+CLNDMVT+AL HVEDCLTYMS
Sbjct  223  EDINEIPKSRMFWPRQIWSKYVNKLEDLKDKENSVKAVECLNDMVTNALIHVEDCLTYMS  282

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYGGF
Sbjct  283  ALRDPSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMSDVYGGF  342

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDFSCMLKSKV+ +DP A K L RLE I K CR+SGTLNKRKSYI+++EP Y
Sbjct  343  FDFSCMLKSKVNKSDPNAMKALSRLEAIQKICRESGTLNKRKSYIIKSEPRY  394



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKY+ENS  AV CLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYKENSDKAVHCLNDMVTNALMHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD ND  A KT  RLE ILK CRDSGTLNKRKSYIL +EP + P +I++F
Sbjct  336  FDFSCMLKSKVDDNDLNAKKTKSRLEDILKICRDSGTLNKRKSYILGSEPTFNPTMILIF  395

Query  250  fiilailLGYLSGNK  206
             ++LAILL YLS N+
Sbjct  396  VVMLAILLAYLSANR  410



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE+NSV +VQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEKNSVKSVQCLNDMVTNALIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVID+T+T+ DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDQTKTISDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV+ NDP ++KTL R+E I KTCR+SGTL+KRKSYILR++  +   LI V 
Sbjct  336  FDFSCMLKSKVEKNDPNSTKTLSRIEAIQKTCRESGTLSKRKSYILRSKRTHNSTLIFVL  395

Query  250  fiilailLGYLSGNKP  203
            FIILAIL  YLS N+P
Sbjct  396  FIILAILFAYLSANRP  411



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWP+QIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPQQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L KRK YILR E  Y+  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLTKRKPYILRNESTYSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+ALSHVEDCLTYM 
Sbjct  216  EDINEVPKCRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALSHVEDCLTYMP  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+I R   IPQ+M IGTLAMCY NI VF     MRRGLTAKVIDRTRTM DVYG F
Sbjct  276  NLRDPAICRLRGIPQVMVIGTLAMCYYNIEVFSRSGSMRRGLTAKVIDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKV++NDP A+KTLKRLE ILKTCR+SGTLNKRKSY++R+EPNY+P LI+V 
Sbjct  336  FDFSCMLKSKVNNNDPNATKTLKRLEAILKTCRNSGTLNKRKSYVIRSEPNYSPVLIVVI  395

Query  250  fiilailLGYLSGNK  206
            FIILA++L +LSGN+
Sbjct  396  FIILAVILAHLSGNR  410



>gb|KJB32577.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=388

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  192  EDINEIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  251

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  252  ALRDPAIFRFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  311

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  312  YDFSCMLKAKVDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  365



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNK+E+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKIEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E  Y+  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTYSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  210  EDINEIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  269

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  270  ALRDPAIFRFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  329

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  330  YDFSCMLKAKVDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  383



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LK EENS+ AVQCLNDMVT+AL H+EDCLTYMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKEEENSIKAVQCLNDMVTNALIHMEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+ P+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+ M DVYG F
Sbjct  276  ALQSPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKAMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+K L RLE + K CR+SG L KRKSY++R+EP Y  ALI+ F
Sbjct  336  FDFSCMLKSKVDKNDPNATKALSRLEAVQKICRESGALTKRKSYVIRSEPRYNSALIVAF  395

Query  250  fiilailLGYLSGNK  206
            FIIL+I+  YLS N+
Sbjct  396  FIILSIIFAYLSANR  410



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|KJB12167.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
 gb|KJB12170.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=295

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  98   EDINEIPKSRMFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMS  157

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  158  ALRDPAIFRFCAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAF  217

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  218  YDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  271



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  336  YDFSCMLKAKVDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+ WSKYV+KLE+LKYEENSV AVQCLNDMVT++L HV+DCL YMS
Sbjct  216  EDINEIPKCRMFWPRETWSKYVDKLEDLKYEENSVKAVQCLNDMVTNSLIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+DP+IFRFCAIPQIMAIGTLAMCYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALQDPAIFRFCAIPQIMAIGTLAMCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLK+KVD +DP A+KTL RLE I KTCR SG L K KS IL +EP Y  AL  + 
Sbjct  336  FDFSCMLKAKVDKSDPNATKTLSRLEAIQKTCRASGFLTKSKSRILGSEPRYNSALAALG  395

Query  250  fiilailLGYLSGNKP  203
            F+ILAI+  YLS N+P
Sbjct  396  FLILAIVFVYLSANRP  411



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL+HVEDCL YMS
Sbjct  195  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALNHVEDCLKYMS  254

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK IDRT  M DVYG F
Sbjct  255  ALRDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKAIDRTNKMADVYGAF  314

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFSCMLK K++ NDP A+KTL R+E I K C +SG LN+RKSYI++ EP Y   +II+ 
Sbjct  315  YDFSCMLKPKINENDPNATKTLSRVEAIQKACMESGLLNRRKSYIIQREPKYNTTMIIML  374

Query  250  fiilailLGYLSGNKPHS  197
            FIILAI+  YLS N+P++
Sbjct  375  FIILAIIFAYLSANRPNN  392



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKY+ENSV AVQCLN+MVT++L HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKYDENSVKAVQCLNEMVTNSLIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALR+P+IFRFCAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA+VI RT+TM DVYG F
Sbjct  276  ALREPAIFRFCAIPQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQVIHRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL  LE + KTCR+SG LNKRKSY+LR E  Y   LI++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSSLEAVQKTCRESGALNKRKSYVLRNELKYNSVLIVLL  395

Query  250  fiilailLGYLSGNK  206
            FIIL+++  YLS N+
Sbjct  396  FIILSVIFAYLSANR  410



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS N+
Sbjct  396  VIILSIIFAYLSANR  410



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLEELKYEENSV AV+CLNDMVT++L HVEDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEELKYEENSVKAVRCLNDMVTNSLIHVEDCLNYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS MLKSKVD NDP ASKT +RLE I K CRDSGTL++RKS I++ +P      I + 
Sbjct  336  YDFSLMLKSKVDENDPNASKTKERLEAIFKLCRDSGTLSQRKSCIIQNKPQLNATSIALV  395

Query  250  fiilailLGYLSGNKP  203
            FI+LAI++ YLS ++P
Sbjct  396  FIVLAIIVAYLSQSRP  411



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP  RMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT++L HV+DCL YMS
Sbjct  216  EDINEIPMSRMFWPREIWSKYVNKLEDLKYEENSVEAVQCLNDMVTNSLIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALR+P+IFRFCAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA++  RT+TM DVYG F
Sbjct  276  ALREPAIFRFCAIPQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQIFHRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL  LE + KTCR+SG LNKRKSYILR E  Y   LI++ 
Sbjct  336  FDFSCMLKSKVDRNDPNATKTLSSLEAVQKTCRESGALNKRKSYILRNELKYNSVLIVLL  395

Query  250  fiilailLGYLSGNK  206
            FIIL+I+  YLS N+
Sbjct  396  FIILSIIFAYLSANR  410



>gb|KJB12168.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=313

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  116  EDINEIPKSRMFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMS  175

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  176  ALRDPAIFRFCAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAF  235

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  236  YDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  289



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSSN  409



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL+HVEDCLTYMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALTHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALSDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            +DFSCMLKSKVD NDP A+KTL R+E   K CR+SG LNKRKSYI+ ++  Y+
Sbjct  336  YDFSCMLKSKVDKNDPNATKTLSRIEASQKACRNSGLLNKRKSYIIASKSRYS  388



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCLTYM+
Sbjct  211  EDINEIPKSRMFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLTYMA  270

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  271  ALRDPPIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  330

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+ KVD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++ 
Sbjct  331  FDFASMLEPKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVIL  390

Query  250  fiilailLGYLSGNKPHS  197
             I+++I+  YLS N  +S
Sbjct  391  VIMVSIIFAYLSANHHNS  408



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALIHVEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT++M+DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKSMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS ++KSKVD NDP A+KTL RLE + KTCR SG L+KRKSYI++ EP+Y   LI+  
Sbjct  336  FDFSSIIKSKVDKNDPNATKTLSRLEAVQKTCRASGALSKRKSYIVKGEPSYNSTLIVAL  395

Query  250  fiilailLGYLSGN  209
            FIILAI+  YLS +
Sbjct  396  FIILAIVYAYLSAS  409



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALVHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMTDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFS MLKSKVD  DP A KT + LE ILK CRDSGTL++RKSYI++++P Y
Sbjct  336  YDFSRMLKSKVDDADPNAKKTKENLEAILKICRDSGTLSQRKSYIIQSKPQY  387



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLENLKYEENSAKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+C+NNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDPAIFRFCAIPQIMAIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ ++  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESKSAHNSALIAII  395

Query  250  fiilailLGYLSGNKPHS  197
            FIILAIL  YLS N P++
Sbjct  396  FIILAILYAYLSSNLPNN  413



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  ALPDPAIFRFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD NDP A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  336  YDFSCMLKAKVDKNDPCAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSG  212
             IIL+I+  YLS 
Sbjct  396  VIILSIIFAYLSA  408



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG  +KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLPSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQ WSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQSWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+C+NNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCFNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FI+LAIL  YLS N
Sbjct  396  FIMLAILYAYLSSN  409



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALIHMEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT++M+DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKSMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS +LKSKVD NDP A+KTL RLE + KTCR SG L+KRKSYI+R EP++   LI+  
Sbjct  336  FDFSSILKSKVDKNDPNATKTLSRLEAVQKTCRASGALSKRKSYIVRGEPSHNSTLIVAL  395

Query  250  fiilailLGYLSGN  209
            FIILAI+  YLS +
Sbjct  396  FIILAIVYAYLSAS  409



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   301 bits (772),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCLTYM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLTYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  ALRDPPIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTTTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+K L RLE I KTCR+SG L+KRKSYI++ E  Y   +IIV 
Sbjct  336  FDFASMLESKVDKNDPNATKALSRLEAIQKTCRESGLLSKRKSYIVKDESGYGSTMIIVL  395

Query  250  fiilailLGYLSGN  209
             I+++I+  YLS +
Sbjct  396  VIMVSIIFSYLSAS  409



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFC IPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRTRTM DVY  F
Sbjct  276  ALRDPAIFRFCGIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTRTMADVYRAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDFSCM+KSKVD NDP A KTL RLE + KTC+DSG LNKRKSYI  + P Y
Sbjct  336  FDFSCMMKSKVDRNDPNAEKTLNRLEAVQKTCKDSGMLNKRKSYINGSNPIY  387



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H ED L YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALR P+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+T+ DVYG F
Sbjct  276  ALRHPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG L KRKSYILR E  Y   +I++ 
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGVLTKRKSYILRNENGYGSTMIVIL  395

Query  250  fiilailLGYLSGN  209
             I+ +I   YLS N
Sbjct  396  VILFSITYAYLSAN  409



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLNDM+T+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNDMITNALIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRR LTAKVIDRT TM DVYG F
Sbjct  276  ALPDPAIFRFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRSLTAKVIDRTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFSCMLK+KVD NDP+A KT  RL+ ILKTCRDSG LN+RKSYI+  + NYTP
Sbjct  336  YDFSCMLKAKVDKNDPSAQKTSSRLDSILKTCRDSGVLNERKSYIIPNQTNYTP  389



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIM+IGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMSIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliiv  254
            FDFSCMLKSKVD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++
Sbjct  336  FDFSCMLKSKVDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVI  395

Query  253  ffiilailLGYLSGNKPHSV  194
             FIILAIL  YLS N P+S+
Sbjct  396  LFIILAILYAYLSSNLPNSL  415



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPPIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+ KVD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++ 
Sbjct  336  FDFASMLEPKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVIL  395

Query  250  fiilailLGYLSGNKPHS  197
             I+++I+  YLS N  +S
Sbjct  396  VIMVSIIFAYLSANHHNS  413



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  336  YDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  389



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  215  EDINEIPKSRMFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMS  274

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  275  ALRDPAIFRFCAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMTDVYGAF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + NYTP
Sbjct  335  YDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYIIENQSNYTP  388



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPPIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+ KVD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++ 
Sbjct  336  FDFASMLEPKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVIL  395

Query  250  fiilailLGYLSGNKPHS  197
             I+++I+  YLS N  +S
Sbjct  396  VIMVSIIFAYLSANHHNS  413



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGTF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliiv  254
            FDFSCMLKSKVD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LII+
Sbjct  336  FDFSCMLKSKVDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIII  395

Query  253  ffiilailLGYLSGNKPHSV  194
             FIILAIL  YLS N P+S+
Sbjct  396  LFIILAILYAYLSSNLPNSL  415



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK EENS  AV+CLNDMVT+AL+HVEDCLTYMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKCEENSEKAVRCLNDMVTNALTHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DPSIFRFCAIPQIMAIGTLA+CYNNI VF+GVVK+RRGLTAKVIDRTRTM DVYG F
Sbjct  276  ALGDPSIFRFCAIPQIMAIGTLALCYNNIEVFKGVVKIRRGLTAKVIDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFSCMLKSKVD NDP A+KTL R+EI  K CRD+G  NKRKSYIL +EP Y
Sbjct  336  YDFSCMLKSKVDKNDPNATKTLSRIEITQKACRDAGLRNKRKSYILPSEPRY  387



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK EENS  AV+CLNDMVT+AL+HVEDCLTYMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKCEENSEKAVRCLNDMVTNALTHVEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DPSIFRFCAIPQIMAIGTLA+CYNNI VF+GVVK+RRGLTAKVIDRTRTM DVYG F
Sbjct  276  ALGDPSIFRFCAIPQIMAIGTLALCYNNIEVFKGVVKIRRGLTAKVIDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFSCMLKSKVD NDP A+KTL R+EI  K CRD+G  NKRKSYIL +EP Y
Sbjct  336  YDFSCMLKSKVDKNDPNATKTLSRIEITQKACRDAGLRNKRKSYILPSEPRY  387



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPRQIWSKYV+KLE+LKYEENSV AV CLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPRQIWSKYVDKLEDLKYEENSVKAVHCLNDMVTNALIHVEDCLIYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+D SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLKDLSIFRFCAIPQIMAIGTLAICYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS MLK+KV  +DP A+KTL RLE I KTC+ SG LNKRK Y++R+EP Y P LI++ 
Sbjct  336  FDFSVMLKAKVKRSDPNATKTLSRLEAIQKTCQQSGLLNKRKLYVVRSEPIYNPTLIVII  395

Query  250  fiilailLGYLSGNK  206
            F +L I+L YLS  +
Sbjct  396  FSLLCIILAYLSAKR  410



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVRCLNDMVTNALVHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSSN  409



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   300 bits (767),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+ RMFWPRQIWSKY+ KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPQSRMFWPRQIWSKYIKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIKVFRGVVKMRRGLTAKVIDRTKSMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            +DFSC+LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+  + +YT
Sbjct  336  YDFSCILKAKVDKNDPNAQKTMSRLDSILKTCRDSGVLNKRKSYIIENQSDYT  388



>gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS+ AV+CLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSLKAVRCLNDMVTNALMHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFC IPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVI +T++M DVYG F
Sbjct  276  ALRDPAIFRFCVIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIYQTKSMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD +DP A KTL RLE I K C++SG LNKRKSYI R++P Y  ALI++ 
Sbjct  336  FDFSCMLKSKVDMSDPNAEKTLSRLEGIQKACQESGLLNKRKSYINRSKPRYNSALIVLL  395

Query  250  fiilailLGYLSGNKP  203
            F+IL+I+  YLS N+P
Sbjct  396  FVILSIVFSYLSANRP  411



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LK EENSV AVQCLNDMVT+AL H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKDEENSVKAVQCLNDMVTNALLHMEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALR P+IFRFCAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  ALRHPAIFRFCAIPQVMAIGTLAMCYNNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILR  290
            +DFSCMLKSKVD NDP A KTL RLE I KTCRDSGTLNKRKSY+L+
Sbjct  336  YDFSCMLKSKVDDNDPNAKKTLSRLETIQKTCRDSGTLNKRKSYVLK  382



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRTRTM DVY  F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTRTMADVYRAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  281
            FDFSCM+KSKVD NDP A KTL RLE + KTC++SG LNKR+SYI  ++P
Sbjct  336  FDFSCMMKSKVDRNDPNAEKTLNRLEAVQKTCKESGLLNKRRSYINESKP  385



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LR P+IFRFCAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVID+T+TM DVYG F
Sbjct  276  DLRGPAIFRFCAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSSN  409



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHPEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPPIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+ KVD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y   +I++ 
Sbjct  336  FDFASMLEPKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGYGSTMIVIL  395

Query  250  fiilailLGYLSGNKPHS  197
             I+++I+  YLS N  +S
Sbjct  396  VIMVSIIFAYLSANHHNS  413



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 171/200 (86%), Gaps = 1/200 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKLRRGLTAKVIDRTNTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliiv  254
            FDFSCMLKSKVD+NDP A+KTL RLE I K+C++SG L  KRKSYI+  E  Y   LI++
Sbjct  336  FDFSCMLKSKVDNNDPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVI  395

Query  253  ffiilailLGYLSGNKPHSV  194
             FIILAIL  YLS + P+S+
Sbjct  396  LFIILAILYAYLSSSLPNSL  415



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVRCLNDMVTNALVHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSSN  409



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M+DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS +LKSKVD NDP A+KTL R+E + K CRDSG L+KRKSYI   E +Y+  LI+  
Sbjct  336  FDFSSILKSKVDKNDPNATKTLSRVEAVQKLCRDSGALSKRKSYIANHEQSYSSTLIVAL  395

Query  250  fiilailLGYLSGN  209
            FIILAI+  YLS +
Sbjct  396  FIILAIIYAYLSAS  409



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKY+ENS+ AV+CLNDM+T+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYDENSIKAVECLNDMITNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP++FRFCAIPQIMAIGT+A+CYNNI VF+GVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  276  ALRDPAVFRFCAIPQIMAIGTIALCYNNIEVFKGVVKMRRGLTAKVIDRTKSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LK KV+ NDP A+KTL R+E I KTCR+SG LNKR SY++ ++P+Y    II  
Sbjct  336  FDFSCLLKMKVEKNDPNATKTLSRIEAIQKTCRNSGLLNKRSSYMVESKPSYNSVAIIAV  395

Query  250  fiilailLGYLSGNKP-HS  197
            FI+L+I L +LS  +P HS
Sbjct  396  FILLSIFLAFLSTKQPIHS  414



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK+EENSV AVQCLNDMVT+AL H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKHEENSVKAVQCLNDMVTNALIHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS MLK K+D +DP A KT   LE +LK CRDSGTLN+RKSYI++++P     +I++F
Sbjct  336  YDFSRMLKYKIDDSDPNARKTKDSLEAVLKICRDSGTLNQRKSYIIQSKPQINATVIVIF  395

Query  250  fiilailLGYLSGNKPHSV  194
            FIILAILL YLS ++P ++
Sbjct  396  FIILAILLAYLSASRPSNI  414



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEE+SV AVQCLNDMVT+AL H++DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEEDSVKAVQCLNDMVTNALIHMDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKV+DRTRTM DVY  F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVVDRTRTMADVYRAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDFSCM+KSKVD NDP A KTL RLE + KTC++SG LNKRKSY+  ++P Y
Sbjct  336  FDFSCMMKSKVDRNDPNAEKTLNRLEAVQKTCKESGLLNKRKSYVNGSKPYY  387



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD ND  A+KTL RLE I KTCR+SG  +KRK YILR E   +  ++++ 
Sbjct  336  FDFSCMLKSKVDKNDLNATKTLSRLEAIQKTCRESGLSSKRKPYILRNESTNSSTMVLIL  395

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  396  VIILSIIFAYLSAKR  410



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQI++IGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIVSIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliiv  254
            FDFSCMLKSKVD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++
Sbjct  336  FDFSCMLKSKVDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVI  395

Query  253  ffiilailLGYLSGNKPHSV  194
             FIILAIL  YLS N P+S+
Sbjct  396  LFIILAILYAYLSSNLPNSL  415



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWP QIWSKYV KLE+LKYEENSV AVQCLNDMVT+AL H++DCL YMS
Sbjct  216  EDINEIPKSRMFWPHQIWSKYVTKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPSIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFSCMLKSKV+ NDP A KTL RLE + K+CR+SG L++R+SYI R+EP     ++++ 
Sbjct  336  YDFSCMLKSKVEMNDPNAEKTLSRLEALQKSCRESGLLSRRRSYI-RSEPRINSVIVVLL  394

Query  250  fiilailLGYLSGNKP  203
            FIIL+I+  YLS N+P
Sbjct  395  FIILSIIFAYLSANRP  410



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLEELKYEENSV AVQCLNDM+T+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEELKYEENSVEAVQCLNDMITNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIVVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDF+ +L+ KVD NDP A+KTL RLE I K CR+SG L+KRKSY+LR+   Y
Sbjct  336  FDFASLLECKVDKNDPNATKTLSRLEAIQKNCRESGLLSKRKSYVLRSADTY  387



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL H +DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHADDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD S FRFCAIPQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDSSNFRFCAIPQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ +L+SKVD NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++ 
Sbjct  336  FDFASVLESKVDKNDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLL  395

Query  250  fiilailLGYLSGNK  206
             I+ +I+  YLS N+
Sbjct  396  VILFSIIFAYLSANR  410



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDC+ YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHVEDCIKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DP+IFRFCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M DVYG F
Sbjct  276  ALGDPAIFRFCAIPQVMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKSMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS MLKSKV+ +DP A KT  RLE ILK CR+SGTLN+RKSYI++++P      I++ 
Sbjct  336  YDFSRMLKSKVEDSDPNARKTKDRLEAILKICRESGTLNQRKSYIIQSKPQNYATSIVII  395

Query  250  fiilailLGYLSGNKP  203
            FII+AILL YLS  +P
Sbjct  396  FIIIAILLAYLSATRP  411



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLEELKYEENSV AVQCLNDM+T+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEELKYEENSVEAVQCLNDMITNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIVVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDF+ +L+ KVD NDP A+KTL RLE I K CR+SG L+KRKSY+LR+   Y
Sbjct  336  FDFASLLECKVDKNDPNATKTLSRLEAIQKNCRESGLLSKRKSYVLRSADTY  387



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H++DCL Y+S
Sbjct  279  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHMDDCLKYLS  338

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VI +T+TM+DVYG F
Sbjct  339  ELRDPAIFRFCAIPQIMAIGTLALCYNNVNVFRGVVKMRRGLTAQVIHQTKTMDDVYGAF  398

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLK KVD++DP A KTL RLE   K+CR+SG LNKRKSYI+R EP Y   LI++ 
Sbjct  399  FDFSCMLKFKVDNSDPNAIKTLSRLEAAQKSCRESGALNKRKSYIIRNEPKYNSVLIVLL  458

Query  250  fiilailLGYLSGNK  206
            FIIL+I+  YLS N+
Sbjct  459  FIILSIIFAYLSANR  473



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVTDAL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTDALVHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LR P++FRFCAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVID+T+TM DVYG F
Sbjct  276  DLRGPAVFRFCAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDQTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSSN  409



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD SIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+T+ DVYG F
Sbjct  276  DLRDDSIFRFCAIPQIMAIGTLAICYNNVEVFRGVVKMRRGLTAKVIDRTKTIADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDF+ ML+SKVD NDP A+KTL RL  I KTCR+SG LNKRKSYILR E  Y
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLVAIQKTCRESGLLNKRKSYILRKENGY  387



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++M+DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS +LKSKVD NDP A+KTL R+E + K CRDSG L+KRKSYI   E +Y   LI+  
Sbjct  336  FDFSSILKSKVDKNDPNATKTLSRVEAVQKLCRDSGALSKRKSYIANREQSYNSTLIVAL  395

Query  250  fiilailLGYLSGN  209
            FIILAI+  YLS +
Sbjct  396  FIILAIIYAYLSAS  409



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL H  DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHAGDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD S FRFCAIPQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDSSNFRFCAIPQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ +L+SKVD NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++ 
Sbjct  336  FDFASVLESKVDKNDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLL  395

Query  250  fiilailLGYLSGNK  206
             I+ +I+  YLS N+
Sbjct  396  VILFSIIFAYLSANR  410



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWP QIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPCQIWSKYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTNTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliiv  254
            FDFSCMLKSKVD+NDP A+KTL RLE I K C++SG L  KRKSYI+  E  Y   LI++
Sbjct  336  FDFSCMLKSKVDNNDPNATKTLSRLEAIQKICKNSGALTTKRKSYIIENESGYNSTLIVI  395

Query  253  ffiilailLGYLSGNKPHSV  194
             FIILAIL  YLS N P+S+
Sbjct  396  LFIILAILYAYLSSNLPNSL  415



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+L YEENS  AV+CLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLXYEENSAKAVRCLNDMVTNALVHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+C+NN  VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCFNNTQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LKSKVD+NDP A+KTL RLE I KTC++SGTL+KRKSYI+ +E  +  ALI + 
Sbjct  336  FDFSCLLKSKVDNNDPNATKTLSRLEAIQKTCKESGTLSKRKSYIIESESGHNSALIAII  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSSN  409



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   297 bits (760),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWS YV+KLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSIYVDKLEDLKYEENSGKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKLRRGLTAKVIDRTNTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNYTPaliiv  254
            FDFSCMLKSKVD+NDP A+KTL RLE I K+C++SG L  KRKSYI+  E  Y   LI++
Sbjct  336  FDFSCMLKSKVDNNDPNATKTLSRLEAIQKSCKNSGALTTKRKSYIIENESGYNSTLIVI  395

Query  253  ffiilailLGYLSGNKPHSV  194
             FIILAIL  YLS + P+S+
Sbjct  396  LFIILAILYAYLSSSLPNSL  415



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+ FRFCAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPANFRFCAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LK+KVDH+DP+A  TL RLE I +TC++SGTL KRKSYIL  E  Y   LI + 
Sbjct  336  FDFSCLLKAKVDHDDPSAKITLSRLEAIQQTCKNSGTLTKRKSYILENESRYNSVLIAII  395

Query  250  fiilailLGYLSGN  209
            FIILA    YLS N
Sbjct  396  FIILAFFYAYLSSN  409



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 169/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LK+E NSV AVQCLNDMVT+AL H++DCL Y+S
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKHEGNSVKAVQCLNDMVTNALIHMDDCLKYLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLAMCYNN+ VFRGVVKMRRGLTA+V+ +T+TM+DVYG F
Sbjct  276  ELRDPAIFRFCAIPQIMAIGTLAMCYNNVNVFRGVVKMRRGLTAQVLHQTKTMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD++DP A KTL RLE   K+CR+SG LNKRKSYI+R E  Y   LI++ 
Sbjct  336  FDFSCMLKSKVDNSDPNAIKTLSRLEAAQKSCRESGALNKRKSYIIRNEAKYNSVLIVLL  395

Query  250  fiilailLGYLSGNK  206
            F++L+I+  YLS N+
Sbjct  396  FVLLSIIFAYLSANR  410



>gb|KDO43891.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=213

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  16   EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  75

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  76   ALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  135

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++F
Sbjct  136  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIF  195

Query  250  fiilailLGYLSGNK  206
            FIILAI+  YLS  +
Sbjct  196  FIILAIIFSYLSSTR  210



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE NSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYE-NSVKAVQCLNDMVTNALLHAEDCLKYMS  274

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  275  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  335  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  394

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  395  VIILSIIFAYLSAKR  409



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE NSV AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYE-NSVKAVQCLNDMVTNALLHAEDCLKYMS  274

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VF GVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  275  ALRDMSIFRFCAIPQIMAIGTLALCYNNIEVFGGVVKMRRGLTAKVIDRTKTMADVYGAF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSCMLKSKVD NDP A+KTL RLE I KTCR+SG L+KRK YILR E   +  ++++ 
Sbjct  335  FDFSCMLKSKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKPYILRNESTNSSTMVLIL  394

Query  250  fiilailLGYLSGNK  206
             IIL+I+  YLS  +
Sbjct  395  VIILSIIFAYLSAKR  409



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL H +DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALLHADDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD S FRFCAIPQ+MAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDSSNFRFCAIPQVMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ +L+SKVD NDP A+KT  RLE I KTCR+SG L KRKSY+LR E  Y   +I++ 
Sbjct  336  FDFASVLESKVDKNDPNATKTSSRLEAIQKTCRESGLLTKRKSYVLRNESGYGSTMILLL  395

Query  250  fiilailLGYLS  215
             I+ +I+  YLS
Sbjct  396  VILFSIIFAYLS  407



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   294 bits (753),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI VF+GVVKMRRGLTAKVIDRT++M+DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIEVFKGVVKMRRGLTAKVIDRTKSMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            FDF+ ++KSKVD NDP A+KTL R+E + K CRDSG L+KRKSYI+  E N T
Sbjct  336  FDFASVIKSKVDKNDPHATKTLSRVEAVQKLCRDSGALSKRKSYIINNEQNST  388



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+ FRFCAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPANFRFCAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFSC+LK+KVDH+DP+A  TL RLE I +TC++SGTL KR SYIL  E  Y   LI + 
Sbjct  336  FDFSCLLKAKVDHDDPSAKITLSRLEAIQQTCKNSGTLTKRNSYILENESRYNSVLIAII  395

Query  250  fiilailLGYLSGN  209
            FIILA    YLS N
Sbjct  396  FIILAFFYAYLSSN  409



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 170/213 (80%), Gaps = 18/213 (8%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LK EENS+ AVQCLNDMVT+AL H+EDCLTYMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKEEENSIKAVQCLNDMVTNALIHMEDCLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+ P+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+ M DVYG F
Sbjct  276  ALQSPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKAMSDVYGAF  335

Query  430  FDFSCMLKS------------------KVDHNDPTASKTLKRLEIILKTCRDSGTLNKRK  305
            FDFSCMLKS                  KVD NDP A+K L RLE + K CR+SG L KRK
Sbjct  336  FDFSCMLKSKXRRLFICTIRDALASKEKVDKNDPNATKALSRLEAVQKICRESGALTKRK  395

Query  304  SYILRAEPNYTPaliivffiilailLGYLSGNK  206
            SY++R+EP Y  ALI+ FFIIL+I+  YLS N+
Sbjct  396  SYVIRSEPRYNSALIVAFFIILSIIFAYLSANR  428



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD SIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDLSIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS MLK+KV+ NDP ASKTL R+E I +TC+ SG +NKRK Y++R+EP Y PA+I++ 
Sbjct  336  FDFSVMLKAKVNSNDPNASKTLSRIEAIQQTCQQSGLMNKRKLYVVRSEPMYNPAVIVIL  395

Query  250  fiilailLGYLSGNK  206
            F +L I+L YLS  +
Sbjct  396  FSLLCIILAYLSAKR  410



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWS+YVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSEYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPPIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDF+ ML+ KVD NDP A+KTL RLE I KTCR+SG L+KRKSYI+  E  Y
Sbjct  336  FDFASMLEPKVDKNDPNATKTLSRLEAIQKTCRESGLLSKRKSYIVNDESGY  387



>ref|XP_004150142.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 ref|XP_004167323.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD SIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDLSIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS MLK+KV+ NDP ASKTL R+E I KTC+ SG LN+RK Y++R+EP + PA+I++ 
Sbjct  336  FDFSVMLKAKVNSNDPNASKTLSRIEAIQKTCKQSGILNRRKLYVVRSEPMFNPAVIVIL  395

Query  250  fiilailLGYLSGNK  206
            F +L I+L YLS  +
Sbjct  396  FSLLCIILAYLSAKR  410



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+DP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F
Sbjct  276  QLKDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
             DFS MLKSKVD +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + 
Sbjct  336  SDFSDMLKSKVDMHDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALL  395

Query  250  fiilailLGYLSGNKPHSV  194
            F ILAIL  YLS N+P+ +
Sbjct  396  FTILAILYAYLSANRPNKI  414



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+  
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFL  394

Query  250  fiilailLGYLSGNKPHS  197
             I+  I+  YLS N+ ++
Sbjct  395  VILFGIMFAYLSANRQNN  412



>ref|XP_006487315.1| PREDICTED: squalene synthase isoform X2 [Citrus sinensis]
 gb|KDO43890.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=295

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  98   EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  157

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  158  ALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  217

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++F
Sbjct  218  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIF  277

Query  250  fiilailLGYLSGNKP  203
            FIILAI+  YLS  + 
Sbjct  278  FIILAIIFSYLSSTRA  293



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+  
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFL  394

Query  250  fiilailLGYLSGNKPHS  197
             I+  I+  YLS N+ ++
Sbjct  395  VILFGIMFAYLSANRQNN  412



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++ 
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILIL  394

Query  250  fiilailLGYLSGNKPHS  197
             I+  I+  +LS N+ ++
Sbjct  395  VILFGIMFAHLSANRQNN  412



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMGDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++ 
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILIL  394

Query  250  fiilailLGYLSGN  209
             I+  I+  YLS N
Sbjct  395  VILFGIMFAYLSAN  408



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YMS
Sbjct  215  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHIEDCLKYMS  274

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+DP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F
Sbjct  275  QLKDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
             DFS MLKSKVD +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + 
Sbjct  335  SDFSDMLKSKVDMHDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALL  394

Query  250  fiilailLGYLSGNKP  203
            F ILAIL  YLS N+P
Sbjct  395  FTILAILYAYLSANRP  410



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H ED L YM+
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLIYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDSSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ +L+SKVD NDP A+KTL RL  I K+CR+SG L+KRKS+I++ E  Y   +I++ 
Sbjct  336  FDFASVLESKVDKNDPNATKTLSRLVAIQKSCRESGLLSKRKSFIVKNENGYGSFMIVML  395

Query  250  fiilailLGYLSGN  209
             I+++I+  YLS N
Sbjct  396  VIMVSIIFAYLSAN  409



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 167/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL H ED L YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALMHAEDSLIYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD SIFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDSSIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ +L+SKVD NDP A+KTL RL  I K+CR+SG L+KRKS+I++ E  Y   +I++ 
Sbjct  336  FDFASVLESKVDKNDPNATKTLSRLVAIQKSCRESGLLSKRKSFIVKNENGYGSFMIVML  395

Query  250  fiilailLGYLSGNKPHS  197
             I+++I+  YL  N PH+
Sbjct  396  VIMVSIIFAYLFAN-PHN  412



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTA+VIDRT++M+DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAEVIDRTKSMDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS +L SKVD NDP A+K+L R+E + K CRDSG L+KRKSYI   E +Y   LI+  
Sbjct  336  FDFSSILNSKVDKNDPNATKSLSRVEAVQKLCRDSGALSKRKSYIANREQSYNSTLIVAL  395

Query  250  fiilailLGYLSGN  209
            FIILAI+  Y S +
Sbjct  396  FIILAIIYAYFSAS  409



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I++ 
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILIL  394

Query  250  fiilailLGYLSGN  209
             I+  I+  YLS N
Sbjct  395  VILFGIMFAYLSAN  408



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 163/195 (84%), Gaps = 1/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+ FRFCAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPANFRFCAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliiv  254
            FDFSC+LK+KVDH+DP+A  TL RLE I +TC++SGTL K RKSYIL  E  Y   LI +
Sbjct  336  FDFSCLLKAKVDHDDPSAKITLSRLEAIQQTCKNSGTLTKSRKSYILENESRYNSVLIAI  395

Query  253  ffiilailLGYLSGN  209
             FIILA    YLS N
Sbjct  396  IFIILAFFYAYLSSN  410



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 155/188 (82%), Gaps = 14/188 (7%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV KLE+LK EENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVKKLEDLKDEENSVKAVQCLNDMVTNALLHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRR--------------GLTAKV  473
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRR              GLTAKV
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIKVFRGVVKMRRVFQVDVHFISASFPGLTAKV  335

Query  472  IDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL  293
            IDRT++M DVYG F+DFS +LK+KVD NDP A KT+ RL+ ILKTCRDSG LNKRKSYI+
Sbjct  336  IDRTKSMTDVYGAFYDFSYILKAKVDKNDPNAQKTVSRLDSILKTCRDSGVLNKRKSYII  395

Query  292  RAEPNYTP  269
              + NYTP
Sbjct  396  ENQSNYTP  403



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYV+KLEELKYE+NS  AVQCLNDMVT+AL HVED LTYMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVDKLEELKYEQNSEKAVQCLNDMVTNALLHVEDSLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTA VI++T +M DVYG F
Sbjct  276  ALRDHAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAIVIEQTNSMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            FDF+CMLK KVD  DP A+KTL R+E I K CRDSGTLNKRK Y+++++P  TP
Sbjct  336  FDFACMLKPKVDKRDPNATKTLSRIEAIQKICRDSGTLNKRKLYVVKSKPGLTP  389



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY  KLE+LKYE+NS NAVQCLN+MVTDAL+H+EDCL YM+
Sbjct  227  EDINEIPKSRMFWPRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTDALTHIEDCLKYMA  286

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  287  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  346

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  347  YDFSCMLKTKVDKNDPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  391



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL H+EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALIHMEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IF+FCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT++++DVYG F
Sbjct  276  ALRDPAIFKFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTKSIDDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            FDF+ ++KSKVD ND  A+KTL R+E + K CRDSG L+KRKSYI+  E N T
Sbjct  336  FDFASVIKSKVDKNDLHATKTLSRVEAVQKLCRDSGALSKRKSYIINNEQNST  388



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM  VYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMAGVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKVD NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   +I+  
Sbjct  336  FDFASMLESKVDKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMILFL  394

Query  250  fiilailLGYLSGNKPHS  197
             I+  I+  YLS N+ ++
Sbjct  395  VILFGIMFAYLSANRQNN  412



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY NKLE+LKYEENSV AV CLNDMVT+AL HVEDCL YM 
Sbjct  216  EDINEIPKSRMFWPREIWSKYANKLEDLKYEENSVKAVHCLNDMVTNALIHVEDCLNYML  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFS MLKSKVD  DP A KT   LE +LK CRDSG L +R SYI++ +P Y
Sbjct  336  YDFSLMLKSKVDDADPNARKTKANLEKVLKLCRDSGALGQRNSYIIQRKPQY  387



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+ FRFCAIPQIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPANFRFCAIPQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliiv  254
            FDFSC+LK+KVDH+DP+A  TL RLE I +TC++SGTL K R SYIL  E  Y   LI +
Sbjct  336  FDFSCLLKAKVDHDDPSAKITLSRLEAIQQTCKNSGTLTKSRNSYILENESRYNSVLIAI  395

Query  253  ffiilailLGYLSGN  209
             FIILA    YLS N
Sbjct  396  IFIILAFFYAYLSSN  410



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK +ENSV AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKSQENSVKAVQCLNDMVTNALVHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFS MLK KVD  DP A  T  RL+ ILK CRDSGTLN+RKSYI+ + P Y
Sbjct  336  YDFSRMLKFKVDDKDPNAGTTKDRLDSILKICRDSGTLNERKSYIIESGPQY  387



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 164/195 (84%), Gaps = 1/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW+KYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRKIWNKYVNKLEDLKYEENSVKAVQCLNDMVTNALLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT  M DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNLQVFRGVVKMRRGLTAKVIDRTNKMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLN-KRKSYILRAEPNYTPaliiv  254
            +DFSCMLK+KVD+NDP A+KTL RLE I K C++SG +   RKSY+L  +  Y   LI +
Sbjct  336  YDFSCMLKTKVDNNDPNATKTLSRLEAIQKKCKESGVITPNRKSYVLENDSGYNLVLIAI  395

Query  253  ffiilailLGYLSGN  209
             FIILA++  YLS N
Sbjct  396  LFIILALVYAYLSSN  410



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYE+NSV AVQCLNDMVT+AL H EDCL YM+
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEDNSVKAVQCLNDMVTNALMHAEDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI +FRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  ALRDLAIFRFCAIPQIMAIGTLALCYNNIELFRGVVKMRRGLTAKVIDRTKTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDF+ ML+SKV  NDP A+KTL RLE I KTCR+SG LNKRKS +LR    Y   + +  
Sbjct  336  FDFASMLESKVVKNDPNATKTLSRLEAIQKTCRESGLLNKRKS-LLRNGNGYGSTMTLFL  394

Query  250  fiilailLGYLSGN  209
             I+  I+  YLS N
Sbjct  395  VIVFGIMFAYLSAN  408



>ref|XP_006423444.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36684.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=267

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  70   EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  129

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  130  VLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  189

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++F
Sbjct  190  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIF  249

Query  250  fiilailLGYLSGNKP  203
            FIILAI+  YLS  + 
Sbjct  250  FIILAIIFSYLSSTRA  265



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PK RMFWPR+IW KY +KLE+LKYEENS  AV CLNDMVT+AL H+EDCL YM+
Sbjct  218  EDINEVPKSRMFWPRKIWGKYADKLEDLKYEENSTKAVHCLNDMVTNALIHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKMRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK KVD NDP ASKTL RLE + K CRD+G L++RKSY+
Sbjct  338  YDFSCMLKIKVDKNDPNASKTLNRLEAVQKVCRDTGVLHQRKSYV  382



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK+EENS  AVQCLNDMVT+AL H EDCL Y+S
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKHEENSDKAVQCLNDMVTNALMHAEDCLKYVS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVI +T TM DVYG F
Sbjct  276  ALKDLAIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKMRRGLTAKVIHQTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFSCMLKSKVD NDP A+KTL RLE I +TC DS  +NKRKS++   +P Y+ +++I+ 
Sbjct  336  YDFSCMLKSKVDRNDPNATKTLSRLESIQRTCLDSRLINKRKSFVNEGQPTYSSSMVIIL  395

Query  250  fiilailLGYLSGNKPHS  197
            FI+LAI+L YL+ N  +S
Sbjct  396  FIVLAIILAYLTANPLNS  413



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  +VQCLN+MVT+AL H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPREIWGKYADKLEDLKYEENSTKSVQCLNEMVTNALMHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  278
            +DFSCMLK+KVD NDP  SKTL RLE + K CRDSG LN RKSY+  + +PN
Sbjct  338  YDFSCMLKTKVDKNDPNGSKTLNRLEAVQKLCRDSGVLNNRKSYVDDKGQPN  389



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+ KYEENSV AVQCLND+VT+AL+HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWGKYADKLEDFKYEENSVKAVQCLNDLVTNALNHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD SIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  276  NLRDLSIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDRTQTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            FDFS MLK+KV+ +DP A+KTL R+E I KTC  SG LNKRK Y +++EP + P LI++ 
Sbjct  336  FDFSVMLKAKVNSSDPNATKTLSRIEAIQKTCEQSGLLNKRKLYAVKSEPMFNPTLIVIL  395

Query  250  fiilailLGYLSGNK  206
            F +L I+L YLS  +
Sbjct  396  FSLLCIILAYLSAKR  410



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  276  ALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKRKSYI+++E  Y+  +I++F
Sbjct  336  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSELRYSSTMIVIF  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+  YLS  +
Sbjct  396  FIILAIIFSYLSSTR  410



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL+H+EDC+ YM+
Sbjct  218  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSTKAVQCLNDMVTNALTHIEDCVKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IFRFCAIPQIMAIGT+A+CYNNI VFRGVVKMRRGLTAKV+DRT TM DVYG F
Sbjct  278  SLRDPAIFRFCAIPQIMAIGTIALCYNNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            + FS +LK+KVD NDP A+KTL +LE + K CR+SG L+KRKSY+   +P + P  + + 
Sbjct  338  YSFSRLLKTKVDKNDPNATKTLNQLEAVQKVCRESGMLHKRKSYVDDDKPQFNPLYVAIL  397

Query  250  fiilailLGYLSGNK  206
             I+L+I+  YL  N+
Sbjct  398  VILLSIVFAYLKANQ  412



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK +ENSV AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKSQENSVKAVQCLNDMVTNALVHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKIIDRTKTMFDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFS MLK KVD  DP A  T  RL+ ILK CRDSGTLN RKSYI+ + P Y
Sbjct  336  YDFSRMLKFKVDDKDPNAGTTKDRLDSILKICRDSGTLNDRKSYIIESGPQY  387



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+
Sbjct  234  EDINEIPKSRMFWPRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLKYMA  293

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  294  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  353

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP AS TL RLE + K CRD+G L+KRKSYI
Sbjct  354  YDFSCMLKTKVDKNDPNASMTLNRLEAVQKVCRDTGVLHKRKSYI  398



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY  KLE+LKYE+NS NAVQCLN+MVT+AL+H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTNALTHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD N+P ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  338  YDFSCMLKTKVDKNEPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  382



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  +VQCLN+MVT+AL H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPREIWGKYADKLEDLKYEENSTKSVQCLNEMVTNALIHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  278
            +DFSCMLK+KVD+NDP ASKTL RLE + K C+D+G L+ RKSY+  + +PN
Sbjct  338  YDFSCMLKTKVDNNDPNASKTLNRLEAVQKLCKDTGVLHNRKSYVNDKGQPN  389



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY  KLE+LKYE+NS NAVQCLN+MVT+AL+H+EDCL YM+
Sbjct  208  EDINEIPKSRMFWPRKIWGKYAGKLEDLKYEKNSSNAVQCLNEMVTNALTHIEDCLKYMA  267

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  268  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  327

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD N+P ASKTLK+LE + + CRD+G L+KRKSY+
Sbjct  328  YDFSCMLKTKVDKNEPNASKTLKQLEDVQQLCRDNGVLHKRKSYV  372



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT++L H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNSLLHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IF+FCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAK+ID+TRTM DVY  F
Sbjct  276  DLRDPAIFKFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDKTRTMADVYAAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DFS ++KSKVD  DP A+KTL RLE + KTCR+SG L  RKSYI+++E ++
Sbjct  336  YDFSSIIKSKVDKKDPNATKTLSRLESVQKTCRESGALTNRKSYIIKSEQSF  387



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   286 bits (732),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLNYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP AS TL RL+ + K CRD+G L+KRKSYI
Sbjct  338  YDFSCMLKTKVDKNDPNASMTLNRLDAVQKVCRDTGVLHKRKSYI  382



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+I SKYVNKLE+LKYEE+S  AVQCLNDMVT+AL H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIRSKYVNKLEDLKYEEDSEKAVQCLNDMVTNALIHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+DP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRT+TM DVY  F
Sbjct  276  QLKDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTKTMADVYQAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
             DFS MLKSKVD +DP A  T+ RLE   K C+DSGTL+ RKSYI++ E +Y+ AL+ + 
Sbjct  336  SDFSDMLKSKVDMHDPNAQTTITRLEAAQKICKDSGTLSNRKSYIVKRESSYSAALLALL  395

Query  250  fiilailLGYLSGNKPHSV  194
            F ILAIL  YLS N+P+ +
Sbjct  396  FTILAILYAYLSANRPNKI  414



>ref|XP_006423443.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36683.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=356

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  159  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  218

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  219  VLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  278

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++F
Sbjct  279  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIF  338

Query  250  fiilailLGYLSGNKP  203
            FIILAI+  YLS  + 
Sbjct  339  FIILAIIFSYLSSTRA  354



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  278
            +DFSCMLK+KVD NDP ASKTL RLE + K C D+G LN RKSY+  + +PN
Sbjct  338  YDFSCMLKTKVDRNDPNASKTLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  389



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY  KLE+LKYEENS  AV CLN+MVT+AL H+EDCL YM 
Sbjct  218  EDINEIPKSRMFWPRKIWGKYAGKLEDLKYEENSTKAVHCLNEMVTNALMHIEDCLKYMV  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  278
            +DFSCMLK+KVD +DP ASKTL R+E + K CRD+G L KRKSY+  + +PN
Sbjct  338  YDFSCMLKTKVDKDDPNASKTLNRIEAVQKICRDTGVLQKRKSYVNDKGQPN  389



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+
Sbjct  207  EDINEIPKSRMFWPRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMA  266

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  267  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAF  326

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP AS TL RLE + K C+D+G L KRKSY+
Sbjct  327  YDFSCMLKTKVDKNDPNASNTLNRLEAVEKVCKDTGVLQKRKSYV  371



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENS  AVQCLNDMVT++L H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNSLLHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IF+FCAIPQ+MAIGTLA+CYNNI VFRGVVKMRRGLTAK+ID+TRTM DVY  F
Sbjct  276  DLRDPAIFKFCAIPQVMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDKTRTMADVYAAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNY  275
            +DFS ++KSKVD  DP A+KTL RLE + KTCR+SG L N RKSYI+++E ++
Sbjct  336  YDFSSIIKSKVDKKDPNATKTLSRLESVQKTCRESGALTNSRKSYIIKSEQSF  388



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+
Sbjct  207  EDINEIPKSRMFWPRKIWGKYADKLEDLKYEENSTKAVHCLNEMVTNALTHIEDCLNYMA  266

Query  610  ALRDPSIFRFCAIPQ-IMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGG  434
            ALRDPSIFRFCAIPQ IMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG 
Sbjct  267  ALRDPSIFRFCAIPQQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGA  326

Query  433  FFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            F+DFSCMLK+KVD NDP AS TL RLE + K CRD+G L+KRKSYI
Sbjct  327  FYDFSCMLKTKVDKNDPNASMTLNRLEAVQKVCRDTGVLHKRKSYI  372



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+ RMFWPR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+
Sbjct  207  EDINEIPESRMFWPRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMA  266

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  267  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAF  326

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP AS TL RLE + K CRD+G L KRKSY+
Sbjct  327  YDFSCMLKTKVDKNDPNASNTLNRLEAMQKVCRDTGVLQKRKSYV  371



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  AV CLN+MVT+AL+H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPRKIWGKYADKLEDLKYEENSTKAVNCLNEMVTNALTHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ +FRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQLFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP AS TL RLE + K C+D+G L KRKSY+
Sbjct  338  YDFSCMLKTKVDKNDPNASNTLNRLEAVEKVCKDTGVLQKRKSYV  382



>ref|XP_009619298.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=405

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 7/197 (4%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+LK+EENSV AVQCLNDM+T+ALSHVEDCL  +S
Sbjct  215  EDINEVPKCRMFWPRQIWSKYVNKLEDLKFEENSVKAVQCLNDMITNALSHVEDCLVCLS  274

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+I R CAIPQIMA+GTL MCYNN  VFRG VKMRRGL+AKV D+TRTMEDVYG F
Sbjct  275  TLRDPAILRSCAIPQIMAVGTLTMCYNNAEVFRGAVKMRRGLSAKVFDQTRTMEDVYGAF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRD-SGTLNKRKSYILRAEPNYTPaliiv  254
            F FS +LKSKVD+NDP A+ TLKR+E I+KTCRD SGTL+KR       +PNY P LII+
Sbjct  335  FHFSSILKSKVDNNDPNATNTLKRIESIMKTCRDYSGTLSKRN------KPNYIPTLIII  388

Query  253  ffiilailLGYLSGNKP  203
            FFI++AILL YLS  +P
Sbjct  389  FFIVVAILLAYLSAKRP  405



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLN+MVT++L HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNEMVTNSLLHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIM+IGTLA+CYNNI VFRGVVKMRRGLTA VID+T TM DVYG F
Sbjct  276  ALKDHAIFRFCAIPQIMSIGTLALCYNNIQVFRGVVKMRRGLTAIVIDQTNTMPDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DF+CM+K KVD  DP A KTL R+E I K CRDSGTLN+RK Y+ R +  YTP
Sbjct  336  YDFACMMKPKVDKKDPNAIKTLNRIEAIQKICRDSGTLNQRKLYV-RNKSTYTP  388



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  276  VLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKRKSYI+++   Y+  +I++F
Sbjct  336  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTMIVIF  395

Query  250  fiilailLGYLSGNK  206
            FIILAI+  YLS  +
Sbjct  396  FIILAIIFSYLSSTR  410



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK R+FWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRIFWPRQIWSKYVDKLEDLKYEENSAKAVQCLNDMVTNALIHAEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP  FRFCAI QIMAIGTL++C+NNI VFRGVVKMRRGLTAK+IDRT+TM DVY  F
Sbjct  276  DLRDPGNFRFCAISQIMAIGTLSLCFNNIQVFRGVVKMRRGLTAKIIDRTKTMSDVYDAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNK-RKSYILRAEPNYTPaliiv  254
            FDFSC+LK+KVDH+DP+A  TL RLE I +TC++SGTL K RKSYIL  E  Y   LI +
Sbjct  336  FDFSCLLKAKVDHDDPSAKITLSRLEAIQQTCKNSGTLTKSRKSYILENESRYNSVLIAI  395

Query  253  ffiilailLGYLSGN  209
             FIILA    YLS N
Sbjct  396  IFIILAFFYAYLSSN  410



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 2/197 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLE--ELKYEENSVNAVQCLNDMVTDALSHVEDCLTY  617
            EDINEIPK RMFWPRQIWSKYV+KLE  +LKYEENS  AVQCLNDMVT+AL+H+EDC+ Y
Sbjct  218  EDINEIPKSRMFWPRQIWSKYVDKLEVHDLKYEENSTKAVQCLNDMVTNALTHIEDCVKY  277

Query  616  MSALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYG  437
            M++LRDP+IFRFCAIPQIMAIGT+A+CYNNI VFRGVVKMRRGLTAKV+DRT TM DVYG
Sbjct  278  MASLRDPAIFRFCAIPQIMAIGTIALCYNNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYG  337

Query  436  GFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPalii  257
             F+ FS +LK+KVD NDP A+KTL +LE + K CR+SG L+KRKSY+   +P + P  + 
Sbjct  338  AFYSFSRLLKTKVDKNDPNATKTLNQLEAVQKVCRESGMLHKRKSYVDDDKPQFNPLYVA  397

Query  256  vffiilailLGYLSGNK  206
            +  I+L+I+  YL  N+
Sbjct  398  ILVILLSIVFAYLKANQ  414



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEPN  278
            +DFSCMLK+KVD NDP AS TL RLE + K C D+G LN RKSY+  + +PN
Sbjct  338  YDFSCMLKTKVDKNDPNASITLNRLEAVQKLCIDTGVLNNRKSYVDDKGQPN  389



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  718  LEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAIPQIMAIGTLAM  539
            L+ELKYE+NS  AVQCLNDMVT+ALSHVEDCLTYMSALRDPSIFRFCAIPQ+MAIGTLAM
Sbjct  205  LQELKYEDNSAKAVQCLNDMVTNALSHVEDCLTYMSALRDPSIFRFCAIPQVMAIGTLAM  264

Query  538  CYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKR  359
            CY+NI VFRGVVKMRRGLTAKVID+TRT+ DVYG FFDFSCMLKSKV++NDP A+KTLKR
Sbjct  265  CYDNIEVFRGVVKMRRGLTAKVIDQTRTIADVYGAFFDFSCMLKSKVNNNDPNATKTLKR  324

Query  358  LEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivffiilailLGYLSGNK  206
            LE ILKTCRDSGTLNKRKSYI+R+EPNY+P LI+V FIILAI+L  LSGN+
Sbjct  325  LEAILKTCRDSGTLNKRKSYIIRSEPNYSPVLIVVIFIILAIILAQLSGNR  375



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR++W KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPREVWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDPSIFRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  ALRDPSIFRFCAIPQIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP AS TL RLE + K C D+G LN RKSY+
Sbjct  338  YDFSCMLKTKVDKNDPNASMTLNRLEAVQKLCIDTGVLNNRKSYV  382



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWS YVNKLE+LKYEENS  A+QCLN+MVT+AL H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSTYVNKLEDLKYEENSEMALQCLNNMVTNALIHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+DP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVK+RRGLTAKVIDRTRTM DVY  F
Sbjct  276  QLKDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKLRRGLTAKVIDRTRTMADVYQAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
             DFS M+KSKVD +DP+A  T+ RLE   K C+DS TL+ RKSYI + E  Y PAL+ + 
Sbjct  336  SDFSDMIKSKVDMHDPSAQTTITRLEAAQKICKDSSTLSNRKSYIFKRESGYCPALLALL  395

Query  250  fiilailLGYLSGN  209
            FIILAIL  YLS N
Sbjct  396  FIILAILYAYLSAN  409



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEEN+  +VQCLN+MVT+AL H+EDCL YM 
Sbjct  218  EDINEIPKSRMFWPREIWGKYADKLEDLKYEENTNKSVQCLNEMVTNALMHIEDCLKYMV  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDPSIFRFCAIPQIMAIGTLA+CYNN  VFRGVVK+RRGLTAKVIDRT+TM DVYG F
Sbjct  278  SLRDPSIFRFCAIPQIMAIGTLALCYNNEQVFRGVVKLRRGLTAKVIDRTKTMADVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL-RAEPN  278
            +DFSCMLK+KVD NDP ASKTL RLE + K CRD+G L  RKSY+  + +PN
Sbjct  338  YDFSCMLKTKVDKNDPNASKTLNRLEAVQKLCRDAGVLQNRKSYVNDKGQPN  389



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS
Sbjct  219  EDINEVPKCRMFWPRQIWSKYVNKLEDFKYEENSVKAVQCLNEMVTNALLYVEDCLTSMS  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+FCAIPQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVY  F
Sbjct  279  SLRDPAIFQFCAIPQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYRAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DF C+++SKVD +DP A+ TLKRLE ILKTCRDSGTLN+RKSY    +PNY
Sbjct  339  YDFCCIMESKVDRDDPNATSTLKRLEAILKTCRDSGTLNQRKSYTFSHQPNY  390



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 165/195 (85%), Gaps = 2/195 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL+H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPRQIWSKYVDKLEDLKYEENSNKAVQCLNDMVTNALTHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IFRFCAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKV+DRT TM DVYG F
Sbjct  278  SLRDPAIFRFCAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVMDRTNTMTDVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFS MLK+KVD NDP ASKTL R+E + K C DSG  +KRKS+I   E  + P  I++ 
Sbjct  338  YDFSPMLKTKVDKNDPNASKTLSRIEAVQKICIDSGA-HKRKSFI-TDESRFNPLTIVML  395

Query  250  fiilailLGYLSGNK  206
             +ILAI+L YL+ N+
Sbjct  396  IVILAIVLAYLNPNQ  410



>ref|XP_010027379.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=274

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDIN+IPK RMFWP QIW KYVNKLE+LKYEENSV AVQCLN+MVTDAL+HVED LTYMS
Sbjct  77   EDINKIPKSRMFWPHQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTDALTHVEDSLTYMS  136

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRF AI QIMAIG LA+ YNNI VFRG VK+R GL AK+ D TRTM DVYG F
Sbjct  137  ALRDPAIFRFWAIFQIMAIGNLALSYNNIEVFRGEVKIRPGLAAKLRDHTRTMADVYGVF  196

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  281
            +DFSCMLKSKVD NDP A+KTL  +E + K CRDSG LNKRKSYIL  EP
Sbjct  197  YDFSCMLKSKVDKNDPNATKTLSIIEGMQKACRDSGLLNKRKSYILATEP  246



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 164/197 (83%), Gaps = 7/197 (4%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+LK  ENSV AVQCLNDMVT+ALSH EDCL  +S
Sbjct  216  EDINEVPKCRMFWPRQIWSKYVNKLEDLKCGENSVKAVQCLNDMVTNALSHGEDCLVCLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L DP+IFR CAIPQIMAIGTL MCYNN+ VFRGVVKMRRGL+AKV D+TRTMEDVYG F
Sbjct  276  TLHDPAIFRSCAIPQIMAIGTLTMCYNNVEVFRGVVKMRRGLSAKVFDQTRTMEDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRD-SGTLNKRKSYILRAEPNYTPaliiv  254
            F FS +LKSKVD+NDP A+ TLKR+E I+KTCRD S TL+KR       +PNY P LIIV
Sbjct  336  FHFSSILKSKVDNNDPNATNTLKRIESIMKTCRDYSETLSKRN------KPNYIPTLIIV  389

Query  253  ffiilailLGYLSGNKP  203
            FF ++AILL YLS  +P
Sbjct  390  FFFVVAILLAYLSAKRP  406



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS
Sbjct  219  EDINEVPKCRMFWPRQIWSKYVNKLEDFKYEENSVMAVQCLNEMVTNALLYVEDCLTGMS  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LR+P+IF FCAIPQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F
Sbjct  279  SLRNPAIFHFCAIPQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            +DF C+++SKVD +DP A+ TLKRLE ILKTCRDSGTLN+RKS+    +PNY
Sbjct  339  YDFCCIMESKVDRDDPNATITLKRLEAILKTCRDSGTLNQRKSHTFSHQPNY  390



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 158/195 (81%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP  RMFWPRQIW KYVNKLE+LKYEENSV AVQCLN+MVT+AL+HVED LTYMS
Sbjct  216  EDINEIPMSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTNALTHVEDSLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRF AI QIMAIG L++ YNNI VFRG VK+R GL AKV DRTRTM DVYG F
Sbjct  276  ALRDPAIFRFWAIFQIMAIGNLSLSYNNIEVFRGEVKIRPGLAAKVRDRTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DFSCM+KSKVD +D  A+KTL  +E I K CRDSG LNKRKSYIL  EP Y+  L+   
Sbjct  336  YDFSCMIKSKVDKDDSNATKTLSIIEGIQKACRDSGLLNKRKSYILATEPTYSSILVAFL  395

Query  250  fiilailLGYLSGNK  206
             +IL I++ +LS ++
Sbjct  396  LMILVIVVAHLSASQ  410



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK  MFWPR+IWSKYVNKLE+LK EENS  AVQCLN+M+T+AL HVEDC  YMS
Sbjct  216  EDINEIPKRHMFWPREIWSKYVNKLEDLKDEENSEKAVQCLNEMLTNALLHVEDCFKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIM+IGT A+CYNN+ VFRGVVKMRRGLTA VID+T TM DVYG F
Sbjct  276  ALQDHAIFRFCAIPQIMSIGTYALCYNNVQVFRGVVKMRRGLTAVVIDQTNTMPDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            +DF+CM+K KVD  DP A+KTL R+E I K CRDSGTLNKRK +I+  +  YTP +++V 
Sbjct  336  YDFACMMKLKVDKRDPNATKTLSRIEAIQKICRDSGTLNKRKLHIVHTKSAYTPIMMMVL  395

Query  250  fiilailLGYLSGNK  206
             II+AI+   LS N+
Sbjct  396  LIIVAIIFARLSANR  410



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 10/181 (6%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KY +KLE+LKYEENS  +VQCLN++VT+AL H+EDCL YM+
Sbjct  218  EDINEIPKSRMFWPREIWGKYADKLEDLKYEENSTKSVQCLNELVTNALMHIEDCLKYMA  277

Query  610  ALRDPSIFRFCAIPQ---------IMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTR  458
            ALRDPSIFRFCAIPQ         IMAIGTLA+CYNN+ VFRGVVK+RRGLTAKVIDRT+
Sbjct  278  ALRDPSIFRFCAIPQVGEGNIIILIMAIGTLALCYNNVQVFRGVVKLRRGLTAKVIDRTK  337

Query  457  TMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI-LRAEP  281
            TM DVYG F+DFSCMLK+KVD NDP AS TL RLE + K C D+G LN RKSY+  + +P
Sbjct  338  TMADVYGAFYDFSCMLKTKVDKNDPNASITLNRLEAVQKLCIDTGVLNNRKSYVDDKGQP  397

Query  280  N  278
            N
Sbjct  398  N  398



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  276  ALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKR
Sbjct  336  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKR  376



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT  M DVY  F
Sbjct  276  ALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            +DFS +LK K++ NDP A+KTL R+E I K C DSG LNKR
Sbjct  336  YDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKR  376



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+ KYEENSV A QCLN+MVT+ALSH EDCLTYMS
Sbjct  204  EDINEVPKCRMFWPRQIWSKYVNKLEDFKYEENSVKAGQCLNEMVTNALSHAEDCLTYMS  263

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP IF FCAIPQI+ +G L M YNNI VF+GVV+MRRGL AKVI +TRTM DVY  F
Sbjct  264  NLRDPVIFHFCAIPQIINMGNLTMYYNNIEVFKGVVEMRRGLCAKVIGQTRTMTDVYRAF  323

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDF  +L+SKVDHNDP A+ TLKRLE I KTCRDSGTLN+RKS I   + NY
Sbjct  324  FDFCRILESKVDHNDPNATITLKRLEAISKTCRDSGTLNQRKSCIFSRQRNY  375



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDIN+IPK RMFWP QIW KYVNKLE+LKYEENSV AVQCLN+MVTDAL+HVED LTYMS
Sbjct  216  EDINKIPKSRMFWPHQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTDALTHVEDSLTYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRF AI QIMAIG LA+ YNNI VFRG VK+R GL AK+ D TRTM DVYG F
Sbjct  276  ALRDPAIFRFWAIFQIMAIGNLALSYNNIEVFRGEVKIRPGLAAKLRDHTRTMADVYGSF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  281
            +DFSCMLK KVD NDP A+KTL  +E I K CRDSG LNKRKSYIL  EP
Sbjct  336  YDFSCMLKPKVDKNDPNATKTLSIIEGIQKACRDSGLLNKRKSYILATEP  385



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+ KYEENSV AVQCLN+MVT+AL +VEDCLT MS
Sbjct  219  EDINEVPKCRMFWPRQIWSKYVNKLEDFKYEENSVMAVQCLNEMVTNALLYVEDCLTGMS  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LR+P+IF FCAIPQI+ +G L+M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F
Sbjct  279  SLRNPAIFHFCAIPQIINMGNLSMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DF C+++SKVD +DP A+ TLKRLE ILKTCRDSGTLN+RK+YI
Sbjct  339  YDFCCIMESKVDRDDPNATITLKRLEAILKTCRDSGTLNQRKNYI  383



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDIN+IPK RMFWPRQIW KYVNKLE+LKYEENSV AVQCLN+MVT+AL+HVED LTYMS
Sbjct  210  EDINQIPKSRMFWPRQIWGKYVNKLEDLKYEENSVKAVQCLNEMVTNALTHVEDSLTYMS  269

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IFRF AI QIMAIG L + YNNI VF+G VK+R GL AKV DRTRTM DVYG F
Sbjct  270  SLRDPTIFRFWAIFQIMAIGNLVLSYNNIQVFKGEVKIRPGLAAKVRDRTRTMADVYGAF  329

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  281
            +DFSCMLKSKVD NDP A+KTL  +E I K CRDS  LNKRKSYIL  +P
Sbjct  330  YDFSCMLKSKVDKNDPNATKTLSIIEGIQKACRDSSLLNKRKSYILATKP  379



>ref|XP_006841632.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PK RMFWPR+IW+KY  KLE+ KYEENS  AV+CLN+MVT+AL HVEDCL YMS
Sbjct  216  EDINEVPKSRMFWPREIWNKYALKLEDFKYEENSSEAVRCLNEMVTNALFHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNN+ +FRGVV+MRRGL A+V+D TR+M DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLALCYNNVELFRGVVRMRRGLVARVMDETRSMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  299
            FDFSCML SKVD  DP A+KTL R+E I K CR SG+L+KR+SY
Sbjct  336  FDFSCMLSSKVDKGDPNATKTLDRVEAIQKACRASGSLDKRRSY  379



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKY +KLE+LKYEENS  AV+CLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYADKLEDLKYEENSAKAVECLNDMVTNALMHAEDCLVYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQ+MAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TRTM DVYG F
Sbjct  276  ALKDIAIFRFCAIPQVMAIGTLALCYNNLEVFRGVVKMRRGLTARVIDQTRTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            +DFS +LK+KV+  DP A  T KR+E I K C  SG LNKR   +   +P + P
Sbjct  336  YDFSSLLKAKVNDKDPNAELTKKRVEAIQKACISSGLLNKRGLQVCDTKPTFNP  389



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+LK EENS  AVQCLN+MVT+AL HVE CL  M+
Sbjct  219  EDINEIPKPRMFWPREIWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEVCLKSMA  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IF+ C+IPQI+A+GTLA+CYNN+ VFRGVVK+RRGL AKVIDRT+TM+DVYG F
Sbjct  279  GLRDPAIFKSCSIPQIVAMGTLALCYNNVQVFRGVVKLRRGLIAKVIDRTKTMDDVYGAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP A KTLKRLE I K CR++G L+KRKSY+
Sbjct  339  YDFSCMLKTKVDKNDPNAIKTLKRLEAIEKVCRENGDLHKRKSYV  383



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+LK EE S  AVQCLN+MVT+AL HVEDCL  M+
Sbjct  219  EDINEIPKPRMFWPREIWGKYVDKLEDLKNEEKSTKAVQCLNEMVTNALIHVEDCLKSMA  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IF+ CAIPQI+A+GTLA+CYNN+ VFRG VK+RRGL AKVIDRT+TM DVYG F
Sbjct  279  GLRDPAIFKSCAIPQIVAMGTLALCYNNVQVFRGAVKLRRGLIAKVIDRTKTMGDVYGAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD NDP A KTL+RLE I K CR++G L+KRKSY+
Sbjct  339  YDFSCMLKTKVDKNDPNAMKTLQRLETIEKVCRENGDLHKRKSYV  383



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+LK EE S  AVQCLN+MVT+AL HVEDCL  M+
Sbjct  219  EDINEIPKPRMFWPREIWGKYVDKLEDLKNEEKSTKAVQCLNEMVTNALIHVEDCLKSMA  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IF+ CAIPQI+A+GTLA+CYNN+ VFRG VK+RRGL AKVIDRT+TM+DVYG F
Sbjct  279  GLRDPAIFKSCAIPQIVAMGTLALCYNNVQVFRGAVKLRRGLIAKVIDRTKTMDDVYGAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCMLK+KVD  DP A KTL+RLE I K CR++G L+KRKSY+
Sbjct  339  YDFSCMLKTKVDKKDPNAMKTLQRLETIEKVCRENGDLHKRKSYV  383



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+L+YEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYASKLEDLQYEENSTKAVQCLNDMVTNALVHAEDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFC IPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG F
Sbjct  276  ALKDLAIFRFCVIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  284
            F+FS +LKSK+D NDP AS T  R+E I K C  SG LNKR  ++  ++
Sbjct  336  FEFSSLLKSKIDDNDPNASLTRHRVEAIHKACISSGLLNKRGRHMYESK  384



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   263 bits (673),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+LKYEENS  AVQCLNDMVT+AL H EDCL Y+ 
Sbjct  216  EDINEIPKSRMFWPREIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLQYLF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IF+FCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG F
Sbjct  276  ALKDLAIFQFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            F+FS +LKSK+D NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  336  FEFSSLLKSKIDDNDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  387



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+LKYEENS  AVQCLNDMVT+AL H EDCL Y+ 
Sbjct  216  EDINEIPKSRMFWPREIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLQYLF  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IF+FCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG F
Sbjct  276  ALKDLAIFQFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            F+FS +LKSK+D NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  336  FEFSSLLKSKIDDNDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  387



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIW+KY +KLE+ KYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWNKYADKLEDFKYEENSEKAVQCLNDMVTNALDHAEDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQ+MAIGTLA+CYNN+ VFRGVVKMRRGLTAKVID+TRTM DVYG F
Sbjct  276  ALKDIAIFRFCAIPQVMAIGTLALCYNNVKVFRGVVKMRRGLTAKVIDQTRTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            F+FS ++K+KV+  DP A+ TLKR+E I K+C  SG L+KR   + +++  +
Sbjct  336  FEFSSLMKTKVNDLDPNAALTLKRIEAIQKSCISSGNLDKRGCSLYKSQTQH  387



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+ K EENS  AVQCLN+MVT+AL HVEDCL  ++
Sbjct  218  EDINEIPKSRMFWPREIWGKYVDKLEDFKKEENSTKAVQCLNEMVTNALIHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTLA+CYNN+ VF GVV++RRGL AK+IDRT+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLALCYNNVQVFGGVVRLRRGLIAKIIDRTKTMDDVYGVF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML+SKVD NDP A KTL RLE I K CR++G L+KRK+Y+
Sbjct  338  YDFSCMLQSKVDKNDPNAMKTLNRLETIKKVCRENGVLHKRKTYV  382



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE PK RMFWPR+IW KYV+KLE+ K EE +  AVQCLN+MVT+AL+HVEDCL  ++
Sbjct  218  EDINERPKSRMFWPREIWGKYVDKLEDFKNEEKATKAVQCLNEMVTNALNHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTL +CYNN+ VFRGVV+MRRGL AKVIDRT+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLTLCYNNVQVFRGVVRMRRGLIAKVIDRTKTMDDVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML++KVD+NDP A KTL RLE I K CR++G L+KRKSY+
Sbjct  338  YDFSCMLQTKVDNNDPNAMKTLNRLETIKKVCRENGVLHKRKSYV  382



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWP +IWSKY +KLE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPWEIWSKYASKLEDLKYEENSTKAVQCLNDMVTNALMHAEDCLHYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG F
Sbjct  276  ALKDLAIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAE  284
            F+FS +L+SK+D NDP AS T  R+E I K C  SG LNKR  ++  ++
Sbjct  336  FEFSSLLESKIDDNDPNASLTRHRVEAIHKACISSGFLNKRGRHMYESK  384



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+ K EEN+  AVQCLN+MVT+AL HVEDCL  ++
Sbjct  218  EDINEIPKSRMFWPREIWGKYVDKLEDFKNEENATKAVQCLNEMVTNALIHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AK+IDRT+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKIIDRTKTMDDVYGVF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
             DFSCML+SKVD NDP A  TL RLE I K CRD+G L+KRK+Y+
Sbjct  338  CDFSCMLQSKVDKNDPNAVITLNRLETIKKVCRDNGVLHKRKTYV  382



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE L+YEENS  AV+CLN+MVT+AL HVEDCL  ++
Sbjct  218  EDINEIPKSRMFWPREIWGKYVDKLEVLQYEENSTKAVKCLNEMVTNALIHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTLA+CYNNI VFRGVV++RRGL AK+IDRT+ M+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLALCYNNIQVFRGVVRLRRGLIAKIIDRTKNMDDVYGLF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML+SKVD +DP A KTL RLE I K  RD+G L+KRK+Y+
Sbjct  338  YDFSCMLQSKVDKSDPDAMKTLNRLETIKKVSRDNGVLHKRKTYV  382



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY NKLE+ KYEENS NA+ CLNDMVT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYANKLEDFKYEENSTNALHCLNDMVTNALMHAEDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL++ SIFRFCAIPQIMAIGTLA+CYNN  +FRGVVKMRRGL A+VID+T+TM D YG F
Sbjct  276  ALKNLSIFRFCAIPQIMAIGTLALCYNNQELFRGVVKMRRGLVARVIDQTKTMSDTYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            ++FS +LKSK+D  DP A+ T +R+E I K+C  SG LNKR+  +  ++P Y
Sbjct  336  YEFSSLLKSKIDKKDPNATLTWERIEAIQKSCISSGLLNKRRCRMYESKPAY  387



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+LK EE S  AVQCLN+MVT+AL+HVEDCL  ++
Sbjct  218  EDINEIPKSRMFWPREIWGKYVDKLEDLKNEEKSTQAVQCLNEMVTNALTHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTL +CYNN+ VFRG V++RRGL AKVID T+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLTLCYNNVQVFRGAVRLRRGLIAKVIDLTKTMDDVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML++KVD NDP A KTL RLE I K C+++G ++KRKSY+
Sbjct  338  YDFSCMLQTKVDKNDPNAMKTLNRLETIKKVCKENGVIHKRKSYV  382



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE PK RMFWPR+IW KYV+KLE+ K EE +  AVQCLN+MVT+AL+HVEDCL  ++
Sbjct  218  EDINERPKSRMFWPREIWGKYVDKLEDFKNEEKATKAVQCLNEMVTNALNHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AKVIDRT+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKVIDRTKTMDDVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML++KVD+NDP A KTL RLE I K C+++G L+KRKSY+
Sbjct  338  YDFSCMLQTKVDNNDPNAMKTLNRLETIKKFCKENGGLHKRKSYV  382



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWP QIWSKY NKLE+ KY ENS  AVQCLND+VT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPHQIWSKYANKLEDFKYVENSTKAVQCLNDLVTNALIHAEDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+D SIFRF AIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAKVID+T +M DVYG F
Sbjct  276  GLKDLSIFRFAAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKVIDQTYSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            ++FS +LKSK+D+NDP AS T +R++ I KTC  SG L+KR  ++  ++ +Y 
Sbjct  336  YEFSSLLKSKIDNNDPNASLTHQRVDAIQKTCISSGLLSKRSLHVYESKFHYV  388



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR IWSKYV+KLE+LKY+ENS  AVQCLNDMVT+AL H +DCL Y+S
Sbjct  216  EDINEIPKSRMFWPRAIWSKYVDKLEDLKYKENSTQAVQCLNDMVTNALLHAQDCLKYLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+D S FRFCAIPQIMA+GTLA+CYNN+ +FRGVVKMRRG+ A+V+D+TRTM DVYG F
Sbjct  276  DLKDLSNFRFCAIPQIMAMGTLALCYNNVEIFRGVVKMRRGVVARVMDQTRTMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            F+FS +LKSK+D+NDP AS T  R+E I  +C  SG LNKR  ++ R+ P Y
Sbjct  336  FEFSSLLKSKIDNNDPNASLTRMRIEAIQNSCVKSGMLNKRGCHMYRSSPAY  387



>dbj|BAJ99680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H  DCL YMS
Sbjct  70   EDINEIPKCRMFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAHDCLQYMS  129

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D S FRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T+++ DVY  F
Sbjct  130  ALKDNSNFRFCAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARIIDETKSISDVYSAF  189

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            ++FS +L+SK+D NDP A+ T KR++ I KTC+ SG L KR+ Y L       P LI++ 
Sbjct  190  YEFSSLLESKIDDNDPNAALTRKRVDAIKKTCKSSGLL-KRRGYDLEKSKYRMPMLIMIV  248

Query  250  fiilailLGYLSG  212
             ++ AI+LG L G
Sbjct  249  LLLAAIILGVLYG  261



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR++W KYV+KLE+LK EENS  AVQCLN+MVT+AL HVEDCL  ++
Sbjct  219  EDINEIPKPRMFWPREMWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEDCLKCLA  278

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LR+P I   CAIPQI+AIGTLA+CYNN+ VFRGVVK+RRGL AKVIDRT+TM+DVYG F
Sbjct  279  SLRNPEILLSCAIPQIVAIGTLALCYNNVQVFRGVVKLRRGLIAKVIDRTKTMDDVYGAF  338

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML++KVD NDP A KTL RLE I K CR++G  +KRKSY+
Sbjct  339  YDFSCMLQTKVDKNDPNAMKTLNRLETIKKVCRENGAFHKRKSYV  383



>gb|EAY92248.1| hypothetical protein OsI_13969 [Oryza sativa Indica Group]
Length=397

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMS
Sbjct  206  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMS  265

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F
Sbjct  266  ALKDHAIFRFCAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAF  325

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL  293
            ++FS +++SK+D+NDP AS T KR++ I +TC+ S +L KR+ Y L
Sbjct  326  YEFSSLIESKIDNNDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDL  370



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMS
Sbjct  212  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F
Sbjct  272  ALKDHAIFRFCAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL  293
            ++FS +++SK+D+NDP AS T KR++ I +TC+ S +L KR+ Y L
Sbjct  332  YEFSSLIESKIDNNDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDL  376



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+ALSH EDCL YMS
Sbjct  222  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSEKAVQCLNDMVTNALSHAEDCLQYMS  281

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T TM DVY  F
Sbjct  282  ALKDHAIFRFCAIPQIMAIGTCAICYNNVNVFRGVVKMRRGLTARVIDETNTMSDVYTAF  341

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYIL  293
            ++FS +++SK+D+NDP AS T KR++ I +TC+ S +L KR+ Y L
Sbjct  342  YEFSSLIESKIDNNDPNASLTRKRVDAIKRTCKSSCSL-KRRGYDL  386



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PK RMFWPR+IWSKY +KLE+LKYEE+S  AV+CLNDMVTDAL H EDCL YMS
Sbjct  216  EDINEVPKSRMFWPREIWSKYADKLEDLKYEESSDKAVECLNDMVTDALRHAEDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+D SIFRFCAIPQIMAIGTLA+C+NNI VF+GVVKMRRGL AK+ID+T+TM DVY  F
Sbjct  276  DLQDISIFRFCAIPQIMAIGTLALCFNNIEVFQGVVKMRRGLAAKIIDQTKTMTDVYNAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRK  305
            + FS +LKSK+++ DP AS TLKRL++I K C DSG L+KR+
Sbjct  336  YGFSHLLKSKINYKDPNASLTLKRLDVIQKVCLDSGLLDKRQ  377



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H  DCL YMS
Sbjct  212  EDINEIPKCRMFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAHDCLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D S FRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T+++ DVY  F
Sbjct  272  ALKDNSNFRFCAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARIIDETKSISDVYSAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            ++FS +L+SK+D NDP A+ T KR++ I KTC+ SG L KR+ Y L       P LI++ 
Sbjct  332  YEFSSLLESKIDDNDPNAALTRKRVDAIKKTCKSSGLL-KRRGYDLEKSKYRMPMLIMIV  390

Query  250  fiilailLGYLSG  212
             ++ AI+LG L G
Sbjct  391  LLLAAIILGVLYG  403



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 141/165 (85%), Gaps = 3/165 (2%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+ K EENS  AVQCLN+MVT+AL HVEDCL  ++
Sbjct  218  EDINEIPKSRMFWPREIWGKYVDKLEDFKKEENSTKAVQCLNEMVTNALIHVEDCLKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTLA+CYNN+ VF GVV++RR   AK+IDRT+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLALCYNNVQVFGGVVRLRR---AKIIDRTKTMDDVYGVF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML+SKVD NDP A KTL RLE I K CR++G L+KRK+Y+
Sbjct  335  YDFSCMLQSKVDKNDPNAMKTLNRLETIKKVCRENGVLHKRKTYV  379



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDI+EIP+ RMFWPR+IW KYV+KLE+LK EENS  AVQCLN+MVT+AL HVED L  ++
Sbjct  218  EDISEIPQSRMFWPREIWGKYVDKLEDLKNEENSTKAVQCLNEMVTNALIHVEDSLKTIA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LR+P+IF+ CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AKV DRT+TM+DVYG F
Sbjct  278  SLRNPAIFQSCAIPQIVAIGTLALCYNNVQVFRGVVRLRRGLIAKVYDRTKTMDDVYGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEP  281
            +DFSCMLK+KVD NDP A KTL RLE I + CR++G  +KR+   L   P
Sbjct  338  YDFSCMLKAKVDKNDPNAIKTLNRLETIKRVCRENGVFHKRQGSFLLLVP  387



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+CRMFWPR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H +DCL YMS
Sbjct  258  EDINEIPRCRMFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAQDCLQYMS  317

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D S FRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T+++ DVY  F
Sbjct  318  ALKDNSNFRFCAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARVIDETKSISDVYSAF  377

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTPaliivf  251
            ++FS +L+SK+D NDP A+ T +R++ I KTC+ SG L KR+ Y L       P LI++ 
Sbjct  378  YEFSSLLESKIDDNDPNAALTRRRVDAIKKTCKSSGLL-KRRGYDLEKSMYRMPMLIMIA  436

Query  250  fiilailLGYLSG  212
             +++AI+LG L G
Sbjct  437  LLLVAIILGVLYG  449



>gb|AFS28708.1| putative squalene synthase, partial [Olea europaea]
Length=171

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LKYEENSV AVQCLNDMVT+AL HVEDCL YMS
Sbjct  45   EDINEIPKSRMFWPRQIWSKYVNKLEDLKYEENSVKAVQCLNDMVTNALIHVEDCLKYMS  104

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAKVIDRT+TM DVYG F
Sbjct  105  ALRDPAIFRFCAIPQIMAIGTLALCYNNIQVFRGVVKMRRGLTAKVIDRTKTMSDVYGDF  164

Query  430  FDFSCML  410
            +DFS ML
Sbjct  165  YDFSRML  171



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 138/173 (80%), Gaps = 11/173 (6%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PKCRMFWPRQIWSKYVNKLE+ KYEENSV AVQCLN          EDCL YMS
Sbjct  216  EDINEVPKCRMFWPRQIWSKYVNKLEDFKYEENSVKAVQCLN----------EDCLVYMS  265

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDPSIF+FCAIP ++ +G L M YNN+ +F+GVV+MRRGL AK+ID+TRTM DVYG F
Sbjct  266  NLRDPSIFQFCAIPLVINMGNLMMYYNNVEIFKGVVEMRRGLCAKIIDQTRTMADVYGAF  325

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTL-NKRKSYILRAEPNY  275
            FDF C+++SKVD +DP A+ TLKRLE I K CR+SGTL N+RKSY    +PNY
Sbjct  326  FDFCCIMESKVDRDDPNATSTLKRLEEISKNCRNSGTLINQRKSYTFSHQPNY  378



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYV+KLE+LKYEENSV AVQCLNDMVT+AL HV+DCL YMS
Sbjct  174  EDINEIPKSRMFWPRQIWSKYVSKLEDLKYEENSVKAVQCLNDMVTNALIHVDDCLKYMS  233

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTLA+CY+NI VFRGVVKMRRGLTAKVIDRT TM DVYG F
Sbjct  234  ALRDPAIFRFCAIPQIMAIGTLALCYDNIEVFRGVVKMRRGLTAKVIDRTNTMADVYGAF  293

Query  430  FDFSCMLKSK  401
            +DFSCMLK++
Sbjct  294  YDFSCMLKAR  303



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+ KYEENS  AVQCLN+MVTDAL H E+CL YMS
Sbjct  212  EDINEIPKSRMFWPREIWSKYADKLEDFKYEENSKKAVQCLNNMVTDALIHAEECLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+DP+IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F
Sbjct  272  ALKDPAIFRFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMTDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +++SK+D +DP A+ T +R++ I +TC+ SG L K++ Y L   P Y P
Sbjct  332  YEFSSLIESKIDDSDPNAALTQRRVDSIKQTCKSSG-LVKQRGYHLEKSP-YRP  383



>ref|XP_004981370.1| PREDICTED: squalene synthase-like [Setaria italica]
Length=289

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+ RMFWPR IWSKY +KLE+ KYEENS   VQCLNDMVT+AL H EDCL YMS
Sbjct  98   EDINEIPRSRMFWPRDIWSKYADKLEDFKYEENSEKGVQCLNDMVTNALIHAEDCLQYMS  157

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGT A CYNN+ VFRGVVKMRRGLTA+VI  T +M DVY  F
Sbjct  158  ALKDHTIFRFCAIPQIMAIGTCAFCYNNVNVFRGVVKMRRGLTARVIYETDSMSDVYTAF  217

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +L+SK+D NDP A+ T KR++ I +TC+ SG L KR+ Y L   P Y P
Sbjct  218  YEFSLLLESKIDDNDPNAALTRKRVDSIKQTCKSSGLL-KRRGYHLDKSP-YKP  269



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE+PK R FWP QIW+KY NKLE+LKYEENSV AVQCLNDMVT+AL H EDCL Y+S
Sbjct  216  EDINEMPKSRTFWPWQIWNKYANKLEDLKYEENSVKAVQCLNDMVTNALVHAEDCLKYLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             L+  SIFRFCAIPQIMAIGTLA+CY N  VFRGVVKMRRGLTA++ D+TR+M DVYG F
Sbjct  276  NLKTHSIFRFCAIPQIMAIGTLALCYGNEEVFRGVVKMRRGLTARISDQTRSMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            +DFS +L++K+D  DP A  T KR++ I K C  +G LNKR  Y++R    Y+
Sbjct  336  YDFSSLLETKIDEKDPNAILTRKRVDAIKKACVSTGLLNKRGLYVVRKRAMYS  388



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY NKLE+ KYEENS  AVQCLND+VT+AL H EDCL YMS
Sbjct  212  EDINEIPKSRMFWPREIWSKYANKLEDFKYEENSEKAVQCLNDLVTNALYHAEDCLKYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T +M DVY  F
Sbjct  272  ALKDHAIFRFCAIPQIMAIGTCAVCYNNVNVFRGVVKMRRGLTARVIDETNSMSDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYT  272
            ++FS +++SK+D+NDP AS T KR++ I +TC  S +L +R   + +++ N T
Sbjct  332  YEFSSLIESKIDNNDPNASLTRKRVDAIKRTCMSSCSLKRRGYDLEKSKYNTT  384



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDI+EIPK RMFWPR+IWSKYV KLE+LKY+ENS  AVQCLNDMVT+AL H +DCL YMS
Sbjct  212  EDISEIPKRRMFWPREIWSKYVEKLEDLKYKENSEKAVQCLNDMVTNALIHAKDCLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D ++FR CAIPQIMA+G  A+CYNN+ VFRG+VKMR GLTA+VID T++M DVY  F
Sbjct  272  ALKDDTVFRLCAIPQIMAMGNFAICYNNVNVFRGLVKMRHGLTARVIDETKSMSDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +L+SK+D NDP+A+ T KR++ I KTC+ SG L KR+ Y L  +P Y P
Sbjct  332  YEFSSLLESKIDDNDPSAALTRKRVDAIKKTCKSSGLL-KRRGYDLE-KPKYMP  383



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKY +KLE  K   NS  AV+CLND+VT+AL H EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYADKLEGFKNAGNSTKAVECLNDLVTNALIHAEDCLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +IFRFCAIPQIMAIGTLA+CYNN+ VFRGVVKMRRGLTAK+ID+T +M DVYG F
Sbjct  276  ALKDLAIFRFCAIPQIMAIGTLALCYNNVEVFRGVVKMRRGLTAKIIDQTNSMSDVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            ++FS +LKSK+D NDP A  T K +E I K C  SG L+ R
Sbjct  336  YEFSSLLKSKIDDNDPNAKLTRKHVEAIQKACGSSGLLDTR  376



>gb|ACN33457.1| unknown [Zea mays]
Length=275

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 139/174 (80%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMS
Sbjct  98   EDINEIPKSRMFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMS  157

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL++ +IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F
Sbjct  158  ALKNHAIFRFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAF  217

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +++SK+D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  218  YEFSSLIESKIDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  269



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYVNKLE+LKYEENSV AVQCLN+MVT++L HV+DCL YMS
Sbjct  216  EDINEIPKSRMFWPREIWSKYVNKLEDLKYEENSVEAVQCLNEMVTNSLIHVDDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL +P+IFRFCAIPQ+MAIGTLAMCYNNI VFRGVVKMRRGLTA+VI RT+TM DVYG F
Sbjct  276  ALPEPAIFRFCAIPQVMAIGTLAMCYNNINVFRGVVKMRRGLTAQVIHRTKTMADVYGAF  335

Query  430  FDFSCMLKSKV  398
            FDFSCMLKSKV
Sbjct  336  FDFSCMLKSKV  346



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPRQIWSKYVNKLE+LK+EENSV AVQCLNDMVT+AL H+EDCL YMS
Sbjct  216  EDINEIPKSRMFWPRQIWSKYVNKLEDLKHEENSVKAVQCLNDMVTNALIHIEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRGLTAK+IDRT+TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKIIDRTKTMSDVYGAF  335

Query  430  FDFSCMLKSKV  398
            +DFS MLK KV
Sbjct  336  YDFSRMLKYKV  346



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+CRMFWPR+IWSKY ++LE+LKYEENS  AVQCLNDMVT+AL H EDCL YMS
Sbjct  212  EDINEIPRCRMFWPREIWSKYADELEDLKYEENSERAVQCLNDMVTNALIHAEDCLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D + FRFCAIPQIMAIGT A CYNN+ VFR VVKMRRGLTA+++D T++M DVY  F
Sbjct  272  ALKDNANFRFCAIPQIMAIGTCAQCYNNVQVFRRVVKMRRGLTARIMDETKSMSDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +L+SK+D NDP+A+ T +R++ I K CR SG L KR+ Y L+ +  Y P
Sbjct  332  YEFSSLLESKIDDNDPSAAITRERVDAIKKRCRSSGLL-KRRGYDLQ-KSQYRP  383



>tpg|DAA52015.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=261

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMS
Sbjct  70   EDINEIPKSRMFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMS  129

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL++ +IF FCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F
Sbjct  130  ALKNHAIFHFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAF  189

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +++SK+D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  190  YEFSSLIESKIDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  241



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR IW KY +KLE+ K EENS  AV+CLND++T+ALSH  DCLTYM+
Sbjct  217  EDINEIPKPRMFWPRDIWGKYASKLEDFKEEENSEAAVECLNDLITNALSHALDCLTYMA  276

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D ++FRFCAIPQIMAIGTLA+CYNN+ VFRGVVK+RRGLTAK++D+T TM DVYG F
Sbjct  277  ALKDHAVFRFCAIPQIMAIGTLAVCYNNVHVFRGVVKIRRGLTAKIMDQTHTMADVYGAF  336

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  299
            +DF  ML  K++  DP++ +TL  +E I   CR SGTL+KR+ +
Sbjct  337  YDFCSMLSVKINKKDPSSQRTLNCVEAIQHACRSSGTLSKRRVF  380



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 140/174 (80%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+ RMFWPR+IWSKY +KLE+ KYEENS  AVQCLND+VT+AL H E+CL YMS
Sbjct  212  EDINEIPRSRMFWPREIWSKYADKLEDFKYEENSEKAVQCLNDLVTNALIHAEECLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+  +IFRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F
Sbjct  272  ALKGHAIFRFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMADVYTSF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +++SK+D NDP A+ T +R++ I +TC+ SG L KR+ Y L   P Y P
Sbjct  332  YEFSSLIESKIDDNDPNAALTRRRVDSIKQTCKSSG-LVKRRGYHLDKSP-YRP  383



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            ED+NEIPK RMFWPR+IW KYV+KLE+LK E+ S  AVQCLNDM+T+AL HVEDCL  M+
Sbjct  218  EDVNEIPKPRMFWPREIWGKYVDKLEDLKDEDKSTKAVQCLNDMITNALIHVEDCLKSMA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+I   C+IP I+AIGTLA+CYNNI VFRG +K+RRGL AKV DRT+TM+DV G F
Sbjct  278  ALRDPAILHSCSIPLIVAIGTLALCYNNIQVFRGSLKLRRGLIAKVFDRTKTMDDVCGAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRD-SGTLNKRKSYI  296
            +DFSCML++KVD  DP A KTL RLE I K CR+  G +++RKSY+
Sbjct  338  YDFSCMLETKVDKKDPNAMKTLNRLETIKKVCREYGGDIHQRKSYV  383



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 139/174 (80%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMS
Sbjct  212  EDINEIPKSRMFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL++ +IFRFCA+PQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F
Sbjct  272  ALKNHAIFRFCAVPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +++SK+D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  332  YEFSSLIESKIDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  383



>gb|EMS67019.1| Squalene synthase [Triticum urartu]
Length=384

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 138/178 (78%), Gaps = 17/178 (10%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP+CRMFWPR+IWSKYV+KLE+LKYEENS  AVQCLNDMVT+AL H +DCL YMS
Sbjct  175  EDINEIPRCRMFWPREIWSKYVDKLEDLKYEENSEKAVQCLNDMVTNALIHAQDCLQYMS  234

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D S FRFCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA+VID T+++ DVY  F
Sbjct  235  ALKDNSNFRFCAIPQIMAIGTCAICYNNVKVFRGVVKMRRGLTARVIDETKSISDVYSAF  294

Query  430  FDFSCMLKSK-----------------VDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            ++FS +L+SK                 +D NDP A+ T +R++ I KTC+ SG L +R
Sbjct  295  YEFSSLLESKLFSSCDFIHNMFGRHAQIDDNDPNAALTRRRVDAIKKTCKSSGLLKRR  352



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+ KYEEN+  AVQCLND+VT+AL H E+CL YMS
Sbjct  212  EDINEIPKSRMFWPREIWSKYADKLEDFKYEENTEKAVQCLNDIVTNALIHAEECLQYMS  271

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL++ +IF FCAIPQIMAIGT A+CYNN+ VFRGVVKMRRGLTA++ID T +M DVY  F
Sbjct  272  ALKNHAIFHFCAIPQIMAIGTCALCYNNVHVFRGVVKMRRGLTARIIDETNSMSDVYTAF  331

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
            ++FS +++SK+D NDP A+ T + +  I +TC+ SG L KR+ Y L   P Y P
Sbjct  332  YEFSSLIESKIDDNDPNAALTRRHVNSIKQTCKSSG-LVKRRGYHLDTSP-YRP  383



>ref|XP_006658375.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=363

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE PK RMFWPR+IWSKYV+KLE+LKYEENSVNAV+CLN+MVT+ L H EDCL YMS
Sbjct  171  EDINETPKSRMFWPREIWSKYVDKLEDLKYEENSVNAVKCLNEMVTNGLIHTEDCLRYMS  230

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +I RFCAIPQ+MA+ T A+CYNN+ VFRGVVKMRRGLTA++I+ T +M DVY  F
Sbjct  231  ALKDIAILRFCAIPQVMALATYALCYNNVNVFRGVVKMRRGLTARIINETNSMSDVYTAF  290

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            ++FS +L+ K+D NDP AS T K +  I ++C+ SG L KR
Sbjct  291  YEFSSLLEEKIDENDPNASLTWKYVNAIKESCKSSGMLKKR  331



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP  RMFWPR+IW+KYV++LE+LK EE S  AVQCLN+MVT+AL H  DCL Y+S
Sbjct  216  EDINEIPAPRMFWPREIWAKYVSRLEDLKEEERSKEAVQCLNEMVTNALKHANDCLKYLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRDP+IFRFCAIPQIMAIGTL  CYNNI VF+GVVK+RRGLTAK+++RT TM DVYG F
Sbjct  276  ALRDPAIFRFCAIPQIMAIGTLERCYNNIEVFKGVVKIRRGLTAKIMERTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  299
            FDFS  L SKV  +DP A +TL  ++ I +TC+ SG L +R+++
Sbjct  336  FDFSRSLASKVPKDDPNARETLNCIDDIQRTCKASGLLARRRTF  379



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP  RMFWPR+IW+KYV+KLE+LK EE S  AVQCLN+MVT+AL H  DCL Y+S
Sbjct  216  EDINEIPAPRMFWPREIWAKYVSKLEDLKEEEWSKEAVQCLNEMVTNALKHANDCLKYLS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP+IFRFCAIPQIMAIGTL  CYNNI VFRGVVK+RRGLTAK+++RT TM DVYG F
Sbjct  276  DLRDPAIFRFCAIPQIMAIGTLERCYNNIEVFRGVVKIRRGLTAKIMERTNTMADVYGAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  299
            FDFS  L SKV  +DP A +TL  ++ I +TC+ SG L +R ++
Sbjct  336  FDFSRSLASKVPEDDPNAKETLNCIDEIQRTCKASGLLARRTTF  379



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYV+KLE+LKYE NSV AV+CLN+MVT+ L H EDCL YMS
Sbjct  218  EDINEIPKSRMFWPREIWSKYVDKLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMS  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +I RFCAIPQ+MA+ T A+CYNN+ VFRGVVK+RRGLTA++I+ T +M DVY  F
Sbjct  278  ALKDITILRFCAIPQVMALATYALCYNNVNVFRGVVKLRRGLTARIINETNSMADVYTAF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            ++FS +L  K+D NDP AS T KR+  I +TC+ SG L  R
Sbjct  338  YEFSSLLAEKIDDNDPNASLTRKRVNAIKETCKSSGLLKIR  378



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IW KYV+KLE+ K EE S  AVQCLN+MVT+AL HVEDC+  ++
Sbjct  218  EDINEIPKSRMFWPREIWGKYVDKLEDFKNEETSTKAVQCLNEMVTNALIHVEDCMKSLA  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            +LRDP+IF+ CAIPQI+AIGTLA+CYNN+ VFRGVV++RRGL AKVIDRT+TM+DVYG F
Sbjct  278  SLRDPAIFQSCAIPQIVAIGTLALCYNNVQVFRGVVRVRRGLIAKVIDRTKTMDDVYGVF  337

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            +DFSCML++KVD ND  A KT  RLE I K CR++G L KRKSY+
Sbjct  338  YDFSCMLQTKVDKNDANAMKTFNRLETIKKVCRENGVLEKRKSYV  382



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWP +IWSKYV  LE+LK EE S  AVQCLN+M+T+AL H  DCL YM+
Sbjct  216  EDINEIPKSRMFWPHEIWSKYVPNLEDLKEEECSKEAVQCLNEMITNALKHANDCLKYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL++P+IFRFCAIPQIMA+ TL +CYNN+ VFR VVK+RRGLTAK++DRT++M DVY  F
Sbjct  276  ALKNPAIFRFCAIPQIMALATLEICYNNLQVFRRVVKIRRGLTAKIMDRTKSMADVYEAF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            FDFS  L SKV  +DP A+ TLK ++ I +TC  SG + KR+S+ + ++  +
Sbjct  336  FDFSGSLASKVPKDDPNATVTLKYIDEIQRTCNASGLMAKRRSFTIDSKKGH  387



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -1

Query  718  LEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSALRDPSIFRFCAIPQIMAIGTLAM  539
            L++L+YEENS  AVQCLNDMVT+AL H EDCL YMSAL+D +IFRFC IPQIMAIGTLA+
Sbjct  205  LQDLQYEENSTKAVQCLNDMVTNALVHAEDCLQYMSALKDLAIFRFCVIPQIMAIGTLAL  264

Query  538  CYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFDFSCMLKSKVDHNDPTASKTLKR  359
            CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG FF+FS +LKSK+D NDP AS T  R
Sbjct  265  CYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAFFEFSSLLKSKIDDNDPNASLTRHR  324

Query  358  LEIILKTCRDSGTLNKRKSYILRAE  284
            +E I K C  SG LNKR  ++  ++
Sbjct  325  VEAIHKACISSGLLNKRGRHMYESK  349



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINE P  RMFWP +IW KY  +L + K E+ S  ++ CLNDM+T+AL H  D L YMS
Sbjct  216  EDINEEPAPRMFWPHEIWGKYSARLADFKEEKKSDVSLACLNDMITNALEHAIDSLQYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            ALRD +IFRFCAIPQIMAI TLA CYNNI VFRGVVK+RRGL AK++  T +M+DVY  F
Sbjct  276  ALRDGAIFRFCAIPQIMAIATLAACYNNIQVFRGVVKIRRGLAAKIVLETSSMKDVYSTF  335

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSY  299
            +DFS ML +K+D  DP++S T+K +E IL TCR SG  + R  +
Sbjct  336  YDFSNMLTAKIDKQDPSSSTTMKHVENILSTCRASGIPHNRSLF  379



>ref|XP_009138586.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=270

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            ED+NEIPK RMFWPR+ W KYV+KLE+LK E+ S  AVQCLNDM+T+AL HVEDCL  M+
Sbjct  127  EDVNEIPKPRMFWPRETWGKYVDKLEDLKDEDKSTKAVQCLNDMITNALIHVEDCLKSMA  186

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL DP+I + C+IP I+AIGTLA+CYNN+ VFRG +K+RRGL AKV DRT+TM+DV G F
Sbjct  187  ALHDPAILQSCSIPLIVAIGTLALCYNNVQVFRGSLKLRRGLIAKVFDRTKTMDDVCGAF  246

Query  430  FDFSCMLKSKV  398
            +DFSCML++KV
Sbjct  247  YDFSCMLETKV  257



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 2/165 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIP  RMFWP ++W KY  KLE+ K+E+NS NA++CLN ++T+AL+H  DCL YM 
Sbjct  216  EDINEIPAPRMFWPHEVWGKYATKLEDFKHEDNSQNALRCLNALITNALAHATDCLKYME  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             +      RFCAIPQIMAI TLA CYNNI VFRGVVK+RRG+TAK++ +TRTM DVYG F
Sbjct  276  DINQEDNLRFCAIPQIMAIATLAECYNNINVFRGVVKIRRGITAKIM-QTRTMGDVYGTF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYI  296
            FDFS  + +K+D ND +AS T K +E I + C +S  L   KSYI
Sbjct  335  FDFSKKIAAKIDDNDDSASVTRKHIEDIQEYC-ESHLLEPEKSYI  378



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 115/172 (67%), Gaps = 31/172 (18%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKY +KLE+LKYEENS  AVQCLNDM                
Sbjct  216  EDINEIPKSRMFWPREIWSKYASKLEDLKYEENSTKAVQCLNDM----------------  259

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
                           IMAIGTLA+CYNN+ VFRGVVKMRRGLTA+VID+TR+M DVYG F
Sbjct  260  ---------------IMAIGTLALCYNNVEVFRGVVKMRRGLTARVIDQTRSMSDVYGAF  304

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNY  275
            F+FS +LKSK+D NDP AS T  R+E I K C  SG LNKR  ++  +   Y
Sbjct  305  FEFSSLLKSKIDDNDPNASLTRHRVEAIQKACISSGLLNKRGYHMYESRLQY  356



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPKCRMFWPR+IWSKYVNKLE+LKYEENS  AVQCLNDMVT+AL HVEDCL YMS
Sbjct  216  EDINEIPKCRMFWPREIWSKYVNKLEDLKYEENSDKAVQCLNDMVTNALMHVEDCLKYMS  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGL  485
            ALRD +IFRFCAIPQIMAIGTLA+CYNNI VFRGVVKMRRG+
Sbjct  276  ALRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGM  317



>ref|XP_002971951.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
 gb|EFJ26868.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
Length=392

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYV--NKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTY  617
            EDINE+P  RMFWPR+IW KY   + L + + E N   AV+CLNDM+TD L H  +CL Y
Sbjct  230  EDINELPAPRMFWPREIWGKYAPTSLLSDFRDESNEKEAVECLNDMITDCLRHAPECLFY  289

Query  616  MSALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYG  437
            MS L++PS+FRFCA+PQ+MAI T A+CYNN  VFRGVVK+RRG TAK+I  T  M DV G
Sbjct  290  MSKLKNPSVFRFCAVPQVMAIATAAVCYNNPQVFRGVVKIRRGTTAKIIVTTNNMADVCG  349

Query  436  GFFDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
             F+DF+ +L SK++ NDP+A    +R+E I K CR  G  + R
Sbjct  350  AFYDFASILASKINKNDPSALIAAERVENIFKACRQYGLSSSR  392



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = -1

Query  784  INEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMSAL  605
            I EIP  RMFWP +IW K+  +LE+ K EENS NAV+CLN M+T+AL+H  DCL Y+ A 
Sbjct  165  ICEIPAPRMFWPHEIWGKFGTRLEDFKLEENSENAVRCLNAMITNALTHATDCLKYIEAN  224

Query  604  RDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGFFD  425
            +D S  RFCAIPQIMAIGTLA CYNNI VFRGVVK+RRG+TAKV+ +T+T+ DVYG FFD
Sbjct  225  KDESNLRFCAIPQIMAIGTLAECYNNINVFRGVVKIRRGITAKVM-QTKTISDVYGTFFD  283

Query  424  FSCMLKSKVDHNDPTASKTLKRLEIILKTC  335
            FS  +  K+  ND +AS T K +E I + C
Sbjct  284  FSRKIAEKIGENDDSASATRKHIEDIQEYC  313



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 118/175 (67%), Gaps = 1/175 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDI E+P  RMFWPR +WSKY  +L+EL++EEN   AVQC+N+++T+ALSH  DCL YM 
Sbjct  218  EDIQELPAPRMFWPRSVWSKYAKELDELQHEENHEKAVQCMNELITNALSHTTDCLKYMG  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             +++PSIFRFCAIPQ+MAI TLA CY N+ VF+GVVK+RRGL+A+++     M +   GF
Sbjct  278  RIKEPSIFRFCAIPQVMAIATLAECYGNVNVFKGVVKIRRGLSARIMLNCNNMYEFAKGF  337

Query  430  FDFSCMLKSKVD-HNDPTASKTLKRLEIILKTCRDSGTLNKRKSYILRAEPNYTP  269
              F+  L  KVD  NDP   +T++R+E + + C         +  + R E +  P
Sbjct  338  KHFASELVHKVDPRNDPNGEETMQRIEALEEACDKIIAEESERMQLSRIEDDTIP  392



>gb|EEC81691.1| hypothetical protein OsI_25282 [Oryza sativa Indica Group]
Length=273

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 19/161 (12%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDINEIPK RMFWPR+IWSKYV+KLE+LKYE NSV AV+CLN+MVT+ L H EDCL YMS
Sbjct  100  EDINEIPKSRMFWPREIWSKYVDKLEDLKYENNSVKAVKCLNEMVTNGLIHTEDCLRYMS  159

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D +I RFCAIPQ     TL                  GLTA++I+ T +M DVY  F
Sbjct  160  ALKDITILRFCAIPQHSC--TLI-----------------GLTARIINETNSMADVYTAF  200

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCRDSGTLNKR  308
            ++FS +L  K+D NDP AS T KR+  I +TC+ SG L  R
Sbjct  201  YEFSSLLAEKIDDNDPNASLTRKRVNAIKETCKSSGLLKIR  241



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDI E+P  RMFWPR +WSKY  +L++L++EEN   AVQC+N+++T+ALSH  DCL YMS
Sbjct  218  EDIQELPAPRMFWPRSVWSKYAEELDDLQHEENREKAVQCMNELITNALSHSLDCLKYMS  277

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             +++ SIFRFCAIPQ+MAI TLA CY N  VF+GVVK+RRGL+A+++ +   M ++  GF
Sbjct  278  RVKEISIFRFCAIPQVMAIATLAECYGNENVFKGVVKIRRGLSARIMLKCNNMLELASGF  337

Query  430  FDFSCMLKSKVD-HNDPTASKTLKRLEIILKTC  335
              F+  L  KVD  +DP   +T+ R+E + + C
Sbjct  338  KHFANELVHKVDPKSDPNGEETMARIEALEEAC  370



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            E+IN  P  R+ WP+++WSKY +K E    E N    + CLN+MVTDALSH  DCL YM+
Sbjct  216  ENINAQPTSRLRWPKEVWSKYADKPEAFMDETNYKQGLHCLNEMVTDALSHGLDCLHYMA  275

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
            AL+D    RFCA  QI A+GTLAMCYNN+ VFRG V+MRRGLTAK++D  + M DVYG F
Sbjct  276  ALQDQPNLRFCATFQITALGTLAMCYNNVEVFRGSVRMRRGLTAKILD-VKNMVDVYGAF  334

Query  430  FDFSCMLKSKVDHNDPTASKTLKRLEIILKTCR  332
            +DF+ ++ +K+D  DP+A  T K ++ I   CR
Sbjct  335  YDFTRLIAAKIDKTDPSAVTTHKFVDDIRSICR  367



>gb|KIZ04121.1| farnesyl-diphosphatefarnesyltransferase [Monoraphidium neglectum]
Length=493

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 4/160 (3%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDI E P  RMFWPR++W +Y + L+E K   N   A+ CLND+VTDAL HV  C+ ++ 
Sbjct  227  EDITEEPAPRMFWPREVWGRYASSLDEFKDPANRTAAIHCLNDLVTDALRHVPHCVAFLQ  286

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             LRDP +FRFCAIPQIMA GTL++CYNN GVF G VK+RRG TA+V D  RTM DV+  F
Sbjct  287  QLRDPDVFRFCAIPQIMAAGTLSLCYNNGGVFEGAVKLRRGETARVFDELRTMADVHAWF  346

Query  430  FDFSCMLKSK---VDHNDPTASKTLKRLEIILKTCRDSGT  320
              +  +L+ K   V  +DPTA +    ++  LK   D G+
Sbjct  347  GRYLRLLRRKALSVASHDPTAKEARAAVDSCLKIV-DEGS  385



>ref|XP_007512409.1| squalene synthase [Bathycoccus prasinos]
 emb|CCO17009.1| squalene synthase [Bathycoccus prasinos]
Length=462

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -1

Query  790  EDINEIPKCRMFWPRQIWSKYVNKLEELKYEENSVNAVQCLNDMVTDALSHVEDCLTYMS  611
            EDI EIP+ RMFWPR +W KY   L++L+Y++N  NAV CLN+++T+AL+H  D L YMS
Sbjct  220  EDIQEIPRPRMFWPRVVWGKYATSLDDLQYKKNRTNAVHCLNELITNALTHACDSLEYMS  279

Query  610  ALRDPSIFRFCAIPQIMAIGTLAMCYNNIGVFRGVVKMRRGLTAKVIDRTRTMEDVYGGF  431
             ++ PSIFRFCAIPQ+MAI TLA CY+N  VF GVVK+RRGL+A+++  +     +  GF
Sbjct  280  RVKTPSIFRFCAIPQVMAIATLAECYDNGKVFEGVVKIRRGLSARIMLSSNDTYQIGQGF  339

Query  430  FDFSCMLKSKVDHNDPTASKTLK  362
              F  +LK+KV   DP   +T++
Sbjct  340  KHFVKILKNKVRKEDPNRKETMR  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570