BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022L17

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002519556.1|  conserved hypothetical protein                     172   3e-49   
ref|XP_009601139.1|  PREDICTED: uncharacterized protein LOC104096...    163   6e-45   Nicotiana tomentosiformis
ref|XP_009601138.1|  PREDICTED: uncharacterized protein LOC104096...    161   4e-44   Nicotiana tomentosiformis
ref|XP_009784159.1|  PREDICTED: uncharacterized protein LOC104232609    158   3e-43   Nicotiana sylvestris
ref|XP_007162732.1|  hypothetical protein PHAVU_001G175800g             157   2e-42   Phaseolus vulgaris [French bean]
gb|KDP29097.1|  hypothetical protein JCGZ_16486                         156   2e-42   Jatropha curcas
emb|CBI32707.3|  unnamed protein product                                155   5e-42   Vitis vinifera
ref|XP_011048575.1|  PREDICTED: uncharacterized protein LOC105142...    155   7e-42   Populus euphratica
ref|XP_011048574.1|  PREDICTED: uncharacterized protein LOC105142...    155   7e-42   Populus euphratica
ref|XP_006381475.1|  hypothetical protein POPTR_0006s13180g             155   8e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006577012.1|  PREDICTED: uncharacterized protein LOC102667501    154   1e-41   Glycine max [soybeans]
ref|XP_008369743.1|  PREDICTED: uncharacterized protein LOC103433275    155   1e-41   Malus domestica [apple tree]
emb|CDP06723.1|  unnamed protein product                                151   2e-40   Coffea canephora [robusta coffee]
gb|KHN02356.1|  hypothetical protein glysoja_002380                     150   5e-40   Glycine soja [wild soybean]
ref|XP_003553543.1|  PREDICTED: uncharacterized protein LOC100786645    149   7e-40   Glycine max [soybeans]
gb|KJB36628.1|  hypothetical protein B456_006G167900                    149   1e-39   Gossypium raimondii
ref|XP_009358150.1|  PREDICTED: uncharacterized protein LOC103948809    150   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_010653545.1|  PREDICTED: uncharacterized protein LOC100854914    148   1e-39   Vitis vinifera
ref|XP_004249495.1|  PREDICTED: uncharacterized protein LOC101249595    146   4e-39   Solanum lycopersicum
gb|KJB62488.1|  hypothetical protein B456_009G419000                    147   5e-39   Gossypium raimondii
ref|XP_008239371.1|  PREDICTED: uncharacterized protein LOC103337975    146   3e-38   Prunus mume [ume]
ref|XP_010253606.1|  PREDICTED: uncharacterized protein LOC104594811    145   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010264742.1|  PREDICTED: uncharacterized protein LOC104602661    144   9e-38   Nelumbo nucifera [Indian lotus]
gb|KHG27555.1|  hypothetical protein F383_14062                         144   9e-38   Gossypium arboreum [tree cotton]
ref|XP_007027287.1|  Uncharacterized protein TCM_022118                 145   1e-37   
gb|KHG19373.1|  rna exonuclease 3                                       144   2e-37   Gossypium arboreum [tree cotton]
ref|XP_011077361.1|  PREDICTED: uncharacterized protein LOC105161392    142   3e-37   Sesamum indicum [beniseed]
gb|KDO35922.1|  hypothetical protein CISIN_1g025682mg                   140   1e-36   Citrus sinensis [apfelsine]
ref|XP_006480639.1|  PREDICTED: uncharacterized protein LOC102612278    139   6e-36   Citrus sinensis [apfelsine]
ref|XP_010107564.1|  hypothetical protein L484_024420                   138   1e-35   Morus notabilis
ref|XP_004493960.1|  PREDICTED: uncharacterized protein LOC101490574    137   6e-35   Cicer arietinum [garbanzo]
ref|XP_010046753.1|  PREDICTED: uncharacterized protein LOC104435755    135   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008442668.1|  PREDICTED: late secretory pathway protein AV...    131   6e-33   Cucumis melo [Oriental melon]
ref|XP_007205680.1|  hypothetical protein PRUPE_ppa009620mg             129   8e-32   
ref|XP_006850606.1|  hypothetical protein AMTR_s00034p00131640          127   1e-31   
ref|XP_004137815.1|  PREDICTED: uncharacterized protein LOC101215662    125   7e-31   
ref|XP_004165143.1|  PREDICTED: uncharacterized LOC101215662            125   2e-30   
ref|XP_010696407.1|  PREDICTED: uncharacterized protein LOC104908935    122   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004304411.1|  PREDICTED: uncharacterized protein LOC101305283  99.8    4e-21   Fragaria vesca subsp. vesca
gb|ACU23192.1|  unknown                                               97.1    2e-20   Glycine max [soybeans]
gb|AFK41563.1|  unknown                                               96.7    2e-20   Lotus japonicus
ref|XP_010246440.1|  PREDICTED: uncharacterized protein LOC104589726  95.1    8e-20   Nelumbo nucifera [Indian lotus]
emb|CBI22018.3|  unnamed protein product                              92.0    2e-19   Vitis vinifera
ref|XP_011083310.1|  PREDICTED: uncharacterized protein LOC105165845  94.4    2e-19   Sesamum indicum [beniseed]
ref|XP_007159478.1|  hypothetical protein PHAVU_002G240700g           94.0    3e-19   Phaseolus vulgaris [French bean]
ref|XP_007044083.1|  Uncharacterized protein TCM_008922               94.0    3e-19   
ref|XP_003527334.1|  PREDICTED: uncharacterized protein LOC100800312  93.6    4e-19   
ref|XP_006830214.1|  hypothetical protein AMTR_s00130p00028330        92.4    2e-18   Amborella trichopoda
ref|XP_004487581.1|  PREDICTED: uncharacterized protein LOC101503885  91.7    2e-18   Cicer arietinum [garbanzo]
ref|NP_001241326.1|  uncharacterized protein LOC100807366             91.3    3e-18   Glycine max [soybeans]
ref|XP_008790021.1|  PREDICTED: uncharacterized protein LOC103707351  90.9    3e-18   Phoenix dactylifera
ref|NP_001241436.1|  uncharacterized protein LOC100811994             90.9    3e-18   Glycine max [soybeans]
ref|XP_010274414.1|  PREDICTED: uncharacterized protein LOC104609737  90.5    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010317344.1|  PREDICTED: uncharacterized protein LOC104646047  89.4    8e-18   Solanum lycopersicum
ref|XP_011082982.1|  PREDICTED: uncharacterized protein LOC105165613  89.7    8e-18   Sesamum indicum [beniseed]
gb|KJB57387.1|  hypothetical protein B456_009G161100                  89.7    9e-18   Gossypium raimondii
ref|XP_007149725.1|  hypothetical protein PHAVU_005G093900g           89.7    1e-17   Phaseolus vulgaris [French bean]
ref|XP_004504284.1|  PREDICTED: uncharacterized protein LOC101494080  89.4    1e-17   Cicer arietinum [garbanzo]
ref|XP_002277325.1|  PREDICTED: uncharacterized protein LOC100266042  89.4    1e-17   Vitis vinifera
ref|XP_009591668.1|  PREDICTED: uncharacterized protein LOC104088654  89.0    1e-17   Nicotiana tomentosiformis
ref|XP_002316812.1|  hypothetical protein POPTR_0011s07010g           89.0    1e-17   
ref|XP_003546042.1|  PREDICTED: uncharacterized protein LOC100782674  89.0    1e-17   Glycine max [soybeans]
ref|XP_010279224.1|  PREDICTED: uncharacterized protein LOC104613196  89.7    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009766224.1|  PREDICTED: uncharacterized protein LOC104217628  89.0    1e-17   Nicotiana sylvestris
ref|XP_002277345.1|  PREDICTED: uncharacterized protein LOC100260838  89.0    1e-17   Vitis vinifera
ref|XP_011098377.1|  PREDICTED: uncharacterized protein LOC105177052  88.2    2e-17   Sesamum indicum [beniseed]
ref|XP_010999777.1|  PREDICTED: uncharacterized protein LOC105107522  88.6    2e-17   Populus euphratica
gb|AFK40408.1|  unknown                                               87.4    2e-17   Medicago truncatula
ref|XP_010915479.1|  PREDICTED: programmed cell death protein 7-like  88.6    2e-17   Elaeis guineensis
ref|XP_002522240.1|  conserved hypothetical protein                   89.0    2e-17   
gb|KDP21126.1|  hypothetical protein JCGZ_21597                       88.2    3e-17   Jatropha curcas
ref|XP_009804439.1|  PREDICTED: uncharacterized protein LOC104249662  87.8    3e-17   Nicotiana sylvestris
gb|AFK43794.1|  unknown                                               88.2    3e-17   Lotus japonicus
ref|XP_008381194.1|  PREDICTED: uncharacterized protein LOC103444064  87.8    4e-17   
ref|XP_008439724.1|  PREDICTED: uncharacterized protein LOC103484438  87.0    4e-17   Cucumis melo [Oriental melon]
ref|XP_002305058.2|  hypothetical protein POPTR_0004s05860g           87.4    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008371722.1|  PREDICTED: uncharacterized protein LOC103435110  87.0    5e-17   
ref|XP_003629806.1|  hypothetical protein MTR_8g086820                87.4    6e-17   
ref|XP_009365283.1|  PREDICTED: uncharacterized protein LOC103955136  87.4    6e-17   
gb|AET04282.2|  DUF1685 family protein                                87.0    6e-17   Medicago truncatula
ref|XP_007216770.1|  hypothetical protein PRUPE_ppa024447mg           87.4    6e-17   Prunus persica
ref|XP_011039395.1|  PREDICTED: uncharacterized protein LOC105135974  87.0    6e-17   Populus euphratica
ref|XP_002269394.1|  PREDICTED: uncharacterized protein LOC100266883  86.7    8e-17   Vitis vinifera
ref|XP_011101455.1|  PREDICTED: uncharacterized protein LOC105179506  86.3    9e-17   Sesamum indicum [beniseed]
ref|XP_007132824.1|  hypothetical protein PHAVU_011G127600g           86.3    1e-16   Phaseolus vulgaris [French bean]
gb|KGN49319.1|  hypothetical protein Csa_6G519700                     85.9    1e-16   
ref|XP_004485927.1|  PREDICTED: uncharacterized protein LOC101512973  86.3    1e-16   Cicer arietinum [garbanzo]
ref|XP_010100736.1|  hypothetical protein L484_005803                 86.3    1e-16   Morus notabilis
ref|XP_008225325.1|  PREDICTED: uncharacterized protein LOC103324979  86.3    1e-16   Prunus mume [ume]
ref|XP_010059035.1|  PREDICTED: uncharacterized protein LOC104446943  86.3    2e-16   Eucalyptus grandis [rose gum]
ref|XP_008460386.1|  PREDICTED: uncharacterized protein LOC103499218  85.5    2e-16   Cucumis melo [Oriental melon]
ref|XP_007213349.1|  hypothetical protein PRUPE_ppa1027161mg          85.1    2e-16   Prunus persica
ref|XP_003524968.1|  PREDICTED: uncharacterized protein LOC100792716  85.5    2e-16   Glycine max [soybeans]
emb|CDO96846.1|  unnamed protein product                              85.1    3e-16   Coffea canephora [robusta coffee]
ref|XP_009353410.1|  PREDICTED: uncharacterized protein LOC103944673  84.7    3e-16   Pyrus x bretschneideri [bai li]
gb|KHN06416.1|  hypothetical protein glysoja_010760                   84.7    3e-16   Glycine soja [wild soybean]
gb|EYU37337.1|  hypothetical protein MIMGU_mgv11b016324mg             84.7    4e-16   Erythranthe guttata [common monkey flower]
gb|KGN61130.1|  hypothetical protein Csa_2G058630                     84.3    4e-16   
gb|EYU30763.1|  hypothetical protein MIMGU_mgv1a025120mg              83.6    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_010040033.1|  PREDICTED: uncharacterized protein LOC104428796  84.7    4e-16   Eucalyptus grandis [rose gum]
ref|XP_003596709.1|  hypothetical protein MTR_2g083910                85.1    4e-16   
ref|XP_009591632.1|  PREDICTED: uncharacterized protein LOC104088627  84.3    4e-16   Nicotiana tomentosiformis
ref|XP_010040036.1|  PREDICTED: uncharacterized protein LOC104428799  84.7    5e-16   
gb|AES66960.2|  DUF1685 family protein                                84.3    6e-16   Medicago truncatula
gb|KJB66849.1|  hypothetical protein B456_010G160700                  84.0    7e-16   Gossypium raimondii
ref|XP_011465206.1|  PREDICTED: uncharacterized protein LOC105351692  84.0    7e-16   Fragaria vesca subsp. vesca
ref|XP_003543003.1|  PREDICTED: uncharacterized protein LOC100781024  84.0    7e-16   
ref|XP_010925601.1|  PREDICTED: putative WAS protein family homol...  84.0    8e-16   Elaeis guineensis
gb|KEH36642.1|  DUF1685 family protein                                85.1    1e-15   Medicago truncatula
ref|XP_004294142.1|  PREDICTED: uncharacterized protein LOC101306310  84.3    1e-15   Fragaria vesca subsp. vesca
gb|KHN36708.1|  hypothetical protein glysoja_001439                   83.2    1e-15   Glycine soja [wild soybean]
ref|XP_011460623.1|  PREDICTED: uncharacterized protein LOC105350386  83.2    1e-15   Fragaria vesca subsp. vesca
ref|XP_010317343.1|  PREDICTED: uncharacterized protein LOC104646046  83.2    1e-15   Solanum lycopersicum
gb|KCW47364.1|  hypothetical protein EUGRSUZ_K01150                   82.0    2e-15   Eucalyptus grandis [rose gum]
ref|XP_004517128.1|  PREDICTED: uncharacterized protein LOC101512525  83.6    2e-15   Cicer arietinum [garbanzo]
gb|ACU23694.1|  unknown                                               82.8    2e-15   Glycine max [soybeans]
ref|XP_009352733.1|  PREDICTED: uncharacterized protein LOC103944066  82.4    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_010038705.1|  PREDICTED: uncharacterized protein LOC104427291  80.5    3e-15   Eucalyptus grandis [rose gum]
gb|KCW45543.1|  hypothetical protein EUGRSUZ_L00732                   82.0    3e-15   Eucalyptus grandis [rose gum]
gb|KHN48012.1|  hypothetical protein glysoja_015482                   82.0    3e-15   Glycine soja [wild soybean]
ref|XP_010040035.1|  PREDICTED: uncharacterized protein LOC104428798  82.0    3e-15   
ref|XP_003531264.1|  PREDICTED: uncharacterized protein LOC100814411  82.0    4e-15   Glycine max [soybeans]
ref|XP_009385553.1|  PREDICTED: uncharacterized protein LOC103972892  82.0    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH38854.1|  DUF1685 family protein                                81.6    5e-15   Medicago truncatula
ref|XP_008783125.1|  PREDICTED: uncharacterized protein LOC103702463  81.6    6e-15   
gb|AFK41310.1|  unknown                                               80.9    7e-15   Medicago truncatula
ref|XP_003607621.1|  hypothetical protein MTR_4g080340                80.9    7e-15   Medicago truncatula
ref|XP_006451767.1|  hypothetical protein CICLE_v10010201mg           82.0    8e-15   Citrus clementina [clementine]
ref|XP_008226466.1|  PREDICTED: uncharacterized protein LOC103326040  82.0    8e-15   Prunus mume [ume]
gb|KJB13283.1|  hypothetical protein B456_002G066500                  81.6    8e-15   Gossypium raimondii
ref|XP_008228946.1|  PREDICTED: uncharacterized protein LOC103328331  80.9    9e-15   Prunus mume [ume]
emb|CDP15956.1|  unnamed protein product                              80.5    1e-14   Coffea canephora [robusta coffee]
ref|XP_007213579.1|  hypothetical protein PRUPE_ppa014990mg           81.6    1e-14   Prunus persica
ref|XP_006591846.1|  PREDICTED: uncharacterized protein LOC100527...  81.3    1e-14   
ref|XP_008366054.1|  PREDICTED: uncharacterized protein LOC103429701  80.1    2e-14   
ref|XP_004303200.1|  PREDICTED: uncharacterized protein LOC101313135  80.1    2e-14   Fragaria vesca subsp. vesca
gb|KDO63416.1|  hypothetical protein CISIN_1g041944mg                 80.1    2e-14   Citrus sinensis [apfelsine]
ref|XP_006446825.1|  hypothetical protein CICLE_v10016386mg           80.1    2e-14   Citrus clementina [clementine]
ref|XP_010524072.1|  PREDICTED: uncharacterized protein LOC104802264  80.1    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_007025324.1|  Uncharacterized protein TCM_029658               79.7    2e-14   Theobroma cacao [chocolate]
ref|XP_010916028.1|  PREDICTED: uncharacterized protein LOC105040...  79.0    4e-14   Elaeis guineensis
ref|XP_008455295.1|  PREDICTED: uncharacterized protein LOC103495495  78.6    4e-14   Cucumis melo [Oriental melon]
ref|XP_007021600.1|  Serine/arginine repetitive matrix protein 2,...  79.7    4e-14   
ref|XP_010916029.1|  PREDICTED: uncharacterized protein LOC105040...  78.6    5e-14   
ref|XP_006294801.1|  hypothetical protein CARUB_v10023852mg           78.6    7e-14   Capsella rubella
ref|XP_010508532.1|  PREDICTED: uncharacterized protein LOC104785090  78.6    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009404523.1|  PREDICTED: forkhead box protein G1-like          78.2    8e-14   
ref|XP_003563777.1|  PREDICTED: uncharacterized protein LOC100825390  77.8    9e-14   Brachypodium distachyon [annual false brome]
gb|KEH38674.1|  hypothetical protein MTR_2g078620                     78.6    1e-13   Medicago truncatula
ref|XP_006467617.1|  PREDICTED: uncharacterized protein LOC102628675  77.4    1e-13   Citrus sinensis [apfelsine]
ref|XP_007149427.1|  hypothetical protein PHAVU_005G069500g           78.6    1e-13   Phaseolus vulgaris [French bean]
ref|XP_006449540.1|  hypothetical protein CICLE_v10016436mg           77.4    1e-13   Citrus clementina [clementine]
ref|XP_010102120.1|  hypothetical protein L484_021354                 77.4    2e-13   Morus notabilis
ref|XP_002881871.1|  hypothetical protein ARALYDRAFT_483373           77.0    2e-13   
emb|CDP15954.1|  unnamed protein product                              76.6    2e-13   Coffea canephora [robusta coffee]
ref|XP_010686232.1|  PREDICTED: uncharacterized protein LOC104900508  75.1    7e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136833.1|  PREDICTED: uncharacterized protein LOC101209175  74.7    7e-13   
ref|XP_009794562.1|  PREDICTED: uncharacterized protein LOC104241317  74.7    9e-13   Nicotiana sylvestris
ref|XP_009339321.1|  PREDICTED: uncharacterized protein LOC103931537  75.9    1e-12   Pyrus x bretschneideri [bai li]
emb|CBI20241.3|  unnamed protein product                              73.9    1e-12   Vitis vinifera
ref|XP_009593785.1|  PREDICTED: uncharacterized protein LOC104090403  74.3    1e-12   
ref|XP_006428825.1|  hypothetical protein CICLE_v10013612mg           73.6    2e-12   
gb|KCW74140.1|  hypothetical protein EUGRSUZ_E02771                   73.9    2e-12   Eucalyptus grandis [rose gum]
ref|XP_009390733.1|  PREDICTED: uncharacterized protein LOC103977053  74.7    3e-12   
ref|XP_009586598.1|  PREDICTED: uncharacterized protein LOC104084453  72.8    3e-12   Nicotiana tomentosiformis
emb|CAN63558.1|  hypothetical protein VITISV_034122                   74.7    5e-12   Vitis vinifera
ref|XP_006411544.1|  hypothetical protein EUTSA_v10017132mg           72.8    5e-12   Eutrema salsugineum [saltwater cress]
ref|XP_002285236.1|  PREDICTED: uncharacterized protein LOC100257151  74.7    5e-12   Vitis vinifera
ref|NP_181804.1|  uncharacterized protein                             72.4    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010059032.1|  PREDICTED: uncharacterized protein LOC104446940  73.9    1e-11   
ref|XP_004243270.1|  PREDICTED: uncharacterized protein LOC101267910  71.6    1e-11   Solanum lycopersicum
ref|XP_003541833.1|  PREDICTED: uncharacterized protein LOC100803315  72.8    1e-11   Glycine max [soybeans]
ref|XP_010059037.1|  PREDICTED: uncharacterized protein LOC104446945  70.5    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010506114.1|  PREDICTED: uncharacterized protein LOC104782786  71.6    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009142082.1|  PREDICTED: uncharacterized protein LOC103865964  70.9    2e-11   Brassica rapa
gb|KCW74145.1|  hypothetical protein EUGRSUZ_E02780                   70.5    3e-11   Eucalyptus grandis [rose gum]
emb|CDY14852.1|  BnaC04g48490D                                        70.5    3e-11   Brassica napus [oilseed rape]
ref|XP_002523267.1|  conserved hypothetical protein                   71.6    4e-11   Ricinus communis
ref|XP_010040852.1|  PREDICTED: uncharacterized protein LOC104429715  70.5    4e-11   Eucalyptus grandis [rose gum]
ref|XP_011082714.1|  PREDICTED: uncharacterized protein LOC105165412  71.2    4e-11   Sesamum indicum [beniseed]
ref|XP_010059038.1|  PREDICTED: uncharacterized protein LOC104446946  70.5    4e-11   Eucalyptus grandis [rose gum]
ref|XP_010098450.1|  hypothetical protein L484_012165                 71.2    5e-11   Morus notabilis
ref|XP_009341291.1|  PREDICTED: uncharacterized protein LOC103933323  70.9    5e-11   
ref|XP_009115260.1|  PREDICTED: uncharacterized protein LOC103840505  67.8    8e-11   Brassica rapa
ref|XP_010062846.1|  PREDICTED: uncharacterized protein LOC104450110  70.9    9e-11   Eucalyptus grandis [rose gum]
ref|XP_008363621.1|  PREDICTED: uncharacterized protein LOC103427337  70.1    1e-10   
emb|CDY50782.1|  BnaA09g54110D                                        67.4    1e-10   Brassica napus [oilseed rape]
ref|XP_010675463.1|  PREDICTED: uncharacterized protein LOC104891465  70.1    1e-10   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK07204.1|  predicted protein                                    69.3    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004967336.1|  PREDICTED: uncharacterized protein LOC101777454  70.5    1e-10   Setaria italica
ref|XP_006348891.1|  PREDICTED: uncharacterized protein LOC102578884  68.6    2e-10   Solanum tuberosum [potatoes]
gb|AFW86969.1|  hypothetical protein ZEAMMB73_882946                  67.0    2e-10   
ref|XP_010517817.1|  PREDICTED: uncharacterized protein LOC104793203  68.6    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010230679.1|  PREDICTED: uncharacterized protein LOC100823668  69.3    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_009790979.1|  PREDICTED: uncharacterized protein LOC104238348  66.6    7e-10   Nicotiana sylvestris
gb|KFK37122.1|  hypothetical protein AALP_AA4G215600                  66.6    8e-10   Arabis alpina [alpine rockcress]
ref|XP_008659691.1|  PREDICTED: uncharacterized protein LOC103638600  67.0    8e-10   
emb|CDX99803.1|  BnaC05g22250D                                        64.7    1e-09   
ref|XP_003629798.1|  hypothetical protein MTR_8g086670                63.5    1e-09   
emb|CBI30714.3|  unnamed protein product                              64.7    2e-09   Vitis vinifera
ref|XP_007148013.1|  hypothetical protein PHAVU_006G173300g           65.5    2e-09   Phaseolus vulgaris [French bean]
ref|XP_006303202.1|  hypothetical protein CARUB_v10011127mg           63.9    2e-09   Capsella rubella
gb|ACU17606.1|  unknown                                               64.7    3e-09   Glycine max [soybeans]
ref|XP_010059036.1|  PREDICTED: uncharacterized protein LOC104446944  62.8    4e-09   Eucalyptus grandis [rose gum]
gb|EMT32203.1|  hypothetical protein F775_12035                       63.9    5e-09   
gb|KCW74143.1|  hypothetical protein EUGRSUZ_E02775                   63.5    7e-09   Eucalyptus grandis [rose gum]
ref|XP_006643978.1|  PREDICTED: uncharacterized protein LOC102712021  65.1    9e-09   Oryza brachyantha
emb|CDM82557.1|  unnamed protein product                              63.9    2e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006303781.1|  hypothetical protein CARUB_v10012027mg           61.2    2e-08   Capsella rubella
ref|XP_002457038.1|  hypothetical protein SORBIDRAFT_03g000320        63.5    3e-08   Sorghum bicolor [broomcorn]
ref|NP_001042550.1|  Os01g0241000                                     63.5    3e-08   
ref|XP_002978809.1|  hypothetical protein SELMODRAFT_443974           62.8    4e-08   
ref|XP_002984723.1|  hypothetical protein SELMODRAFT_423830           62.8    5e-08   
ref|XP_008366658.1|  PREDICTED: uncharacterized protein LOC103430300  59.3    5e-08   
gb|EPS61787.1|  hypothetical protein M569_13011                       58.5    8e-08   Genlisea aurea
ref|XP_010314075.1|  PREDICTED: uncharacterized protein LOC104644911  59.7    1e-07   
ref|XP_001753980.1|  predicted protein                                61.2    2e-07   
gb|KCW75609.1|  hypothetical protein EUGRSUZ_E04347                   60.5    2e-07   Eucalyptus grandis [rose gum]
dbj|BAJ89671.1|  predicted protein                                    60.8    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89680.1|  predicted protein                                    60.8    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK23726.1|  unknown                                               58.9    2e-07   Picea sitchensis
gb|EYU30762.1|  hypothetical protein MIMGU_mgv1a022590mg              58.5    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_010059033.1|  PREDICTED: uncharacterized protein LOC104446941  59.7    2e-07   Eucalyptus grandis [rose gum]
gb|ABK22856.1|  unknown                                               58.5    2e-07   Picea sitchensis
gb|EYU28109.1|  hypothetical protein MIMGU_mgv1a022012mg              57.8    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_009390133.1|  PREDICTED: uncharacterized protein LOC103976591  58.2    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004155514.1|  PREDICTED: uncharacterized protein LOC101232662  58.2    5e-07   
ref|NP_001057835.1|  Os06g0550800                                     58.9    8e-07   
gb|KCW45545.1|  hypothetical protein EUGRSUZ_L00734                   57.4    1e-06   Eucalyptus grandis [rose gum]
gb|KCW74141.1|  hypothetical protein EUGRSUZ_E02773                   57.0    2e-06   Eucalyptus grandis [rose gum]
gb|AFG65733.1|  hypothetical protein 0_3683_01                        55.5    2e-06   Pinus taeda
gb|ADE77004.1|  unknown                                               54.7    5e-06   Picea sitchensis
ref|XP_004965581.1|  PREDICTED: serine/arginine repetitive matrix...  56.2    5e-06   
gb|KGN65040.1|  hypothetical protein Csa_1G181530                     54.3    8e-06   
gb|KCW74142.1|  hypothetical protein EUGRSUZ_E02774                   53.9    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010059034.1|  PREDICTED: uncharacterized protein LOC104446942  53.5    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010040037.1|  PREDICTED: uncharacterized protein LOC104428800  54.3    2e-05   Eucalyptus grandis [rose gum]
ref|XP_001752059.1|  predicted protein                                55.5    2e-05   
ref|XP_004159879.1|  PREDICTED: uncharacterized protein LOC101225687  54.3    4e-05   
gb|KGN57636.1|  hypothetical protein Csa_3G236040                     53.9    6e-05   Cucumis sativus [cucumbers]
gb|KCW74146.1|  hypothetical protein EUGRSUZ_E02782                   52.4    8e-05   Eucalyptus grandis [rose gum]
ref|XP_007212450.1|  hypothetical protein PRUPE_ppa017283mg           50.8    2e-04   
gb|KDP45851.1|  hypothetical protein JCGZ_15295                       50.1    8e-04   Jatropha curcas
gb|KGN65608.1|  hypothetical protein Csa_1G470240                     49.7    9e-04   Cucumis sativus [cucumbers]



>ref|XP_002519556.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42970.1| conserved hypothetical protein [Ricinus communis]
Length=183

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 119/179 (66%), Gaps = 32/179 (18%)
 Frame = -1

Query  655  KERLTRLDLAACKSQSHTSSPSLDR----------------SCKSLGELELEEVKGFMDL  524
            KER TRL+LA  +++SH+SSPS  +                SC+SLGELELEEVKGFMDL
Sbjct  6    KERPTRLNLATSRARSHSSSPSTAKRLTKNIGLRKVLQKSMSCRSLGELELEEVKGFMDL  65

Query  523  GFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED-------------  383
            GFIF KE+ S + +SVVPGL RL L K K     K  NS+   EDED             
Sbjct  66   GFIFKKEQISPRMISVVPGLSRLGLYKHK-HNTTKLINSEVVPEDEDCYDSDDHDIVRDD  124

Query  382  --DMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
              + E+G +RPYLSEAWLI+ P+SPLLNLR+P+ SAAAD+K+HL+ WA+TVA+ I+QES
Sbjct  125  QQEQEKGIIRPYLSEAWLIRRPDSPLLNLRLPKVSAAADMKKHLKFWARTVASEIQQES  183



>ref|XP_009601139.1| PREDICTED: uncharacterized protein LOC104096470 isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 139/235 (59%), Gaps = 56/235 (24%)
 Frame = -1

Query  760  SSMAGNDSSSTVDEITSQDEDVEEEXEARQNETT-AKERLTRLDLAACKSQSHTSSPS--  590
            S++      S+V+  ++  +DV E+ EA + E+T  KER TRL+  + +++SH++SP   
Sbjct  39   STLVPQKEFSSVESESTLLQDVCEKEEANEKESTQPKERPTRLNTTSTRNRSHSTSPYKK  98

Query  589  -----------LDR--SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQL  449
                       L++  SCKSLGELELEEVKGF+DLGFIF KE  SK+ +SV+PGLQRL++
Sbjct  99   HSRNLCSERRVLEKHMSCKSLGELELEEVKGFVDLGFIFRKEHISKRMISVIPGLQRLEV  158

Query  448  IKAKPERVLKSWNSQREHEDEDDM------------------------------------  377
            + ++ E      N++   E+E                                       
Sbjct  159  VVSEDEET----NNEDSEEEEGQPGTPSSRYAWGPGNGRTTRIYCAQPYATEEEEEEEED  214

Query  376  ERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
            +R  VRPYLSEAWLIK P+SPLLNLR+PR SAAAD+K+HLR WAKTVATV+ QES
Sbjct  215  KREIVRPYLSEAWLIKKPDSPLLNLRVPRISAAADMKKHLRCWAKTVATVVLQES  269



>ref|XP_009601138.1| PREDICTED: uncharacterized protein LOC104096470 isoform X1 [Nicotiana 
tomentosiformis]
Length=274

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 129/215 (60%), Gaps = 56/215 (26%)
 Frame = -1

Query  700  DVEEEXEARQNETT-AKERLTRLDLAACKSQSHTSSPS-------------LDR--SCKS  569
            DV E+ EA + E+T  KER TRL+  + +++SH++SP              L++  SCKS
Sbjct  64   DVCEKEEANEKESTQPKERPTRLNTTSTRNRSHSTSPYKKHSRNLCSERRVLEKHMSCKS  123

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHED  389
            LGELELEEVKGF+DLGFIF KE  SK+ +SV+PGLQRL+++ ++ E      N++   E+
Sbjct  124  LGELELEEVKGFVDLGFIFRKEHISKRMISVIPGLQRLEVVVSEDEET----NNEDSEEE  179

Query  388  EDDM------------------------------------ERGRVRPYLSEAWLIKSPNS  317
            E                                       +R  VRPYLSEAWLIK P+S
Sbjct  180  EGQPGTPSSRYAWGPGNGRTTRIYCAQPYATEEEEEEEEDKREIVRPYLSEAWLIKKPDS  239

Query  316  PLLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
            PLLNLR+PR SAAAD+K+HLR WAKTVATV+ QES
Sbjct  240  PLLNLRVPRISAAADMKKHLRCWAKTVATVVLQES  274



>ref|XP_009784159.1| PREDICTED: uncharacterized protein LOC104232609 [Nicotiana sylvestris]
Length=256

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 123/208 (59%), Gaps = 53/208 (25%)
 Frame = -1

Query  703  EDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSP--------SLDR-------SCKS  569
            +DV E+ EA       KER TR +  A ++ SH++SP        S +R       SCKS
Sbjct  58   QDVCEKEEA-----NGKERPTRHNSTATRNGSHSTSPYKKHSRNLSSERRILENTTSCKS  112

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLI-------------------  446
            LGELELEEVKGFMDLGFIF KE  SK+ ++V+PGLQRL+ +                   
Sbjct  113  LGELELEEVKGFMDLGFIFRKEHISKRMINVIPGLQRLEEVMPEDEETNNEDSEEGQPGT  172

Query  445  ----------KAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRM  296
                      K +  RV    N    +  E++ +R  VRPYLSEAWLIK P+SPLLN+R+
Sbjct  173  LSFYYARGSEKGQTTRV----NYTPPYAAEEEDKREIVRPYLSEAWLIKKPDSPLLNMRV  228

Query  295  PRASAAADVKRHLRHWAKTVATVIRQES  212
            PR SAA D+K+HLR+WAKTVATV+ QES
Sbjct  229  PRISAATDMKKHLRYWAKTVATVVLQES  256



>ref|XP_007162732.1| hypothetical protein PHAVU_001G175800g [Phaseolus vulgaris]
 gb|ESW34726.1| hypothetical protein PHAVU_001G175800g [Phaseolus vulgaris]
Length=263

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 124/197 (63%), Gaps = 25/197 (13%)
 Frame = -1

Query  745  NDSSSTVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAAC-KSQSHTSSPSLDR----  581
            ++S+S    ++S+   V  +  +  NE   KERL R+DL    K++SH+SSPS       
Sbjct  72   DESASLEKPLSSESISVLLQDGSINNEEKTKERLARMDLLLGDKTRSHSSSPSTQNRHRK  131

Query  580  ---------------SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLI  446
                           SC++LGELEL+EVKGFMDLGF F+KE  S + MSVVPGLQRL ++
Sbjct  132  LRNPVTCARKLQKSESCRTLGELELDEVKGFMDLGFTFNKEYLSPRMMSVVPGLQRLGVM  191

Query  445  KAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVK  266
              K     ++        DED+ +R  +RPYLSEAWLIK P+SPLLNL++P+  ++A++K
Sbjct  192  NGK-----ETVEGDYIEADEDEGKRDIMRPYLSEAWLIKRPDSPLLNLKIPKRCSSANMK  246

Query  265  RHLRHWAKTVATVIRQE  215
            +HLR WAKTVA+ I Q+
Sbjct  247  KHLRFWAKTVASEIHQK  263



>gb|KDP29097.1| hypothetical protein JCGZ_16486 [Jatropha curcas]
Length=264

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 111/169 (66%), Gaps = 21/169 (12%)
 Frame = -1

Query  655  KERLTRLDLAACKSQSHTSSPS-------------------LDRSCKSLGELELEEVKGF  533
            KER TR +L+  ++ S + SPS                      SC+SLGELE+EEVKGF
Sbjct  96   KERQTRSNLSTNRACSQSFSPSNKNRQPKSIRNSISFSKLKKSMSCRSLGELEMEEVKGF  155

Query  532  MDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHE--DEDDMERGRVR  359
            +DLGFIF KE  S + ++VVPGL RL L +       K  N++ E E  DE + E+  +R
Sbjct  156  LDLGFIFKKENVSARMITVVPGLLRLGLCQNDKNYNTKIINNEEEDEVRDEKEEEKEIMR  215

Query  358  PYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
            PYLSEAW+IK P+SPLLNLR+PR  AAAD+K+HL+ WA+TVA+VI+QES
Sbjct  216  PYLSEAWIIKRPDSPLLNLRLPRVYAAADMKKHLKFWARTVASVIQQES  264



>emb|CBI32707.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 124/199 (62%), Gaps = 25/199 (13%)
 Frame = -1

Query  739  SSSTVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSPSLDR-------  581
            S+S + ++  +++D + + E +  E   KER  RL+L   K++S +SSP+  +       
Sbjct  71   SASPLPQLVDEEDDPKNQGEDK--EMKQKERPNRLNLMTRKTRSFSSSPATKKRAKNHRY  128

Query  580  -----------SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKP  434
                       SCKSL ELELEEVKGFMDLGF F +E  S + ++V+PGLQRL     + 
Sbjct  129  LGAVTSLPKTMSCKSLRELELEEVKGFMDLGFKFKREHLSPRMITVIPGLQRLGGYNNEQ  188

Query  433  ERVLKSWNSQREHEDED-----DMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADV  269
            E  L        ++D+      + ER  VRPYLSEAWLIK P+SPLLNL+MPR SA+AD+
Sbjct  189  ETELSDSTQSANYKDDKIEEEEEEERAVVRPYLSEAWLIKRPDSPLLNLKMPRVSASADM  248

Query  268  KRHLRHWAKTVATVIRQES  212
            K+HL HWA+TVA VI+Q+S
Sbjct  249  KKHLWHWARTVAYVIQQQS  267



>ref|XP_011048575.1| PREDICTED: uncharacterized protein LOC105142581 isoform X2 [Populus 
euphratica]
Length=280

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 96/128 (75%), Gaps = 5/128 (4%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC+S+GELELEEVKGFMDLGFIF KE  S + MSVVPGLQRL L + +    L+      
Sbjct  153  SCRSMGELELEEVKGFMDLGFIFKKEHLSPRMMSVVPGLQRLGLYQNRQNINLRDSKEAE  212

Query  400  EH-----EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
            +H     + E+D E+G +RPYLSE+WLIK P+SPLLNLR+PR S AAD+K+HL+ WA+TV
Sbjct  213  DHGELIRKQEEDEEKGIIRPYLSESWLIKRPDSPLLNLRVPRVSVAADMKKHLKFWARTV  272

Query  235  ATVIRQES  212
            A+ I+ ES
Sbjct  273  ASEIQPES  280



>ref|XP_011048574.1| PREDICTED: uncharacterized protein LOC105142581 isoform X1 [Populus 
euphratica]
Length=281

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 96/128 (75%), Gaps = 5/128 (4%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC+S+GELELEEVKGFMDLGFIF KE  S + MSVVPGLQRL L + +    L+      
Sbjct  154  SCRSMGELELEEVKGFMDLGFIFKKEHLSPRMMSVVPGLQRLGLYQNRQNINLRDSKEAE  213

Query  400  EH-----EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
            +H     + E+D E+G +RPYLSE+WLIK P+SPLLNLR+PR S AAD+K+HL+ WA+TV
Sbjct  214  DHGELIRKQEEDEEKGIIRPYLSESWLIKRPDSPLLNLRVPRVSVAADMKKHLKFWARTV  273

Query  235  ATVIRQES  212
            A+ I+ ES
Sbjct  274  ASEIQPES  281



>ref|XP_006381475.1| hypothetical protein POPTR_0006s13180g [Populus trichocarpa]
 gb|ERP59272.1| hypothetical protein POPTR_0006s13180g [Populus trichocarpa]
Length=281

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 5/128 (4%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC+SLGELELEEVKGFMDLGFIF KE  S + MSVVPGLQRL L + +    L+      
Sbjct  154  SCRSLGELELEEVKGFMDLGFIFKKEYLSPRMMSVVPGLQRLGLYQNRQNINLRDSKEAE  213

Query  400  EHED-----EDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
            +H++     E+D E+G +RPYLSE+WLIK P+SPLLNLR+PR S AAD+K HL+ WA+TV
Sbjct  214  DHDELIRKQEEDEEKGIIRPYLSESWLIKRPDSPLLNLRVPRVSVAADMKIHLKFWARTV  273

Query  235  ATVIRQES  212
            A+ I+ ES
Sbjct  274  ASEIQPES  281



>ref|XP_006577012.1| PREDICTED: uncharacterized protein LOC102667501 [Glycine max]
 gb|KHN09486.1| hypothetical protein glysoja_016585 [Glycine soja]
Length=260

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 126/198 (64%), Gaps = 28/198 (14%)
 Frame = -1

Query  745  NDSSSTVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSPSLDR-----  581
            ++S S+  +++S+   V  +  +  NE   KE LTR++ +  +++SH+SSPS        
Sbjct  70   DESPSSEKQLSSESISVPLQDGSINNEEETKEGLTRMNQSDNRTRSHSSSPSTQNRHRKL  129

Query  580  ----------------SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQL  449
                            SC++LGELEL+EVKGFMDLGF F KE  S + MSVVPGLQRL +
Sbjct  130  RKPATTTCARKLQKSISCRTLGELELDEVKGFMDLGFTFKKEYLSPRMMSVVPGLQRLGV  189

Query  448  IKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADV  269
            + A+ E V      +  H + ++ +R  +RPYLSEAWLIK P+SPLLNL++P+  +++++
Sbjct  190  VDAR-ETV------EGNHIEAEEQKRDIMRPYLSEAWLIKRPDSPLLNLKIPKCCSSSNM  242

Query  268  KRHLRHWAKTVATVIRQE  215
            K+HLR WAKTVA+ I QE
Sbjct  243  KKHLRFWAKTVASEIHQE  260



>ref|XP_008369743.1| PREDICTED: uncharacterized protein LOC103433275 [Malus domestica]
Length=295

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 131/223 (59%), Gaps = 40/223 (18%)
 Frame = -1

Query  760  SSMAGNDSSSTVDEITS--QDEDVEEEXEARQNETTA----KERLTRLDLAA----CKSQ  611
            S +   D+SS   ++T+   D + EEE +   NE       K R TRL++ A     +SQ
Sbjct  73   SPLLYEDNSSDSPQMTTPQDDSNNEEEDDMNSNEFVNVQKNKTRPTRLNMLANRMLIRSQ  132

Query  610  SH---------------TSSPSLDR------------SCKSLGELELEEVKGFMDLGFIF  512
            S                TSSP                SC+SLGELELEEVKGF+DLGF F
Sbjct  133  SSDHQKRPRKNRRCSSSTSSPGYATAAAAAQKLQKSMSCRSLGELELEEVKGFIDLGFTF  192

Query  511  DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE--HEDEDDMERGRV-RPYLSEA  341
             KE  S + MS+VPGLQRL +  +K  R     +++ E   ED+DD + G V RPYLSEA
Sbjct  193  KKEHLSPRMMSLVPGLQRLGVSNSKKLRNKNDDSAEIEVPKEDKDDEKEGEVMRPYLSEA  252

Query  340  WLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
            WLIK P+SPLLNLR+PR SAAAD+K+HL+ WA+TVA+ I QES
Sbjct  253  WLIKRPDSPLLNLRLPRVSAAADMKKHLKFWARTVASEIHQES  295



>emb|CDP06723.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 96/129 (74%), Gaps = 6/129 (5%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQL----IKAKPERVLKS-  416
            SCKSL ELELEEV+GFMDLGFIF+KE  SK+ MSV+PGLQRL+L    I+ K   ++ S 
Sbjct  142  SCKSLCELELEEVQGFMDLGFIFNKENMSKRMMSVIPGLQRLELSGSTIQGKDNILMGSP  201

Query  415  -WNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
              +  R  E E   E+   RPYLSEAWLI+ P+SPLLNLR+PR S AAD+K+HL++WA+T
Sbjct  202  PRHETRRVEVEGGAEQTITRPYLSEAWLIRRPDSPLLNLRIPRVSTAADMKKHLKYWART  261

Query  238  VATVIRQES  212
            VA+ I  E+
Sbjct  262  VASAIALET  270



>gb|KHN02356.1| hypothetical protein glysoja_002380 [Glycine soja]
Length=247

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 27/173 (16%)
 Frame = -1

Query  673  QNETTAKERLTRLDLAACKSQSHTSSPSLDR--------------------SCKSLGELE  554
             NE   K+ LTR++L   +++SH+SSPS                       SC++LGELE
Sbjct  82   NNEEERKDGLTRMNLLDNRTRSHSSSPSTQNRHRKLRKPATTCARKLQKSISCRTLGELE  141

Query  553  LEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDME  374
            L+EVKGFMDLGF F KE  S + MSV+PGLQRL ++ A       +   +  H + ++ +
Sbjct  142  LDEVKGFMDLGFTFKKECLSPRMMSVIPGLQRLGVMDA-------TETVEGNHIEAEEQK  194

Query  373  RGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
            RG +RPYLSEAW IK P+SPLLNL++P+  ++A++K+HLR WAKTVA+ I QE
Sbjct  195  RGIMRPYLSEAWPIKRPDSPLLNLKIPKRCSSANMKKHLRFWAKTVASEIHQE  247



>ref|XP_003553543.1| PREDICTED: uncharacterized protein LOC100786645 [Glycine max]
Length=259

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 27/173 (16%)
 Frame = -1

Query  673  QNETTAKERLTRLDLAACKSQSHTSSPSLDR--------------------SCKSLGELE  554
             NE   K+ LTR++L   +++SH+SSPS                       SC++LGELE
Sbjct  94   NNEEERKDGLTRMNLLDNRTRSHSSSPSTQNRHRKLRKPATTCARKLQKSISCRTLGELE  153

Query  553  LEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDME  374
            L+EVKGFMDLGF F KE  S + MSV+PGLQRL ++ A       +   +  H + ++ +
Sbjct  154  LDEVKGFMDLGFTFKKECLSPRMMSVIPGLQRLGVMDA-------TETVEGNHIEAEEQK  206

Query  373  RGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
            RG +RPYLSEAW IK P+SPLLNL++P+  ++A++K+HLR WAKTVA+ I QE
Sbjct  207  RGIMRPYLSEAWPIKRPDSPLLNLKIPKRCSSANMKKHLRFWAKTVASEIHQE  259



>gb|KJB36628.1| hypothetical protein B456_006G167900 [Gossypium raimondii]
Length=264

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKP------ERVLK  419
            SCKSL +LELEEVKGFMDLGFIF KE    + + VVPGL RL  +K +P        V K
Sbjct  136  SCKSLEDLELEEVKGFMDLGFIFKKEHLDSRMIDVVPGLLRLGFLKTQPNLPADEHEVSK  195

Query  418  SWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
              +   +  +++D E G +RPYLSEAWLIK P+SPLLNL++PR SAAAD+K+HL+ WA+T
Sbjct  196  DDDDDDDDIEQEDQESGVIRPYLSEAWLIKRPDSPLLNLKVPRVSAAADMKKHLKCWART  255

Query  238  VATVIRQE  215
            VA+V++QE
Sbjct  256  VASVVQQE  263



>ref|XP_009358150.1| PREDICTED: uncharacterized protein LOC103948809 [Pyrus x bretschneideri]
Length=294

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 129/220 (59%), Gaps = 41/220 (19%)
 Frame = -1

Query  760  SSMAGNDSSSTVDEITS--QDEDVEEEXEARQNETT----AKERLTRLDLAA----CKSQ  611
            S +   D+SS   ++T+   D + EEE +   NE       K R TRL++ A     +SQ
Sbjct  73   SPLFYEDNSSDSPQMTTPQDDSNNEEEDDMNSNEFINVKKKKTRPTRLNMLANRMLIRSQ  132

Query  610  SH---------------TSSPSL------------DRSCKSLGELELEEVKGFMDLGFIF  512
            S                TSSP                SC+SLGELELEEVKGF+DLGF F
Sbjct  133  SSDHQKRPRKNRTCSSSTSSPGYATAATAAQKLQKSMSCRSLGELELEEVKGFIDLGFTF  192

Query  511  DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE---HEDEDDMERGRV-RPYLSE  344
             KE  S + MS+VPGLQRL +  +K  R     +++ E   +ED+DD + G V RPYLSE
Sbjct  193  KKEHLSPRMMSLVPGLQRLGVSNSKKLRNKNDDSAEIEVAPNEDKDDEKAGEVMRPYLSE  252

Query  343  AWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
            AWLIK P+SPLLNLR+PR SAAAD+K+HL+ WA+TVA+ +
Sbjct  253  AWLIKRPDSPLLNLRLPRVSAAADMKKHLKFWARTVASEV  292



>ref|XP_010653545.1| PREDICTED: uncharacterized protein LOC100854914 [Vitis vinifera]
Length=242

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 115/181 (64%), Gaps = 14/181 (8%)
 Frame = -1

Query  739  SSSTVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGE  560
            S+S + ++  +++D + + E +  E   KER  R  L A  S   T       SCKSL E
Sbjct  71   SASPLPQLVDEEDDPKNQGEDK--EMKQKERPNRY-LGAVTSLPKT------MSCKSLRE  121

Query  559  LELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED-  383
            LELEEVKGFMDLGF F +E  S + ++V+PGLQRL     + E  L        ++D+  
Sbjct  122  LELEEVKGFMDLGFKFKREHLSPRMITVIPGLQRLGGYNNEQETELSDSTQSANYKDDKI  181

Query  382  ----DMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
                + ER  VRPYLSEAWLIK P+SPLLNL+MPR SA+AD+K+HL HWA+TVA VI+Q+
Sbjct  182  EEEEEEERAVVRPYLSEAWLIKRPDSPLLNLKMPRVSASADMKKHLWHWARTVAYVIQQQ  241

Query  214  S  212
            S
Sbjct  242  S  242



>ref|XP_004249495.1| PREDICTED: uncharacterized protein LOC101249595 [Solanum lycopersicum]
Length=203

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 7/121 (6%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KS G+LELEE++GFMDLGF F KE  SK+ ++V+PGLQR +++  + E      +++   
Sbjct  90   KSFGDLELEELRGFMDLGFTFRKEHISKRMINVIPGLQRREIVICECE------DTKAIV  143

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
             +E+D +R  VRPYLSEAWLIK PNSPLLN+R+PR SA +D+K+HLR+WAKTVATV+RQE
Sbjct  144  AEEED-KREIVRPYLSEAWLIKRPNSPLLNMRIPRISAPSDMKKHLRYWAKTVATVVRQE  202

Query  214  S  212
            S
Sbjct  203  S  203



>gb|KJB62488.1| hypothetical protein B456_009G419000 [Gossypium raimondii]
Length=246

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 99/142 (70%), Gaps = 14/142 (10%)
 Frame = -1

Query  622  CKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIK  443
            CK Q  TS       C+SL +LELEEVKGFMDLGF+F KE  + + +SV+PGL RL   +
Sbjct  114  CKLQKSTS-------CRSLKDLELEEVKGFMDLGFVFTKEHLNARMISVIPGLLRLGFSR  166

Query  442  AKPERVLKSWNSQREH-EDEDDME----RGRVRPYLSEAWLIKSPNSPLLNLRMPRASAA  278
             K  R+    N   +    +DD+E    RG +RPYLSEAWLIK P+SPLLNLR+PR SAA
Sbjct  167  TK--RIHNEVNVDADQLSKDDDIEQEEKRGVIRPYLSEAWLIKRPDSPLLNLRVPRVSAA  224

Query  277  ADVKRHLRHWAKTVATVIRQES  212
            AD+K+HL+ WA+TVA V++Q+S
Sbjct  225  ADMKKHLKFWARTVAYVVQQDS  246



>ref|XP_008239371.1| PREDICTED: uncharacterized protein LOC103337975 [Prunus mume]
Length=298

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 94/132 (71%), Gaps = 14/132 (11%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC+SLGELELEEVKGFMDLGF F +E  S + MS+VPGLQRL +   K     K  N + 
Sbjct  172  SCRSLGELELEEVKGFMDLGFTFKREHLSPRMMSLVPGLQRLGMSNNK-----KLQNGED  226

Query  400  EHE------DEDDMERGRV---RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHW  248
            + +      D+D+   G V   RPYLSEAWLIK P+SPLLNLR+PR SAAAD+K+HL+ W
Sbjct  227  DDDSVEVAADKDEDGEGEVEVTRPYLSEAWLIKRPDSPLLNLRLPRVSAAADMKKHLKFW  286

Query  247  AKTVATVIRQES  212
            A+TVA+ I QES
Sbjct  287  ARTVASEIHQES  298



>ref|XP_010253606.1| PREDICTED: uncharacterized protein LOC104594811 [Nelumbo nucifera]
Length=260

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 99/170 (58%), Gaps = 48/170 (28%)
 Frame = -1

Query  619  KSQSHTSSPSLDRS---------CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPG  467
            K Q H +  + DRS         CKSL ELE EEVKGFMDLGF FDKE  + + MSV+PG
Sbjct  105  KGQKHLTYSNNDRSRRILQKTTSCKSLWELEYEEVKGFMDLGFTFDKEYLTPRMMSVIPG  164

Query  466  LQRLQLIKAKPERVLKSWNSQREHEDEDD-----ME--------------------RGRV  362
            LQRL                  +HEDE +     ME                    RG  
Sbjct  165  LQRL--------------GKYNDHEDEGEDYRCGMEAAEKKKFKDDEEIEVEKEEKRGVR  210

Query  361  RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
            RPYLSEAWLIK P+SPLLNLR+PRASA A++K+HLR WA+TVA+V+RQES
Sbjct  211  RPYLSEAWLIKRPDSPLLNLRLPRASATAEMKKHLRFWARTVASVVRQES  260



>ref|XP_010264742.1| PREDICTED: uncharacterized protein LOC104602661 [Nelumbo nucifera]
Length=273

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 121/214 (57%), Gaps = 49/214 (23%)
 Frame = -1

Query  724  DEITSQDEDVEEEXEARQNET----TAKERLTRLD-LAACKSQSHTSSPSLDR-------  581
            +EI+S    V  + E+  N++      KE+ TRL+ L   K +SH+SSPS  +       
Sbjct  66   EEISSISCPVPLQGESSNNDSETNVYTKEKPTRLNFLDISKPRSHSSSPSTKKRRKHQRY  125

Query  580  -------------SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKA  440
                         SCKSL ELE EEVKGFMDLGF FDK   S + MSV+PGLQRL   + 
Sbjct  126  TGGDPSRRIQKTMSCKSLWELEYEEVKGFMDLGFRFDKMYLSPRMMSVIPGLQRLGQYQD  185

Query  439  KPERVLKSWNSQREHEDEDDMERGR------------------VRPYLSEAWLIKSPNSP  314
                     +   E ED  DM+ G+                  +RPYLSEAWLIK P+SP
Sbjct  186  D------DDDDAEEQEDRCDMKTGKEEDKDEEVEEEKQEERVVIRPYLSEAWLIKRPDSP  239

Query  313  LLNLRMPRASAAADVKRHLRHWAKTVATVIRQES  212
            LLNLR+PRASA AD+K+HLR WA+T+A VI+QES
Sbjct  240  LLNLRIPRASATADMKKHLRSWARTIAYVIQQES  273



>gb|KHG27555.1| hypothetical protein F383_14062 [Gossypium arboreum]
Length=265

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 19/135 (14%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SCKSL +LELEEVKGFMDLGFIF KE    + + VVPGL RL  +K +P           
Sbjct  136  SCKSLEDLELEEVKGFMDLGFIFKKEHLDSRMIDVVPGLLRLGFLKTQPNL------PAD  189

Query  400  EHE-------------DEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRH  260
            EHE             +++  E G +RPYLSEAWLIK P+SPLLNL++PR SAAAD+K+H
Sbjct  190  EHEVSKDDDDDDDDDIEQEKQESGVIRPYLSEAWLIKRPDSPLLNLKVPRVSAAADMKKH  249

Query  259  LRHWAKTVATVIRQE  215
            L+ WA+TVA+V++QE
Sbjct  250  LKCWARTVASVVQQE  264



>ref|XP_007027287.1| Uncharacterized protein TCM_022118 [Theobroma cacao]
 gb|EOY07789.1| Uncharacterized protein TCM_022118 [Theobroma cacao]
Length=301

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 92/125 (74%), Gaps = 5/125 (4%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC+SL +LELEEVKGFMDLGFIF KE  + + +SVVPGL RL  +K K +  L    +  
Sbjct  178  SCRSLKDLELEEVKGFMDLGFIFKKENLNARMISVVPGLLRLGFLKTKQKTELNL--AAD  235

Query  400  EHEDEDDME---RGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
            E   +DD+E    G VRPYLSE WLIK P+SPLLNLR+PR  AAAD+K+HL+ WA+TVA+
Sbjct  236  ELPKDDDIEPEETGVVRPYLSETWLIKRPDSPLLNLRVPRVYAAADMKKHLKFWARTVAS  295

Query  229  VIRQE  215
            V +QE
Sbjct  296  VAQQE  300



>gb|KHG19373.1| rna exonuclease 3 [Gossypium arboreum]
Length=295

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 14/142 (10%)
 Frame = -1

Query  622  CKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIK  443
            CK Q  TS       C+SL +LELEEVKGFMDLGF+F KE  + + + V+PGL RL   +
Sbjct  163  CKLQKSTS-------CRSLKDLELEEVKGFMDLGFVFTKEHLNARMIGVIPGLLRLGFSR  215

Query  442  AKPERVLKSWNSQREH-EDEDDME----RGRVRPYLSEAWLIKSPNSPLLNLRMPRASAA  278
             K  R+    N   +    +DD+E    RG +RPYLSEAWLIK P+SPLLNLR+PR SAA
Sbjct  216  TK--RIHNEVNVDADQLSKDDDIEQEEKRGVIRPYLSEAWLIKRPDSPLLNLRVPRVSAA  273

Query  277  ADVKRHLRHWAKTVATVIRQES  212
            AD+K+HL+ WA+TVA V++Q+S
Sbjct  274  ADMKKHLKFWARTVAYVVQQDS  295



>ref|XP_011077361.1| PREDICTED: uncharacterized protein LOC105161392 [Sesamum indicum]
Length=248

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 123/196 (63%), Gaps = 18/196 (9%)
 Frame = -1

Query  763  TSSMAGNDSSSTVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSPSLD  584
            TSS+A     S +    SQDE      +   ++  +   L+ L ++A + QS +S+  L 
Sbjct  59   TSSLA-----SVITTTHSQDEAGCSFFQESDHDKDSDHDLSSLPVSA-RKQSVSSAGRLQ  112

Query  583  RS--CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLI-KAKPERVLKSW  413
            +S  CKSL ELELEEVKGFMDLGF F KE  S++ M++VPGLQR++   K   ++   SW
Sbjct  113  KSMSCKSLAELELEEVKGFMDLGFTFKKENMSQRVMNLVPGLQRIESCNKTSKDKDDSSW  172

Query  412  N----SQREHEDEDDMERGR-----VRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRH  260
            +    +  +H D +  E+       +RPYLSEAWL+K+P+SPLLNLR+PR S   D+K+H
Sbjct  173  DGFGFTHDDHTDNNVEEKNETMMMMMRPYLSEAWLMKTPDSPLLNLRIPRVSTTEDMKKH  232

Query  259  LRHWAKTVATVIRQES  212
            L+ WA+TVA+ I Q+S
Sbjct  233  LKDWARTVASAIHQQS  248



>gb|KDO35922.1| hypothetical protein CISIN_1g025682mg [Citrus sinensis]
Length=249

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 114/168 (68%), Gaps = 20/168 (12%)
 Frame = -1

Query  667  ETTAKERLTRLDLAACKS-QSHTSSPSLDR---------------SCKSLGELELEEVKG  536
            +T  ++R TRL+L   KS +S +SSP+  R               SC+SL ELELEEVKG
Sbjct  84   DTNLEQRPTRLNLTRGKSNRSQSSSPATQRLKKRRYSKSLPQKSKSCRSLMELELEEVKG  143

Query  535  FMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRP  356
            FMDLGF F+KE  S + MSV+PGLQR++L +   +        + + +D++D E+  +RP
Sbjct  144  FMDLGFRFNKECLSPRMMSVLPGLQRVKLHQVARDGDDD---DETDQQDDEDYEKRVMRP  200

Query  355  YLSEAWLIKSPNSPLLNLRMPRASAAA-DVKRHLRHWAKTVATVIRQE  215
            YLSEAWLIK P+SPLLN RMPR +AAA D+K+HLR WAKTVA+ I+QE
Sbjct  201  YLSEAWLIKRPDSPLLNFRMPRVTAAADDMKKHLRFWAKTVASEIQQE  248



>ref|XP_006480639.1| PREDICTED: uncharacterized protein LOC102612278 [Citrus sinensis]
Length=250

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 114/169 (67%), Gaps = 21/169 (12%)
 Frame = -1

Query  667  ETTAKERLTRLDLAACKS-QSHTSSPSL----------------DRSCKSLGELELEEVK  539
            +T  ++R TRL+L   KS +S +SSP+                  +SC+SL ELELEEVK
Sbjct  84   DTNLEQRPTRLNLTRGKSNRSQSSSPATLKRLKKRRYSKSLPQKSKSCRSLMELELEEVK  143

Query  538  GFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVR  359
            GFMDLGF F+KE  S + MSV+PGLQR++L +   +        + + +D++D E+  +R
Sbjct  144  GFMDLGFRFNKECLSPRMMSVLPGLQRVKLHQVARDGDDD---DETDQQDDEDYEKRVMR  200

Query  358  PYLSEAWLIKSPNSPLLNLRMPRASAAA-DVKRHLRHWAKTVATVIRQE  215
            PYLSEAWLIK P+SPLLN RMPR +AAA D+K+HLR WAKTVA+ I+QE
Sbjct  201  PYLSEAWLIKRPDSPLLNFRMPRVTAAADDMKKHLRFWAKTVASEIQQE  249



>ref|XP_010107564.1| hypothetical protein L484_024420 [Morus notabilis]
 gb|EXC16246.1| hypothetical protein L484_024420 [Morus notabilis]
Length=254

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 10/124 (8%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + +SLG+LEL EVKGFMDLGFIF KE  S + MS++PGLQRL++ K+K         S+ 
Sbjct  137  TYRSLGDLELREVKGFMDLGFIFKKEHLSPRMMSLIPGLQRLKVYKSKEN------GSEN  190

Query  400  EHEDEDDME----RGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
               D+++ E    RG +RPYLSEAWLIK P SPLLNLR+PR SAAAD+K+HLR WA+ VA
Sbjct  191  LEGDQEEEEEEEERGVIRPYLSEAWLIKRPGSPLLNLRVPRVSAAADMKKHLRFWARIVA  250

Query  232  TVIR  221
            + I+
Sbjct  251  SEIQ  254



>ref|XP_004493960.1| PREDICTED: uncharacterized protein LOC101490574 [Cicer arietinum]
Length=268

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPE----RVLKSW  413
            SC++LGELEL+EVKGFMDLGF F+KE   +K +SVVPGLQR  L++ K      +++ S 
Sbjct  143  SCRTLGELELDEVKGFMDLGFTFNKECIDQKMISVVPGLQRFCLLQNKQHYSQSQIMAST  202

Query  412  NSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
                E  +  + +R  +RPYLSEAWLIK P+SPLLN+++P++ +A+++K+H+R WAK VA
Sbjct  203  KENDEIIEVCEEKRDIMRPYLSEAWLIKRPDSPLLNMKIPKSCSASNMKKHIRFWAKIVA  262

Query  232  TVIRQE  215
            + I+QE
Sbjct  263  SEIQQE  268



>ref|XP_010046753.1| PREDICTED: uncharacterized protein LOC104435755 [Eucalyptus grandis]
 gb|KCW88827.1| hypothetical protein EUGRSUZ_A01165 [Eucalyptus grandis]
Length=260

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 85/123 (69%), Gaps = 10/123 (8%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC++  ELE++EVKGFMDLGFIF KE  S + +SVVPGL RL    + PE        +R
Sbjct  148  SCRTFEELEMKEVKGFMDLGFIFKKEHLSPRMVSVVPGLHRLGRDASIPESATNDEEGKR  207

Query  400  EHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            E           +RPYLSEAWLIK P+SPLLNLR+PRA  A+D+K+HL+ WA+TVA+ I 
Sbjct  208  E----------IMRPYLSEAWLIKRPDSPLLNLRVPRAYEASDMKKHLKFWARTVASEIH  257

Query  220  QES  212
            QES
Sbjct  258  QES  260



>ref|XP_008442668.1| PREDICTED: late secretory pathway protein AVL9-like [Cucumis 
melo]
Length=248

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 108/176 (61%), Gaps = 16/176 (9%)
 Frame = -1

Query  718  ITSQDEDVEEEXEARQN---ETTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELE  548
            + SQ++   EE + +Q+   E++  + L  L  +  +  + ++S      CKSLGELELE
Sbjct  79   LVSQEDYNNEEDKDKQDAKRESSEDQSLNNLKFSVGRKLNKSTS------CKSLGELELE  132

Query  547  EVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDM---  377
            EVKGFMDLGF F +E  S + + +VPGLQRL+    K            +H++ DD    
Sbjct  133  EVKGFMDLGFEFKRESLSPQMVKLVPGLQRLRTQTNKQNLEEDDDGDGDDHQENDDDDDD  192

Query  376  ----ERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
                +R   RPYLSEAW+I+ PNSPLLNLRMP+ S+ +D+K+HLR WAKTVA  I+
Sbjct  193  DDDKKREIARPYLSEAWIIRRPNSPLLNLRMPKVSSTSDMKKHLRSWAKTVAFEIQ  248



>ref|XP_007205680.1| hypothetical protein PRUPE_ppa009620mg [Prunus persica]
 gb|EMJ06879.1| hypothetical protein PRUPE_ppa009620mg [Prunus persica]
Length=285

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 9/123 (7%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            SC+SLGELELEEVKGFMDLGF F +E  S + MS       L+L   + +       +++
Sbjct  172  SCRSLGELELEEVKGFMDLGFTFKREHLSPRMMS-------LKLQNGEDDDDSVEVAAEK  224

Query  400  EHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            + + E ++E    RPYLSEAWLIK P+SPLLNLR+PR SAAAD+K+HL++WA+TVA+ I 
Sbjct  225  DEDGEGEVEV--TRPYLSEAWLIKRPDSPLLNLRLPRVSAAADMKKHLKYWARTVASEIH  282

Query  220  QES  212
            QES
Sbjct  283  QES  285



>ref|XP_006850606.1| hypothetical protein AMTR_s00034p00131640 [Amborella trichopoda]
 gb|ERN12187.1| hypothetical protein AMTR_s00034p00131640 [Amborella trichopoda]
Length=229

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 94/149 (63%), Gaps = 15/149 (10%)
 Frame = -1

Query  643  TRLDLAACKSQSHTSSPSLDRS----CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSV  476
            T+L L    S+  +  P   RS     KSL ELE++E+KGFMDLGF+F+KE  S +TMSV
Sbjct  91   TQLKLRRTASRLDSGKPQQRRSRLKNSKSLSELEIDELKGFMDLGFVFNKEDLSPRTMSV  150

Query  475  VPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRM  296
            +PGLQRL   +   E   +      +            RPYLSEAWLI+ P+SPLLNLRM
Sbjct  151  IPGLQRLGEEEKYREEEEEEEAENEQVR----------RPYLSEAWLIRRPDSPLLNLRM  200

Query  295  PRASAAA-DVKRHLRHWAKTVATVIRQES  212
            P  +AA  ++KRHLR WA+TVA+VI QES
Sbjct  201  PPPTAAGTEMKRHLRSWARTVASVIHQES  229



>ref|XP_004137815.1| PREDICTED: uncharacterized protein LOC101215662 [Cucumis sativus]
Length=247

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRL------QLIKAKPERVLK  419
            SCKSLGELELEEVKGFMDLGF F +E  S + + +VPGLQRL      Q ++   +    
Sbjct  122  SCKSLGELELEEVKGFMDLGFEFKRESLSPQMVKLVPGLQRLRTQINKQNLEDDEDGDGD  181

Query  418  SWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
                  + +D+ + +R   RPYLSEAW+I+ PNSPLL+LRMP+ S+ +D+K+HLR WAKT
Sbjct  182  HDKENDDDDDDKNKKREIARPYLSEAWIIRRPNSPLLDLRMPKVSSTSDMKKHLRSWAKT  241

Query  238  VATVIR  221
            VA  I+
Sbjct  242  VAFEIQ  247



>ref|XP_004165143.1| PREDICTED: uncharacterized LOC101215662 [Cucumis sativus]
Length=274

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 15/175 (9%)
 Frame = -1

Query  718  ITSQDEDVEEEXEARQN---ETTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELE  548
            + SQ+    EE + +Q+   E +  + L  L  +  +  + ++S      CKSLGELELE
Sbjct  106  LVSQENYSNEEDKNKQDAKRELSEDQSLNGLKFSVGRKLNKSTS------CKSLGELELE  159

Query  547  EVKGFMDLGFIFDKERTSKKTMSVVPGLQRL------QLIKAKPERVLKSWNSQREHEDE  386
            EVKGFMDLGF F +E  S + + +VPGLQRL      Q ++   +          + +D+
Sbjct  160  EVKGFMDLGFEFKRESLSPQMVKLVPGLQRLRTQINKQNLEDDEDGDGDHDKENDDDDDD  219

Query  385  DDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
             + +R   RPYLSEAW+I+ PNSPLL+LRMP+ S+ +D+K+HLR WAKTVA  I+
Sbjct  220  KNKKREIARPYLSEAWIIRRPNSPLLDLRMPKVSSTSDMKKHLRSWAKTVAFEIQ  274



>ref|XP_010696407.1| PREDICTED: uncharacterized protein LOC104908935 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 100/165 (61%), Gaps = 26/165 (16%)
 Frame = -1

Query  661  TAKERLTRLDLAACKSQSHTSSPSLDR-------------------SCKSLGELELEEVK  539
              ++R +RL+L   K +S +SSPS+ R                   SC +L +LE EE+K
Sbjct  111  VGRKRPSRLNLITKKIRSQSSSPSIQRTRKSLSHSSYKGQKLQRFLSCSTLHDLEQEELK  170

Query  538  GFMDLGFIFDKERTSKKTMSVVPGLQRL--QLIKAKPERVLKSWNSQREHEDEDDMERGR  365
            GFMDLGF F++++ S +TM+VVPGLQR+   ++  K E    S    +E E ++     +
Sbjct  171  GFMDLGFEFEEDQLSPRTMTVVPGLQRIGGNVVTTKNENYGASTLDDKEVESDE-----K  225

Query  364  VRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
             +PYLSEAWL+K P+SPLL LRM R S A D+K+ L+ WA+TV T
Sbjct  226  TKPYLSEAWLVKRPDSPLLRLRMARVSTAEDMKKCLKLWARTVTT  270



>ref|XP_004304411.1| PREDICTED: uncharacterized protein LOC101305283 [Fragaria vesca 
subsp. vesca]
Length=294

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 111/214 (52%), Gaps = 36/214 (17%)
 Frame = -1

Query  754  MAGNDSSSTVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAA-----CKSQSHT----  602
            ++ N S+    EI S       E    Q+  T  +R TRLD+ A      +SQS +    
Sbjct  84   VSSNFSTMLEPEIPSPATPDSPEMSTPQDYET--KRPTRLDIVANRLMLIRSQSSSPISR  141

Query  601  ---SSPSLDRSCKSLGELEL--------------EEVKGFMDLGFIFDKERTSKKTMSVV  473
               SSP   R+   L   +L              EE+KG MDLGF F KE  + + MS+V
Sbjct  142  DQRSSPRKSRTSSGLLTRKLEKSMSMRSLGELELEELKGLMDLGFTFKKENLNPRMMSLV  201

Query  472  PGLQRLQLIKAKPERVLKSWNS------QREHEDEDDMERGRVRPYLSEAWLIKSPNSPL  311
            PGLQRL  +  +     K  NS              D E    RPYLSEAWLIK P+SPL
Sbjct  202  PGLQRLG-VGGRHSHSKKRQNSSDDDDVVEVVGGGGDEEGEVARPYLSEAWLIKRPDSPL  260

Query  310  LNLRMP-RASAAADVKRHLRHWAKTVATVIRQES  212
            LNLR+P R S+AAD+K+HL+ WA+TVA+ I+QES
Sbjct  261  LNLRLPTRVSSAADMKKHLKSWARTVASEIQQES  294



>gb|ACU23192.1| unknown [Glycine max]
Length=226

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 20/125 (16%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            RS KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL                 
Sbjct  118  RSSKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRL----------------G  161

Query  403  REHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
            +  E+E+D E   V RPYL EAW I   +   +PL+N ++P  +   D+K  LR WA+TV
Sbjct  162  KSDEEEEDFEGSSVQRPYLFEAWKIQERRKKENPLMNWKIPALNNEIDIKDSLRWWAQTV  221

Query  235  ATVIR  221
            A+ +R
Sbjct  222  ASTVR  226



>gb|AFK41563.1| unknown [Lotus japonicus]
Length=226

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 87/175 (50%), Gaps = 67/175 (38%)
 Frame = -1

Query  670  NETTAKERLTRLDLAACKS-QSHTSSPS--------------------LDRS--CKSLGE  560
            N+   KE   R+DL   ++  S +SSPS                    LD+S  C++LGE
Sbjct  96   NKEETKEGFARIDLLDTRTTHSCSSSPSTTQKRHRKFRKPATSSSTRKLDKSMSCRTLGE  155

Query  559  LELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDD  380
            LEL+EVKGFMDLGF+F KE  S + +SV+PGLQR                          
Sbjct  156  LELDEVKGFMDLGFMFKKEYISPRMISVLPGLQR--------------------------  189

Query  379  MERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
                              P+SPLLNL++P+  +A ++K+HL+ WAKTVA+ I+QE
Sbjct  190  ------------------PDSPLLNLKVPKHCSADNMKKHLKFWAKTVASEIQQE  226



>ref|XP_010246440.1| PREDICTED: uncharacterized protein LOC104589726 [Nelumbo nucifera]
Length=229

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 83/155 (54%), Gaps = 19/155 (12%)
 Frame = -1

Query  673  QNETTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTS  494
            ++ T   E +TR + A   ++  T       S KSL ELE EE+KGFMDLGFIF +    
Sbjct  90   KDATEVAEEITRHEEAEKPTKKATGRRRKRGSSKSLSELEFEELKGFMDLGFIFSEADKD  149

Query  493  KKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRV-RPYLSEAWLI---KS  326
               +S++PGLQR+                ++  ++E  ++   + RPYLSEAW +   + 
Sbjct  150  SSLVSIIPGLQRM---------------GKKGSDEEQTIDESTIPRPYLSEAWAVLDRRK  194

Query  325  PNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
              +PL N R+P A    D+K HLR WA TVA+ +R
Sbjct  195  ERNPLTNWRIPSARNEIDMKDHLRFWAHTVASTVR  229



>emb|CBI22018.3| unnamed protein product [Vitis vinifera]
Length=146

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 21/119 (18%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            +LE EE+KGFMDLGF+F +E  + K +S+VPGLQRL                 ++ ED +
Sbjct  44   DLEFEELKGFMDLGFVFSEEDKNSKLVSIVPGLQRL----------------GKKGEDGE  87

Query  382  DMERGRV-RPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            ++E+  V RPYLSEAW +    +     LLN R+P ++   D+K HLR WA TVA+ +R
Sbjct  88   NIEKSEVSRPYLSEAWGVLDRRRKEMDGLLNWRIPASANEMDMKDHLRLWAHTVASAVR  146



>ref|XP_011083310.1| PREDICTED: uncharacterized protein LOC105165845 [Sesamum indicum]
Length=250

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 81/156 (52%), Gaps = 38/156 (24%)
 Frame = -1

Query  649  RLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVP  470
            R++R   A C+    + S       +SL ELE EE+KGFMDLGF+F  E    + +S++P
Sbjct  120  RVSRTKHAGCRKIRRSGS-------RSLSELEFEELKGFMDLGFVFSDEDRDSRLVSIIP  172

Query  469  GLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRV------RPYLSEAW-------LIK  329
            GLQRL                 +  ++E   ERG        RPYLSEAW       ++K
Sbjct  173  GLQRL----------------GKNVQEESGKERGEAPSTAVSRPYLSEAWECLEDEKIVK  216

Query  328  SPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
              N+PL++ R+P      ++K HLR WA TVA+ +R
Sbjct  217  --NNPLIDWRIPAFGNETELKDHLRFWAHTVASAVR  250



>ref|XP_007159478.1| hypothetical protein PHAVU_002G240700g [Phaseolus vulgaris]
 gb|ESW31472.1| hypothetical protein PHAVU_002G240700g [Phaseolus vulgaris]
Length=250

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 20/126 (16%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E  +    S++PGLQRL                +
Sbjct  140  RDSKSLSDLEFEELKGFMDLGFVFSEEDKNTSLASIIPGLQRL---------------GK  184

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPN-----SPLLNLRMPRASAAADVKRHLRHWAKT  239
            +E E+ D  E    RPYLSEAW ++        +PL+N ++P  +   D+K  LR WA T
Sbjct  185  KEEEEGDCNELNVPRPYLSEAWEVQEYGRRKRENPLMNWKIPALNNETDMKDSLRWWAHT  244

Query  238  VATVIR  221
            VA+ +R
Sbjct  245  VASTVR  250



>ref|XP_007044083.1| Uncharacterized protein TCM_008922 [Theobroma cacao]
 gb|EOX99914.1| Uncharacterized protein TCM_008922 [Theobroma cacao]
Length=268

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 18/124 (15%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            S +SL ELE EE++GFMDLGF+F +E      +S++PGLQ+L                + 
Sbjct  159  SSRSLSELEFEELQGFMDLGFVFSEEDKDSSLVSIIPGLQKL--------------GKKT  204

Query  400  EHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            E   E+++ +  V RPYLSEAW +   +   +PL+N R+P      D+K HLR WA TVA
Sbjct  205  EESREENIGQTVVSRPYLSEAWEVWDRRKVKNPLMNWRIPTMGNEVDMKDHLRFWAHTVA  264

Query  232  TVIR  221
            + +R
Sbjct  265  STVR  268



>ref|XP_003527334.1| PREDICTED: uncharacterized protein LOC100800312 [Glycine max]
 gb|KHN33937.1| hypothetical protein glysoja_036744 [Glycine soja]
Length=243

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 77/136 (57%), Gaps = 13/136 (10%)
 Frame = -1

Query  619  KSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKA  440
            KS  H       R+ +SL ELE +E+KGFMDLGF+F +E    K  S++PGLQRL     
Sbjct  118  KSFGHGRRARKVRTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRLG----  173

Query  439  KPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADV  269
                  +  + + + +D+  +     +PYLSEAW +   +   +PLLN R+P      D+
Sbjct  174  ------REEDEEGQGDDQSVVSDNNNKPYLSEAWDVLDQREMGNPLLNWRVPARGNEIDM  227

Query  268  KRHLRHWAKTVATVIR  221
            K +LR WA TVA+++R
Sbjct  228  KDNLRFWAHTVASIVR  243



>ref|XP_006830214.1| hypothetical protein AMTR_s00130p00028330 [Amborella trichopoda]
 gb|ERM97630.1| hypothetical protein AMTR_s00130p00028330 [Amborella trichopoda]
Length=335

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 73/118 (62%), Gaps = 12/118 (10%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EE+KGF+DLGF F++   S +  S++PGLQR+   K K         ++++ 
Sbjct  230  KSLSELEFEELKGFIDLGFTFEESELSPRLKSIIPGLQRMVKTKEK--------ENEKQE  281

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            ED  ++ R    PYLSEAWL++ P S L+  ++P  S   D+K HL+ WA  VA+ +R
Sbjct  282  EDNKNISR----PYLSEAWLVRKPESKLIQWKIPELSQGMDMKEHLKLWAHNVASTVR  335



>ref|XP_004487581.1| PREDICTED: uncharacterized protein LOC101503885 [Cicer arietinum]
Length=252

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 90/154 (58%), Gaps = 17/154 (11%)
 Frame = -1

Query  664  TTAKERLTRLDLAACKSQSHTSSPSLDR---SCKSLGELELEEVKGFMDLGFIFDKERTS  494
            T AKE   +      K   HT    L +   + +SL ELE +E+KGFMDLGF+F +E   
Sbjct  110  THAKEDEEKEAFDTKKVSHHTQKTKLRKGKSTSRSLSELEFKELKGFMDLGFVFAEEDKD  169

Query  493  KKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAW-LIKSPN-  320
             + +S++PGLQ+L     K +  L    +++EH+ ++++     RPYLSEAW LI+    
Sbjct  170  SRLVSLIPGLQQL----GKDDSSL----NKKEHKIDENV---ICRPYLSEAWGLIEQTKE  218

Query  319  -SPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
             +PLLN R+P      D+K +L+ WA TVA+++R
Sbjct  219  FNPLLNWRVPILGNEIDMKDNLKFWAHTVASIVR  252



>ref|NP_001241326.1| uncharacterized protein LOC100807366 [Glycine max]
 gb|ACU20145.1| unknown [Glycine max]
 gb|KHN27955.1| hypothetical protein glysoja_007687 [Glycine soja]
Length=248

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 75/124 (60%), Gaps = 14/124 (11%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +SL +LE +E+KGFMDLGF+F +E    + +S++PGLQR           L   ++ 
Sbjct  136  KATRSLSDLEFKELKGFMDLGFVFSEEDKDSRLVSLIPGLQR-----------LGKEDAS  184

Query  403  REHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            R + +++  E    RPYLSEAW +   +   +PLLN R+P      D+K +LR WA TVA
Sbjct  185  RGNSEQNIDETVVCRPYLSEAWGVLDQRKVVNPLLNWRVPVVGNEIDMKDNLRFWAHTVA  244

Query  232  TVIR  221
            +++R
Sbjct  245  SIVR  248



>ref|XP_008790021.1| PREDICTED: uncharacterized protein LOC103707351 [Phoenix dactylifera]
Length=252

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 71/119 (60%), Gaps = 11/119 (9%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKP---ERVLKSWNSQRE  398
            L EL+ EEVKGFMDLGF F +     + +S+VPGLQ  QL K +P   E+  +  +   E
Sbjct  142  LSELQFEEVKGFMDLGFTFSEAEADPRLISIVPGLQ--QLGKREPGDGEQAAEGSSCASE  199

Query  397  HEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
              DE  +     RPYLSEAW   +P + L+N R+P+A+    +K HLR WA  VA+ +R
Sbjct  200  EVDESAIS----RPYLSEAW--DAPENKLVNWRIPKAADGVVLKDHLRSWAHAVASTVR  252



>ref|NP_001241436.1| uncharacterized protein LOC100811994 [Glycine max]
 gb|ACU17998.1| unknown [Glycine max]
 gb|KHN34248.1| hypothetical protein glysoja_035883 [Glycine soja]
Length=241

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 75/140 (54%), Gaps = 23/140 (16%)
 Frame = -1

Query  619  KSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKA  440
            K   H   P   R+ +SL ELE +E+KGFMDLGF+F +E    K  S++PGLQRL     
Sbjct  118  KGFGHGRRPRQVRTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRL-----  172

Query  439  KPERVLKSWNSQREHE----DEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASA  281
                        RE +    D+  +     +PYLSEAW +   +   +PLLN R+P    
Sbjct  173  -----------GREDDEVQCDDQSVVSDNNKPYLSEAWDVLDQRELRNPLLNWRVPARGN  221

Query  280  AADVKRHLRHWAKTVATVIR  221
              D+K +LR WA TVA+++R
Sbjct  222  EIDMKDNLRFWAHTVASIVR  241



>ref|XP_010274414.1| PREDICTED: uncharacterized protein LOC104609737 [Nelumbo nucifera]
Length=232

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 68/117 (58%), Gaps = 18/117 (15%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            +LE EE+KGFMDLGF+F +E      +S++PGLQRL                +++ E+E 
Sbjct  131  DLEFEELKGFMDLGFVFSEEDKDSSLVSIIPGLQRL---------------GKKDVEEEA  175

Query  382  DMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
              E    RPYLSEAW +   +   +PL+N R+P   +  D+K HLR WA TVA+ +R
Sbjct  176  IDESTIPRPYLSEAWGVLDQRKERNPLMNWRIPPLGSETDMKDHLRFWAHTVASTVR  232



>ref|XP_010317344.1| PREDICTED: uncharacterized protein LOC104646047 [Solanum lycopersicum]
Length=225

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 16/127 (13%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KS+ ELE EE+KGFMDLGF F +E  +   + ++PGLQ+L+          K+ +S  + 
Sbjct  107  KSISELEYEELKGFMDLGFEFSEEDVNSSLIELIPGLQKLR----------KNRDSDDDQ  156

Query  394  EDEDDMERG---RVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            +  +  E+    R RPYLSEAW +   K    PL+N ++P  S   D+K  L+ WA TVA
Sbjct  157  QKVNFFEKSDQLRARPYLSEAWGVIEKKRKKKPLMNWKLPETSNEIDIKHSLKWWAHTVA  216

Query  232  TVIRQES  212
            + ++Q +
Sbjct  217  SSVKQHN  223



>ref|XP_011082982.1| PREDICTED: uncharacterized protein LOC105165613 [Sesamum indicum]
Length=250

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 77/148 (52%), Gaps = 22/148 (15%)
 Frame = -1

Query  649  RLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVP  470
            R++R   A C+    + S       +SL ELE EE+KGFMDLGF+F  E    + +S++P
Sbjct  120  RVSRTKHAGCRKIRRSGS-------RSLSELEFEELKGFMDLGFVFSDEDRDSRLVSIIP  172

Query  469  GLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLI-----KSPNSPLLN  305
            GLQRL           K+   +   E  +       RPYLSEAW       +  N+PL++
Sbjct  173  GLQRLG----------KNVQEESGKECREASWTAVSRPYLSEAWECLEDEKEVKNNPLID  222

Query  304  LRMPRASAAADVKRHLRHWAKTVATVIR  221
             R+P      ++K HLR WA TVA+ +R
Sbjct  223  WRIPAFGNETELKDHLRFWAHTVASTVR  250



>gb|KJB57387.1| hypothetical protein B456_009G161100 [Gossypium raimondii]
Length=247

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 12/124 (10%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            + KSL +LE EE+KGFMDLGF+F +E     + + ++PGLQRL     + E         
Sbjct  132  TSKSLSDLEFEELKGFMDLGFVFSEEDNKDSRLVEIIPGLQRLGRKDGEEE--------N  183

Query  403  REHEDEDDMERGRV-RPYLSEAWLI--KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            +E    +D +R  V RPYLSEAW +  +   +PL+N R+P      DVK  LR WA TVA
Sbjct  184  KEAAGAEDDDRDEVSRPYLSEAWHVSERRKENPLMNWRVPALGNEVDVKDSLRWWAHTVA  243

Query  232  TVIR  221
            + ++
Sbjct  244  STVK  247



>ref|XP_007149725.1| hypothetical protein PHAVU_005G093900g [Phaseolus vulgaris]
 gb|ESW21719.1| hypothetical protein PHAVU_005G093900g [Phaseolus vulgaris]
Length=247

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 75/126 (60%), Gaps = 16/126 (13%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            +++ +SL +LE +E+KGFMDLGF+F ++    + +S++PGLQRL    A           
Sbjct  134  EKASRSLSDLEFKELKGFMDLGFVFSEKDKDSRLVSLIPGLQRLGREDAG----------  183

Query  406  QREHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
              E   + D++   + RPYLSEAW +   K   +PLLN R+P      D+K +LR WA T
Sbjct  184  --EVSSQHDIDETVICRPYLSEAWGVLDQKKAVNPLLNWRVPVVGNEIDMKDNLRFWAHT  241

Query  238  VATVIR  221
            VA+++R
Sbjct  242  VASIVR  247



>ref|XP_004504284.1| PREDICTED: uncharacterized protein LOC101494080 [Cicer arietinum]
Length=245

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 17/125 (14%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E      +S++PGLQRL     K E V       
Sbjct  134  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLVSIIPGLQRL---GKKDEEV-------  183

Query  403  REHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
               E E+  +   V RPYLSEAW     +    PL+N ++P  +   D+K  LR WA TV
Sbjct  184  ---EKENVFDECLVQRPYLSEAWEFHDRRKKEYPLMNWKVPAMNNEIDMKNSLRLWAHTV  240

Query  235  ATVIR  221
            A+ +R
Sbjct  241  ASSVR  245



>ref|XP_002277325.1| PREDICTED: uncharacterized protein LOC100266042 [Vitis vinifera]
Length=244

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 76/125 (61%), Gaps = 11/125 (9%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            S KSL ELELEEVKGFMDLGF+F +E  +   +S+VPGL+RL        +         
Sbjct  126  SRKSLSELELEEVKGFMDLGFVFSEEDKNSWLVSIVPGLKRLG------RKSTSGGEDHD  179

Query  400  EHEDEDDMERGRV-RPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
            E ED +++E+  V RPYLSEAW +    +     LLN R+P ++   D+K HLR WA TV
Sbjct  180  EEEDGENIEKSEVSRPYLSEAWGVLDRRRKEMDGLLNWRIPASANEMDMKDHLRLWAHTV  239

Query  235  ATVIR  221
            A+ +R
Sbjct  240  ASAVR  244



>ref|XP_009591668.1| PREDICTED: uncharacterized protein LOC104088654 [Nicotiana tomentosiformis]
Length=228

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 71/121 (59%), Gaps = 12/121 (10%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EE+KGFMDLGF F +E  +   + V+PGLQ+L   +   ++V  +   + E 
Sbjct  116  KSLSELEYEELKGFMDLGFEFSEEDVNSSLVEVIPGLQKLGKNRDSGDQVKVNCFEKSE-  174

Query  394  EDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
                     R RPYLSEAW I   K+  S L+N ++P  S   DVKR L+ WA TVA+ +
Sbjct  175  --------SRARPYLSEAWEILEKKNRMSTLMNWKIPATSNEIDVKRSLKRWAHTVASTV  226

Query  223  R  221
            +
Sbjct  227  K  227



>ref|XP_002316812.1| hypothetical protein POPTR_0011s07010g [Populus trichocarpa]
 gb|EEE97424.1| hypothetical protein POPTR_0011s07010g [Populus trichocarpa]
Length=234

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 68/121 (56%), Gaps = 20/121 (17%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + KSL ELE EE+KGF DLGF+F +E       S++PGLQRL                 +
Sbjct  127  ASKSLSELEYEELKGFTDLGFVFSEEDKDSNLASIIPGLQRL----------------GK  170

Query  400  EHEDEDDMERGRV-RPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            +HEDE  ++   V RPYLSEAW ++       PL+N  +P  S   D+K +LR WA TVA
Sbjct  171  QHEDETVLDEPTVSRPYLSEAWEVQEQRMKEEPLMNWAIPALSNEIDMKDNLRWWAHTVA  230

Query  232  T  230
            +
Sbjct  231  S  231



>ref|XP_003546042.1| PREDICTED: uncharacterized protein LOC100782674 [Glycine max]
 gb|KHN28636.1| hypothetical protein glysoja_040504 [Glycine soja]
Length=226

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 71/124 (57%), Gaps = 18/124 (15%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            RS KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL                +
Sbjct  118  RSSKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRL---------------GK  162

Query  403  REHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
             + E+ED       RPYLSEAW I   +   +PL+N ++P  +   D+K  LR WA+TVA
Sbjct  163  SDEEEEDSEGSSVQRPYLSEAWKIQERRKKENPLMNWKIPALNNEIDIKDSLRWWAQTVA  222

Query  232  TVIR  221
            + +R
Sbjct  223  STVR  226



>ref|XP_010279224.1| PREDICTED: uncharacterized protein LOC104613196 [Nelumbo nucifera]
Length=282

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 21/123 (17%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            +S KSL +LE EE++GF DLGF F+KE  S   ++++P L+         E+  ++W   
Sbjct  180  KSRKSLSDLEFEELQGFKDLGFTFNKEDLSPTVVNIIPALK---------EKTQQNW---  227

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
                DED+  R   RPYLSEAWL++   SP+ N     + +A D+K HL+ WA+ VA+ +
Sbjct  228  ----DEDNKVR---RPYLSEAWLVQRSASPMPNWV--HSESAGDMKAHLKFWARVVASNV  278

Query  223  RQE  215
            RQE
Sbjct  279  RQE  281



>ref|XP_009766224.1| PREDICTED: uncharacterized protein LOC104217628 [Nicotiana sylvestris]
Length=235

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 75/125 (60%), Gaps = 11/125 (9%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EE+KGFMDLGF F +E  +   + V+PGLQ+L   ++  ++       +   
Sbjct  116  KSLSELEYEELKGFMDLGFEFSEEDVNSSLVEVIPGLQKLGKNRSSNDQ------EKVNF  169

Query  394  EDEDDMERGRVRPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
             ++ D+    +RPYLSEAW +    K  NS L+N R+P  S   DVK  L+ WA TVA+ 
Sbjct  170  LEKSDLHSRAIRPYLSEAWEVFERKKKMNS-LMNWRIPATSNEIDVKHSLKWWAHTVASS  228

Query  226  IRQES  212
            ++Q++
Sbjct  229  VKQQN  233



>ref|XP_002277345.1| PREDICTED: uncharacterized protein LOC100260838 [Vitis vinifera]
Length=232

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 68/119 (57%), Gaps = 18/119 (15%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            +LE EE+KGFMDLGF+F +E  + K +S+VPGLQRL                  E ++E+
Sbjct  127  DLEFEELKGFMDLGFVFSEEDKNSKLVSIVPGLQRLG-------------KKGGEDDEEE  173

Query  382  DMERGRV-RPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            D +   V RPYLSEAW +    +    PLLN R+P      D+K HLR WA  VA+ +R
Sbjct  174  DAKIVSVSRPYLSEAWDVMDRRRKEVDPLLNWRIPDFGDEMDMKEHLRFWAHMVASAVR  232



>ref|XP_011098377.1| PREDICTED: uncharacterized protein LOC105177052 [Sesamum indicum]
Length=208

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 98/189 (52%), Gaps = 35/189 (19%)
 Frame = -1

Query  751  AGNDSSS-------TVDEITSQDEDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSP  593
            AGN +SS        + +I S  E+V+   EA + +        R++ +  K Q  T + 
Sbjct  43   AGNSTSSRSVIIKPKLQKILSGKEEVDFSREAAEQD--------RVEKSNGKKQCRTGNQ  94

Query  592  SLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSW  413
                  +S   LE EEVKGF+DLGF+F +E  S   +S++PGLQ+   +    E+V    
Sbjct  95   ERKGMRRSSSALEFEEVKGFIDLGFVFTEEDKSSGLVSIIPGLQKCGKMAEDREKV----  150

Query  412  NSQREHEDEDDMERGRV-RPYLSEAWLIKS----PNSPLLNLRMPRASAAADVKRHLRHW  248
                   +E+D    RV RPYLSE W + +     N+ L+N R+P +     +K+HL+ W
Sbjct  151  -------EEND----RVSRPYLSEGWGVPNQRMGSNNHLMNWRIPSSENEIRMKKHLKVW  199

Query  247  AKTVATVIR  221
            A+TVA+ +R
Sbjct  200  AQTVASFVR  208



>ref|XP_010999777.1| PREDICTED: uncharacterized protein LOC105107522 [Populus euphratica]
Length=235

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 67/123 (54%), Gaps = 18/123 (15%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + KSL ELE EE+KGFMDLGF+F +E       S++PGL RL                ++
Sbjct  128  TSKSLSELEYEELKGFMDLGFVFSEEDKDSNLASIIPGLHRL---------------GKK  172

Query  400  EHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
            + E+    E    RPYLSEAW +   K    PL+N R+P      D+K +LR WA TVA+
Sbjct  173  DEEEAILDEPTVCRPYLSEAWEVLEKKRKEEPLMNWRVPALGNEIDMKDNLRWWAHTVAS  232

Query  229  VIR  221
             +R
Sbjct  233  TVR  235



>gb|AFK40408.1| unknown [Medicago truncatula]
Length=180

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E      + ++PGLQRL     K        N +
Sbjct  67   RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLVEIIPGLQRL----GKK-------NDE  115

Query  403  REHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
             E E+ED  +   V RPYLSEAW +   +    PL+N ++P  +   D+K  LR WA+TV
Sbjct  116  EEEEEEDVYDESVVQRPYLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTV  175

Query  235  ATVIR  221
            A+ +R
Sbjct  176  ASTVR  180



>ref|XP_010915479.1| PREDICTED: programmed cell death protein 7-like [Elaeis guineensis]
Length=263

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 70/127 (55%), Gaps = 14/127 (11%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQREH  395
            SL ELE EEVKGFMDLGF F +   + + +S+VPGLQRL +      E   +  +   E 
Sbjct  141  SLPELESEEVKGFMDLGFTFSEAEVNPRLLSIVPGLQRLGKRAAGDSEPAAEGSSCTSEE  200

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNS---------PLLNLRMPRASAAADVKRHLRHWAK  242
             DE  +    +RPYLSEAW  +             PL N R+P+A+   D+K HLR WA 
Sbjct  201  VDESAI----LRPYLSEAWDAQQEEEAAAAVAALKPLKNWRIPKAADGVDLKDHLRSWAH  256

Query  241  TVATVIR  221
             VA+ +R
Sbjct  257  AVASTVR  263



>ref|XP_002522240.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40098.1| conserved hypothetical protein [Ricinus communis]
Length=292

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (58%), Gaps = 13/123 (11%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL ELE EEVKGFMDLGF+F +E      +S++PGLQRL           K    +++
Sbjct  179  SKSLSELEFEEVKGFMDLGFVFSEEDKDSSLVSIIPGLQRLG---------NKDQEEEKK  229

Query  397  HEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
             E     + G V RPYLSEAW     +    PL+N R+P ++   D+K +L+ WA TVA+
Sbjct  230  EEKNSAFDEGAVSRPYLSEAWEALDNRKKEEPLMNWRIPASTNEIDMKYNLKWWAHTVAS  289

Query  229  VIR  221
             +R
Sbjct  290  TVR  292



>gb|KDP21126.1| hypothetical protein JCGZ_21597 [Jatropha curcas]
Length=237

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 67/126 (53%), Gaps = 21/126 (17%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL ELE EEVKGFMDLGF+F +E      +S++PGLQRL                +  
Sbjct  126  SKSLSELEFEEVKGFMDLGFVFSEEDKDSSLVSIIPGLQRL--------------GKKDG  171

Query  397  HEDEDDMERGRV--RPYLSEAWL-----IKSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
             ED    ++  +  RPYLSEAW       K    PL+N R+P      D+K +L+ WA T
Sbjct  172  EEDSSGGDKAAIVSRPYLSEAWERLELDRKRKEDPLMNWRIPAVGNEIDMKDNLKWWAHT  231

Query  238  VATVIR  221
            VA+ +R
Sbjct  232  VASTVR  237



>ref|XP_009804439.1| PREDICTED: uncharacterized protein LOC104249662 [Nicotiana sylvestris]
Length=227

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 71/121 (59%), Gaps = 12/121 (10%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EE+KGFMDLGF F  +  +   + ++PGLQ+L   +   ++V  ++  + E 
Sbjct  115  KSLSELEYEELKGFMDLGFDFSADDVNSSLVEIIPGLQKLGKNRDSDDQVKVNYFEKSE-  173

Query  394  EDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
                     R RPYLSEAW I   K+  S L+N ++P  S   DVK+ L+ WA TVA+ +
Sbjct  174  --------SRARPYLSEAWEILEKKNRMSTLMNWKIPATSNEIDVKQSLKRWAHTVASTV  225

Query  223  R  221
            +
Sbjct  226  K  226



>gb|AFK43794.1| unknown [Lotus japonicus]
Length=248

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 18/165 (11%)
 Frame = -1

Query  706  DEDVEEEXEARQNETTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMD  527
            D + EE    + +E    E+    +  +C+ +        +R  KSL +LE EE+KGFMD
Sbjct  99   DSEAEETPVVQHHEVLLSEKNNNGNSTSCEKKKK------NRGSKSLSDLEFEELKGFMD  152

Query  526  LGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLS  347
            LGF+F  E  +    S++PGLQRL           K      E E+ED  E    RPYLS
Sbjct  153  LGFVFSLEDKNSSLASIIPGLQRLG---------KKEEEQGEEEEEEDSNESLVPRPYLS  203

Query  346  EAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            EAW     +   +PL+N ++P      D+K  LR WA TVA+ +R
Sbjct  204  EAWEFHGKRKKENPLMNWKVPSLKKEIDMKDSLRLWAHTVASTVR  248



>ref|XP_008381194.1| PREDICTED: uncharacterized protein LOC103444064 [Malus domestica]
Length=259

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 11/124 (9%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGFMDLGF+F +E + S + +S++PGLQRL   + +  R     + Q+E
Sbjct  141  KSLSELEFEELKGFMDLGFVFTEEDKDSSRLVSIIPGLQRLASCEEEDIR-----DYQKE  195

Query  397  HEDEDDMERGRVRPYLSEAWLI----KSPNSPLLNLRMPRAS-AAADVKRHLRHWAKTVA  233
             E+E+D      RPYLSEAW +    K  N  L+  R+P A+    D+K HLR WA +VA
Sbjct  196  EEEEEDHGVVSRRPYLSEAWDVLDQRKKENQMLMKWRIPAATNLGKDMKHHLRFWAHSVA  255

Query  232  TVIR  221
            + +R
Sbjct  256  SSVR  259



>ref|XP_008439724.1| PREDICTED: uncharacterized protein LOC103484438 [Cucumis melo]
 gb|ADN34031.1| hypothetical protein [Cucumis melo subsp. melo]
Length=212

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 77/126 (61%), Gaps = 13/126 (10%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EEVKGF DLGF+F +E  + +  SV+PGL RL   + + E+       +R  
Sbjct  92   KSLSELEFEEVKGFKDLGFVFTEEDRNSELASVIPGLNRLGSEEEEKEKE-----EKRTL  146

Query  394  EDEDDMERGRVRPYLSEAWLIKSPN-------SPLL-NLRMPRASAAADVKRHLRHWAKT  239
            +D+DD E    RPYLSE W + + +       +PLL N ++P  ++  D+K++LR WA T
Sbjct  147  DDDDDEESRVSRPYLSEVWEVLAMDRRREEIINPLLKNWKLPSFNSEIDMKQNLRWWAHT  206

Query  238  VATVIR  221
            VA+ +R
Sbjct  207  VASTVR  212



>ref|XP_002305058.2| hypothetical protein POPTR_0004s05860g [Populus trichocarpa]
 gb|ABK93152.1| unknown [Populus trichocarpa]
 gb|EEE85569.2| hypothetical protein POPTR_0004s05860g [Populus trichocarpa]
Length=235

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 18/123 (15%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + KSL ELE EE++GFMDLGF+F +E       S++PGL RL                ++
Sbjct  128  TSKSLSELEYEELRGFMDLGFVFSEEDKDSNLASIIPGLHRL---------------GKK  172

Query  400  EHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
            + E+    E    RPYLSEAW +   K    PL+N R+P      D+K +LR WA TVA+
Sbjct  173  DEEEAILDEPTVCRPYLSEAWEVLEKKRKEEPLMNWRIPALGNEIDMKDNLRWWAHTVAS  232

Query  229  VIR  221
             +R
Sbjct  233  TVR  235



>ref|XP_008371722.1| PREDICTED: uncharacterized protein LOC103435110 [Malus domestica]
Length=229

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 69/122 (57%), Gaps = 17/122 (14%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL +L+ EE+KGFMDLGF+F +E      +S++PGLQRL           K  +S+ E
Sbjct  122  SKSLTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLG----------KKDDSRYE  171

Query  397  HEDEDDMERGRVRPYLSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
              DE  +     RPYLSEAW ++       PL+N R P      D+K +L+ WA TVA+ 
Sbjct  172  SFDESAIS----RPYLSEAWEVREKRKREKPLMNWRFPALENEIDMKDNLKWWAHTVASA  227

Query  226  IR  221
            +R
Sbjct  228  VR  229



>ref|XP_003629806.1| hypothetical protein MTR_8g086820 [Medicago truncatula]
Length=242

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E      + ++PGLQRL     K        N +
Sbjct  129  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLVEIIPGLQRL----GKK-------NEE  177

Query  403  REHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
             E E+ED  +   V RPYLSEAW +   +    PL+N ++P  +   D+K  LR WA+TV
Sbjct  178  EEEEEEDVYDESVVQRPYLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTV  237

Query  235  ATVIR  221
            A+ +R
Sbjct  238  ASTVR  242



>ref|XP_009365283.1| PREDICTED: uncharacterized protein LOC103955136 [Pyrus x bretschneideri]
Length=254

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 78/124 (63%), Gaps = 11/124 (9%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KS+ ELE EE+KGFMDLGF+F +E + S + +S++PGLQRL   + +  R     + Q+E
Sbjct  136  KSMSELEFEELKGFMDLGFVFTEEDKDSSRLVSIIPGLQRLASCEEEDVR-----DYQKE  190

Query  397  HEDEDDMERGRVRPYLSEAWLI----KSPNSPLLNLRMPRAS-AAADVKRHLRHWAKTVA  233
             E+E+D      RPYLSEAW +    K  N  L+  R+P A+    D+K HLR WA +VA
Sbjct  191  EEEEEDHGVVSRRPYLSEAWDVLDQRKKENQMLMKWRIPPATNLGKDMKHHLRFWAHSVA  250

Query  232  TVIR  221
            + +R
Sbjct  251  SSVR  254



>gb|AET04282.2| DUF1685 family protein [Medicago truncatula]
Length=242

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E      + ++PGLQRL     K        N +
Sbjct  129  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLVEIIPGLQRL----GKK-------NEE  177

Query  403  REHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
             E E+ED  +   V RPYLSEAW +   +    PL+N ++P  +   D+K  LR WA+TV
Sbjct  178  EEEEEEDVYDESVVQRPYLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTV  237

Query  235  ATVIR  221
            A+ +R
Sbjct  238  ASTVR  242



>ref|XP_007216770.1| hypothetical protein PRUPE_ppa024447mg [Prunus persica]
 gb|EMJ17969.1| hypothetical protein PRUPE_ppa024447mg [Prunus persica]
Length=265

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 73/130 (56%), Gaps = 23/130 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE +E+KGFMDLGF+F +E    K +S++PGLQRL  I  +           R+ 
Sbjct  147  KSLSDLEFDELKGFMDLGFVFTEEDKDSKLVSIIPGLQRLGSIGEQ----------DRDE  196

Query  394  EDEDDMERGRV---------RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRH  251
            ED  +     +         RPYLSEAW     ++  + L+N R+P A+   D+K +LR 
Sbjct  197  EDRRNNNHNNIDPSSHHVVSRPYLSEAWDALDQRNKENKLVNWRIP-ANLGKDMKHNLRF  255

Query  250  WAKTVATVIR  221
            WA TVA+ +R
Sbjct  256  WAHTVASTVR  265



>ref|XP_011039395.1| PREDICTED: uncharacterized protein LOC105135974 [Populus euphratica]
Length=234

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 68/124 (55%), Gaps = 20/124 (16%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + KSL ELE EE+KGF DLGF+F +E       S++PGLQRL                 +
Sbjct  127  TSKSLSELEYEELKGFTDLGFVFSEEDKDSNLASIIPGLQRL----------------GK  170

Query  400  EHEDEDDMERGRV-RPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            +HED   ++   V RPYLSEAW ++       PL+N  +P  S   D+K +LR WA TVA
Sbjct  171  QHEDGTVLDEPTVSRPYLSEAWEVQEQRMKEEPLMNWAIPALSNEIDMKDNLRWWAHTVA  230

Query  232  TVIR  221
            +  +
Sbjct  231  SAAK  234



>ref|XP_002269394.1| PREDICTED: uncharacterized protein LOC100266883 [Vitis vinifera]
Length=230

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 72/122 (59%), Gaps = 19/122 (16%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE +E+KGF+DLGF+F +       +S++PGL RL                +++ 
Sbjct  124  KSLSDLEFDELKGFIDLGFVFSEGAKDSSLVSIIPGLHRL---------------GKKDG  168

Query  394  EDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
            E+E  ++   V RPYLSEAW +   +   +PL+N R+P  S+  D+K +LR WA TVA+ 
Sbjct  169  EEEKTVDESAVPRPYLSEAWEVLDRRKKENPLMNWRVPALSSEIDMKDNLRSWAHTVASS  228

Query  226  IR  221
            +R
Sbjct  229  VR  230



>ref|XP_011101455.1| PREDICTED: uncharacterized protein LOC105179506 [Sesamum indicum]
Length=223

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 66/123 (54%), Gaps = 25/123 (20%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL ELE EE+KGFMDLGF+F +E      + ++PGLQRL                   
Sbjct  122  SKSLSELEFEELKGFMDLGFVFSEEDRESGLVEIIPGLQRL-------------------  162

Query  397  HEDEDDMERGRVRPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
                D  +  ++RPYLSEAW +    +   SPL+  R+P  S   D+K +L+ WA TVA+
Sbjct  163  --GADGRKEEKLRPYLSEAWEVLNRRREIESPLMKWRVPAVSNEIDMKDNLKWWAHTVAS  220

Query  229  VIR  221
             +R
Sbjct  221  AVR  223



>ref|XP_007132824.1| hypothetical protein PHAVU_011G127600g [Phaseolus vulgaris]
 gb|ESW04818.1| hypothetical protein PHAVU_011G127600g [Phaseolus vulgaris]
Length=235

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 74/124 (60%), Gaps = 16/124 (13%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            +R+ +SL ELE +E+KGFMDLGF+F +E    K +S++PGLQRL   + + +   +S  S
Sbjct  123  ERTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLVSLIPGLQRLGRDEDEGQDDDESVVS  182

Query  406  QREHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTV  236
                   D+M      PYLSEAW +   +   +PLLN R+P      D+K +LR WA TV
Sbjct  183  -------DNM------PYLSEAWDVLDQREMRNPLLNWRVPAMGDEIDMKDNLRFWAHTV  229

Query  235  ATVI  224
            A+ I
Sbjct  230  ASSI  233



>gb|KGN49319.1| hypothetical protein Csa_6G519700 [Cucumis sativus]
Length=211

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 76/126 (60%), Gaps = 14/126 (11%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EEVKGF DLGF+F +E  + +  SV+PGL RL   + + ER       ++  
Sbjct  92   KSLSELEFEEVKGFKDLGFVFSEEDRNSELASVIPGLNRLGSEEEEKER------EEKRS  145

Query  394  EDEDDMERGRVRPYLSEAWLIKSPN-------SPLL-NLRMPRASAAADVKRHLRHWAKT  239
             D+DD E    RPYLSE W + + +       SPLL N ++P  ++  D+K++LR WA T
Sbjct  146  LDDDDEESRVSRPYLSEVWEVLAMDRRREEIISPLLKNWKLPSFNSEIDMKQNLRWWAHT  205

Query  238  VATVIR  221
            VA+ +R
Sbjct  206  VASTVR  211



>ref|XP_004485927.1| PREDICTED: uncharacterized protein LOC101512973 [Cicer arietinum]
Length=235

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 17/150 (11%)
 Frame = -1

Query  661  TAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTM  482
            T  E  T   L     ++ T S    R  KSL +LE EEVKGFMDLGF+F +E      +
Sbjct  100  TETENQTPEQLHVLSKKNMTRSGRRKRESKSLSDLEFEEVKGFMDLGFVFSEEDKDSNLV  159

Query  481  SVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKS---PNSPL  311
            S++PGLQRL                  E E++   E    RPYLSEAW ++        +
Sbjct  160  SIIPGLQRL--------------GKNGEGEEDSCDESAIQRPYLSEAWKVQEMRRKEKLM  205

Query  310  LNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            +N ++P  +   D+K  L+ WA  VA+ +R
Sbjct  206  MNWKIPAPTNEVDMKYSLKCWAHNVASTVR  235



>ref|XP_010100736.1| hypothetical protein L484_005803 [Morus notabilis]
 gb|EXB84039.1| hypothetical protein L484_005803 [Morus notabilis]
Length=248

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 11/124 (9%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL     + E        ++E 
Sbjct  130  KSLSDLEFEELKGFMDLGFVFSEEDRESSLASIIPGLQRLGKNNKELEEE-----KEKEE  184

Query  394  EDEDDMERGRV--RPYLSEAW----LIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            E++ D   G V  RPYLSEAW    L     +PL+N R+P +    D+K +LR WA TVA
Sbjct  185  EEKRDFANGSVISRPYLSEAWEVFDLRPKRENPLMNWRIPASENEIDMKDNLRWWAHTVA  244

Query  232  TVIR  221
            + +R
Sbjct  245  STVR  248



>ref|XP_008225325.1| PREDICTED: uncharacterized protein LOC103324979 [Prunus mume]
Length=234

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 19/123 (15%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRLQLIKAKPERVLKSWNSQR  401
             KSL +L+ EE+KGFMDLGF+F +E      + S++PGLQRL                ++
Sbjct  127  SKSLTDLQFEELKGFMDLGFVFSEEDKEDSNLASIIPGLQRL---------------GKK  171

Query  400  EHEDEDDMERGRVRPYLSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
            + +DE   E    RPYLSEAW ++       PL+N R P      D+K +LR WA TVA+
Sbjct  172  DGQDEVFDESAIPRPYLSEAWKVRDQRKREKPLMNWRFPALGNEIDMKDNLRWWAHTVAS  231

Query  229  VIR  221
             +R
Sbjct  232  TVR  234



>ref|XP_010059035.1| PREDICTED: uncharacterized protein LOC104446943 [Eucalyptus grandis]
Length=263

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGFMDLGF+F +E R     +S++PGLQRL       +   +  +  RE
Sbjct  139  KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSIIPGLQRLGKKIKDGDEDDEDGDHHRE  198

Query  397  HEDEDDM--ERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
              DE ++  E    RPYLSEAW     K    PL+N ++P      D++  L+ WA TVA
Sbjct  199  DGDEKEIVGEPAVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMRESLKWWAHTVA  258

Query  232  -TVIR  221
             TV+R
Sbjct  259  STVVR  263



>ref|XP_008460386.1| PREDICTED: uncharacterized protein LOC103499218 [Cucumis melo]
Length=207

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 22/126 (17%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
             KSL ELE EE+KGFMDLGF+F +E +      S++PGLQR+                Q+
Sbjct  97   SKSLSELEFEELKGFMDLGFVFSEEDKNDTNLASIIPGLQRI---------------GQK  141

Query  400  EHEDEDDMERGRV-RPYLSEAWL-IKSPNSP---LLNLRMPRASAA-ADVKRHLRHWAKT  239
            + E +  +E G + RPYLSEAW  ++  N     L+  R+P   A   D+K HL+ WA T
Sbjct  142  KEEKQKQIEDGILKRPYLSEAWEDVEKENDKKRILMKWRIPSLGATEMDIKHHLKSWAHT  201

Query  238  VATVIR  221
            VA+ +R
Sbjct  202  VASTVR  207



>ref|XP_007213349.1| hypothetical protein PRUPE_ppa1027161mg [Prunus persica]
 gb|EMJ14548.1| hypothetical protein PRUPE_ppa1027161mg [Prunus persica]
Length=226

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 20/122 (16%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +L+ EE+KGFMDLGF+F +E +      S++PGLQRL                 ++
Sbjct  121  KSLTDLQFEELKGFMDLGFVFSEEDKEDSNLASIIPGLQRL----------------GKD  164

Query  397  HEDEDDMERGRVRPYLSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
             +DE   E    RPYLSEAW ++       PL+N R P      D+K +LR WA TVA+ 
Sbjct  165  GQDEVFDESAIPRPYLSEAWKVRDQRKREKPLMNWRFPALGNEIDMKDNLRWWAHTVAST  224

Query  226  IR  221
            +R
Sbjct  225  VR  226



>ref|XP_003524968.1| PREDICTED: uncharacterized protein LOC100792716 [Glycine max]
Length=237

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 68/126 (54%), Gaps = 17/126 (13%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL   + + E         
Sbjct  124  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKKEEEKEEDDDC----  179

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPN-----SPLLNLRMPRASAAADVKRHLRHWAKT  239
                     E    RPYLSEAW ++  +     +PL+N +MP  +   D+K  LR WA T
Sbjct  180  --------DEISVPRPYLSEAWEVQECDRRKKENPLVNWKMPAINNETDMKESLRWWAHT  231

Query  238  VATVIR  221
            VA+ +R
Sbjct  232  VASTVR  237



>emb|CDO96846.1| unnamed protein product [Coffea canephora]
Length=253

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 69/122 (57%), Gaps = 14/122 (11%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGFMDLGF+F +E +     + ++PGLQRL   K   E        QR 
Sbjct  142  KSLSELEFEELKGFMDLGFVFSEEDKNDSSLLEIIPGLQRLGREKDVGE--------QRR  193

Query  397  HEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
            +   D  E    RPYLSEAW +   ++  +PL+N ++P  S    +K  L+ WA  VA+ 
Sbjct  194  NSAPD--ESSVTRPYLSEAWEVLDRRNRENPLMNWKVPAVSNETGMKNSLKWWAHVVAST  251

Query  226  IR  221
            +R
Sbjct  252  VR  253



>ref|XP_009353410.1| PREDICTED: uncharacterized protein LOC103944673 [Pyrus x bretschneideri]
Length=229

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 17/119 (14%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHED  389
            L +L+ EE+KGFMDLGF+F +E      +S++PGLQRL           K  +S+ E  D
Sbjct  125  LTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLG----------KKDDSRYESFD  174

Query  388  EDDMERGRVRPYLSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            E  +     RPYLSEAW ++       PL+N R P      D+K +L+ WA TVA+ +R
Sbjct  175  ESAIS----RPYLSEAWKVREKRKRGKPLMNWRFPALENEIDMKDNLKWWAHTVASAVR  229



>gb|KHN06416.1| hypothetical protein glysoja_010760 [Glycine soja]
Length=240

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 71/126 (56%), Gaps = 17/126 (13%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL                +
Sbjct  127  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGK------------KEE  174

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPN-----SPLLNLRMPRASAAADVKRHLRHWAKT  239
             + ED+D  E    RPYLSEAW ++  +     +PL+N +MP  +   D+K  LR WA T
Sbjct  175  EKEEDDDCDEISVPRPYLSEAWEVQECDRRKKENPLVNWKMPAINNETDMKESLRWWAHT  234

Query  238  VATVIR  221
            VA+ +R
Sbjct  235  VASTVR  240



>gb|EYU37337.1| hypothetical protein MIMGU_mgv11b016324mg [Erythranthe guttata]
Length=225

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 17/120 (14%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIF---DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWN  410
            + KSL ELE EE+KGFMDLGF+F   D ++   K +S++PGLQRL               
Sbjct  114  AVKSLSELEFEELKGFMDLGFVFTAGDDQKLDSKLVSIIPGLQRL--------------G  159

Query  409  SQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
               +    +       RPYLSEAW   S N  + + R+P      ++K HLR WA +VA+
Sbjct  160  KNVDESASESESESVSRPYLSEAWNYSSNNPAMKDWRIPAFGNEMELKHHLRFWAHSVAS  219



>gb|KGN61130.1| hypothetical protein Csa_2G058630 [Cucumis sativus]
Length=208

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 72/131 (55%), Gaps = 23/131 (18%)
 Frame = -1

Query  589  LDRSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSW  413
            + R  KSL ELE EE+KGFMDLGF+F +E +      S++PGLQR               
Sbjct  93   VKRLSKSLSELEFEELKGFMDLGFVFSEEDKNDTNLASIIPGLQRF--------------  138

Query  412  NSQREHEDEDDMERGRV--RPYLSEAWL-IKSPNSP---LLNLRMPRASAA-ADVKRHLR  254
              +++ E +  +E G +  RPYLSEAW  ++  N     L+  R+P   A   D+K HL+
Sbjct  139  -GEKKEEKQKQIEDGVLLKRPYLSEAWEDVEKENDKKRILMKWRVPSLGATEMDIKHHLK  197

Query  253  HWAKTVATVIR  221
             WA TVA+ +R
Sbjct  198  FWAHTVASTVR  208



>gb|EYU30763.1| hypothetical protein MIMGU_mgv1a025120mg [Erythranthe guttata]
Length=177

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 15/122 (12%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL  LE EEVKGFMDLGF+FD++  +   +SV+PGLQ++  +        KS NSQ   
Sbjct  67   RSLSALEFEEVKGFMDLGFVFDEDDKNSSLVSVIPGLQKMGKMAGDDYYEEKSNNSQLLS  126

Query  394  EDEDDMERGRVRPYLSEAW----LIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
                       RPYLSE+W         N+ ++N  +P      ++K HLR WA+ VA+ 
Sbjct  127  -----------RPYLSESWGSSSFFSERNNLMMNWTVPSVKNEINMKDHLRIWAQNVASN  175

Query  226  IR  221
            +R
Sbjct  176  VR  177



>ref|XP_010040033.1| PREDICTED: uncharacterized protein LOC104428796 [Eucalyptus grandis]
 gb|KCW45542.1| hypothetical protein EUGRSUZ_L00731 [Eucalyptus grandis]
Length=250

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 19/125 (15%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQR  401
            KSL ELE+EE+KGF+DLGF+F +++R     +S++PGLQRL   IK              
Sbjct  138  KSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGNKIK------------DG  185

Query  400  EHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            E +DED  E   V RPYLSEAW     K    PL+N ++P      D+K  L+ WA TVA
Sbjct  186  EEDDEDAGESVVVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKESLKWWAHTVA  245

Query  232  -TVIR  221
             TV+R
Sbjct  246  STVVR  250



>ref|XP_003596709.1| hypothetical protein MTR_2g083910 [Medicago truncatula]
Length=278

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (55%), Gaps = 24/130 (18%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +SL ELE +E+KGFMDLGF+F +E      +S++PGL                  S+
Sbjct  131  KTARSLSELEFKELKGFMDLGFVFSEEDKDSGLVSLIPGL------------------SK  172

Query  403  REHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
             +H  ++ +     RPYLSEAW +   K   +PLLN R+P      D+K +L+ WA TVA
Sbjct  173  NQHNVDESVIS---RPYLSEAWGVIKQKKVVNPLLNWRVPTLGNEIDMKDNLKFWAHTVA  229

Query  232  TVIRQES*QC  203
            ++I +    C
Sbjct  230  SIILKHGYFC  239



>ref|XP_009591632.1| PREDICTED: uncharacterized protein LOC104088627 [Nicotiana tomentosiformis]
Length=232

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 76/126 (60%), Gaps = 13/126 (10%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EE+KGFMDLGF F ++  +   + ++PGLQ+L   ++  ++       ++ +
Sbjct  113  KSLSELEYEELKGFMDLGFDFSEDDVNSSLVEIIPGLQKLSKNRSNDDQ-------EKVN  165

Query  394  EDEDDMERGR-VRPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
              E   +  R +RPYLSEAW +    K  NS L+N ++P  S   D+K  L+ WA TVA+
Sbjct  166  FVEKSHQYSRAIRPYLSEAWEVLEKRKRMNS-LMNWKVPATSNEIDIKHSLKWWAHTVAS  224

Query  229  VIRQES  212
             ++Q++
Sbjct  225  SVKQQN  230



>ref|XP_010040036.1| PREDICTED: uncharacterized protein LOC104428799 [Eucalyptus grandis]
 gb|KCW45544.1| hypothetical protein EUGRSUZ_L00733 [Eucalyptus grandis]
Length=244

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 19/125 (15%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQR  401
            KSL ELE+EE+KGF+DLGF+F +++R     +S++PGLQRL   IK              
Sbjct  132  KSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGNKIK------------DG  179

Query  400  EHEDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            E +DED  E   V RPYLSEAW     K    PL+N ++P      D+K  L+ WA TVA
Sbjct  180  EEDDEDAGESVVVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNKTDMKESLKWWAHTVA  239

Query  232  -TVIR  221
             TV+R
Sbjct  240  STVVR  244



>gb|AES66960.2| DUF1685 family protein [Medicago truncatula]
Length=233

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 24/124 (19%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +SL ELE +E+KGFMDLGF+F +E      +S++PGL                  S+
Sbjct  131  KTARSLSELEFKELKGFMDLGFVFSEEDKDSGLVSLIPGL------------------SK  172

Query  403  REHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
             +H  ++ +     RPYLSEAW +   K   +PLLN R+P      D+K +L+ WA TVA
Sbjct  173  NQHNVDESVIS---RPYLSEAWGVIKQKKVVNPLLNWRVPTLGNEIDMKDNLKFWAHTVA  229

Query  232  TVIR  221
            +++R
Sbjct  230  SIVR  233



>gb|KJB66849.1| hypothetical protein B456_010G160700 [Gossypium raimondii]
Length=234

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 73/124 (59%), Gaps = 12/124 (10%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KSL ELE EE+KGFMDLGF+F +E     + + ++PGLQRL+  +++          
Sbjct  120  RRSKSLSELEFEELKGFMDLGFVFSEEDNKDSRLVEIIPGLQRLRRKESQ---------E  170

Query  406  QREHEDEDDMERGRVRPYLSEAWLI--KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            +   E +DD +    RPYLSEAW +  +   +PL+N R+P      D+K  LR WA TVA
Sbjct  171  EDTQEADDDDDDEVSRPYLSEAWKVSERRKTNPLMNWRVPDLGNEIDMKDSLRWWAHTVA  230

Query  232  TVIR  221
            + +R
Sbjct  231  STVR  234



>ref|XP_011465206.1| PREDICTED: uncharacterized protein LOC105351692 [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +L+ EE+KGFMDLGF+F +E       S++PGL++L +                + 
Sbjct  131  KSLTDLQFEELKGFMDLGFVFSEEDKDSNLASIIPGLKKLGV----------------DD  174

Query  394  EDEDDMERGRVRPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
            ++  D E    RP+LSEAW +    K   +PL++ R P  S   D+K +LR WA TVA+ 
Sbjct  175  DEAFDDESAISRPHLSEAWEVMEKRKKEKNPLMDWRFPSLSNEMDMKDNLRWWAHTVAST  234

Query  226  IR  221
            +R
Sbjct  235  VR  236



>ref|XP_003543003.1| PREDICTED: uncharacterized protein LOC100781024 [Glycine max]
 gb|KHN47401.1| hypothetical protein glysoja_020269 [Glycine soja]
Length=230

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 17/121 (14%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL                  E 
Sbjct  124  KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRL--------------GKSDEE  169

Query  394  EDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
            E++ ++     RPYLSEAW     +   +PL+N ++P  +   D+K  LR WA+TVA+ +
Sbjct  170  EEDSELGSSVQRPYLSEAWKAQERRKKENPLVNWKIPALNNEIDIKDSLRWWAQTVASTV  229

Query  223  R  221
            R
Sbjct  230  R  230



>ref|XP_010925601.1| PREDICTED: putative WAS protein family homolog 3 [Elaeis guineensis]
Length=253

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 65/119 (55%), Gaps = 7/119 (6%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQREHE  392
            L ELE EEVKGFMDLGF F       + MS+VPGLQRL +      E   +  +   +  
Sbjct  139  LSELEFEEVKGFMDLGFTFSDAEADPRLMSIVPGLQRLGKRAAGDGEPAEEGSSCASDVV  198

Query  391  DEDDMERGRVRPYLSEAWLIK--SPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            DE  +     RPYLSEAW  +     + L N R+P A+   D+K HLR WA  VA+ +R
Sbjct  199  DESAIS----RPYLSEAWDAQEEEEENMLRNWRIPAAADGVDLKDHLRFWAHAVASTVR  253



>gb|KEH36642.1| DUF1685 family protein [Medicago truncatula]
Length=389

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 77/150 (51%), Gaps = 18/150 (12%)
 Frame = -1

Query  664  TTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKT  485
             T  E+  +L L A  +++   +       KSL +LE EEVKGFMDLGF+F +E      
Sbjct  96   NTEAEKQIQLQLQAVPNKNIIRNGRRKSGSKSLSDLEFEEVKGFMDLGFVFSEEDKDTSL  155

Query  484  MSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAW---LIKSPNSP  314
            +S++PGLQRL                  E ED  D+   + RPYLSEAW     +    P
Sbjct  156  VSIIPGLQRL--------------GKNGEEEDVSDVSAIQ-RPYLSEAWEDQKRRKKEKP  200

Query  313  LLNLRMPRASAAADVKRHLRHWAKTVATVI  224
            L+  ++P  +   D+K  L+ WA+TVA+ +
Sbjct  201  LMKWKIPAPTNEVDMKYSLKCWAQTVASTV  230



>ref|XP_004294142.1| PREDICTED: uncharacterized protein LOC101306310 [Fragaria vesca 
subsp. vesca]
Length=307

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 68/118 (58%), Gaps = 21/118 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE+EEV+GF DLGF FDK+  +   +S++PGLQ                  +R  
Sbjct  211  KSLSDLEIEEVQGFKDLGFTFDKKDIAPSVVSILPGLQ----------------EKKRNE  254

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            E   DM R   RPYLSEAWL++S   P  NL   R  +A D+K  ++ WA++VA+ +R
Sbjct  255  ELNLDMVR---RPYLSEAWLVQSCAPPPPNLGAGR--SAEDMKAQIKFWARSVASNVR  307



>gb|KHN36708.1| hypothetical protein glysoja_001439 [Glycine soja]
Length=229

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 71/125 (57%), Gaps = 15/125 (12%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +SL +LE +++KGFMDLGF+F +E    +++S++PGLQR           L   +  
Sbjct  117  KATRSLSDLEFKKLKGFMDLGFVFSEEDKDSRSVSLIPGLQR-----------LGKEDDG  165

Query  403  REHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            R  E   D E    RPYLSE W     +   +PLLNLR+P       +K +LR WA TVA
Sbjct  166  RNSEQNID-ETVICRPYLSETWDALDQRKVVNPLLNLRVPVVGNEIGMKDNLRFWAHTVA  224

Query  232  TVIRQ  218
            ++++ 
Sbjct  225  SIVKH  229



>ref|XP_011460623.1| PREDICTED: uncharacterized protein LOC105350386 [Fragaria vesca 
subsp. vesca]
Length=237

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 14/123 (11%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL +L+ EE+KGFMDLGF+F +E       S++PGL++            K+ +   E
Sbjct  125  SKSLTDLQFEELKGFMDLGFVFSEEDKDSNLASIIPGLKKFG----------KNKDDGAE  174

Query  397  HEDEDDMERGRVRPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
             ++  + E    RPYLSEAW +    K    PL + R P  S   D+K +LR WA TVA+
Sbjct  175  DDEAFNDESAISRPYLSEAWEVMEKRKKDKKPLTDWRFPSMSNELDMKDNLRWWAHTVAS  234

Query  229  VIR  221
             +R
Sbjct  235  TVR  237



>ref|XP_010317343.1| PREDICTED: uncharacterized protein LOC104646046 [Solanum lycopersicum]
Length=219

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 72/121 (60%), Gaps = 13/121 (11%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL ELE EE+KGFMDLG+ F ++  +   + ++PGLQ+L   +   +++     +  E 
Sbjct  108  KSLSELEYEELKGFMDLGYEFSEDDVNSSLVEILPGLQKLSKNRDNDQKL-----NFVEK  162

Query  394  EDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
             DE      R RPYLSEAW +   K   +PL+N ++P  S   D+K +L+ WA TVA+ +
Sbjct  163  SDE-----LRARPYLSEAWEVVEKKKRMNPLMNWKVPVMSNEIDLKHNLKLWAHTVASTV  217

Query  223  R  221
            +
Sbjct  218  K  218



>gb|KCW47364.1| hypothetical protein EUGRSUZ_K01150, partial [Eucalyptus grandis]
Length=182

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 73/127 (57%), Gaps = 16/127 (13%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            S KSL ELE EE+KGFMDLGF+F +++R     +S++PGLQRL L K   +R+       
Sbjct  65   SSKSLSELEFEELKGFMDLGFVFSEQDRDDSDLVSILPGLQRLGL-KDDGDRI-------  116

Query  403  REHEDEDDMERGRV-RPYLSEAWLI-----KSPNSPLLNLRMPRASAAADVKRHLRHWAK  242
             E E+    +  +V RPYLSEAW       K    PL+N R+P       +K HL+ WA 
Sbjct  117  -EVEETKKADETKVPRPYLSEAWHGLDRQRKRYEDPLVNWRVPALGNEMAMKDHLKFWAH  175

Query  241  TVATVIR  221
             VA+ +R
Sbjct  176  AVASTVR  182



>ref|XP_004517128.1| PREDICTED: uncharacterized protein LOC101512525 [Cicer arietinum]
Length=317

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 19/120 (16%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL +LELEEV+GF DLGF F+KE  S    +++PGLQ                   R+ 
Sbjct  216  RSLSDLELEEVQGFKDLGFSFEKEGLSPSLANIIPGLQE----------------KNRDE  259

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
             +ED   RG   PYLSEAWL++S  +P +        + AD+K++++ WA+ VA+ + QE
Sbjct  260  SEEDKAARG---PYLSEAWLVQSCCAPPVPNCGNTNMSKADIKKNIKFWARAVASNVHQE  316



>gb|ACU23694.1| unknown [Glycine max]
Length=237

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 70/126 (56%), Gaps = 17/126 (13%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL                +
Sbjct  124  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGK------------KEE  171

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPN-----SPLLNLRMPRASAAADVKRHLRHWAKT  239
             + ED+D  E    RPYLSEAW ++  +     +PL+N +MP  +   D+K  L  WA T
Sbjct  172  EKEEDDDCDEISVPRPYLSEAWEVQECDRRKKENPLVNWKMPAINNETDMKESLGWWAHT  231

Query  238  VATVIR  221
            VA+ +R
Sbjct  232  VASTVR  237



>ref|XP_009352733.1| PREDICTED: uncharacterized protein LOC103944066 [Pyrus x bretschneideri]
Length=225

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 17/119 (14%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHED  389
            L +L+ EE+KGFMDLGF+F +E      +S++PGLQRL           K  +S+ E  D
Sbjct  121  LTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLG----------KKDDSREERID  170

Query  388  EDDMERGRVRPYLSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            E  +     RPYLSE W ++       PL+N R P      D+K +L+ WA TVA+ +R
Sbjct  171  ESAIS----RPYLSEVWEVREKRKREKPLMNWRFPALENEIDMKDNLKWWAHTVASAVR  225



>ref|XP_010038705.1| PREDICTED: uncharacterized protein LOC104427291 [Eucalyptus grandis]
Length=145

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (57%), Gaps = 16/123 (13%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHE  392
            L ELE EE+KGFMDLGF+F +++R     +S++PGLQRL L K   +R+        E E
Sbjct  32   LSELEFEELKGFMDLGFVFSEQDRDDSDLVSILPGLQRLGL-KDDGDRI--------EVE  82

Query  391  DEDDMERGRV-RPYLSEAWLI-----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
            +    +  +V RPYLSEAW       K    PL+N R+P       +K HL+ WA  VA+
Sbjct  83   ETKKADETKVPRPYLSEAWHGLDRQRKRYEDPLVNWRVPALGNEMAMKDHLKFWAHAVAS  142

Query  229  VIR  221
             +R
Sbjct  143  TVR  145



>gb|KCW45543.1| hypothetical protein EUGRSUZ_L00732 [Eucalyptus grandis]
Length=244

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 71/128 (55%), Gaps = 23/128 (18%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
             KSL E+E EE+KGF+DLGF+F +++R     +S++PGLQRL               ++ 
Sbjct  131  IKSLSEIEFEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRL--------------GNKI  176

Query  400  EHEDEDDMERGR----VRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAK  242
            +  +EDD + G      RPYLSE W     K    PL+N ++P      D+K  L+ WA 
Sbjct  177  KDGEEDDGDAGESVVVARPYLSEVWEWWEEKRKEDPLMNWKVPAFGNETDMKESLKWWAH  236

Query  241  TVA-TVIR  221
            TVA TV+R
Sbjct  237  TVASTVVR  244



>gb|KHN48012.1| hypothetical protein glysoja_015482 [Glycine soja]
Length=247

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 71/127 (56%), Gaps = 19/127 (15%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL+               +
Sbjct  134  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLRK------------KEE  181

Query  403  REHEDEDDMERGRVRPYLSEAWLI------KSPNSPLLNLRMPRASAAADVKRHLRHWAK  242
             E E+ED  E    RPYLSEAW +      K  NS L+N +MP  +   D+K  LR WA 
Sbjct  182  EEEENEDCDEISVPRPYLSEAWEVQEYDRRKKENS-LVNWKMPAINNETDMKESLRWWAH  240

Query  241  TVATVIR  221
            TVA+ +R
Sbjct  241  TVASTVR  247



>ref|XP_010040035.1| PREDICTED: uncharacterized protein LOC104428798 [Eucalyptus grandis]
Length=259

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 71/127 (56%), Gaps = 23/127 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL E+E EE+KGF+DLGF+F +++R     +S++PGLQRL               ++ +
Sbjct  147  KSLSEIEFEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRL--------------GNKIK  192

Query  397  HEDEDDMERGR----VRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
              +EDD + G      RPYLSE W     K    PL+N ++P      D+K  L+ WA T
Sbjct  193  DGEEDDGDAGESVVVARPYLSEVWEWWEEKRKEDPLMNWKVPAFGNETDMKESLKWWAHT  252

Query  238  VA-TVIR  221
            VA TV+R
Sbjct  253  VASTVVR  259



>ref|XP_003531264.1| PREDICTED: uncharacterized protein LOC100814411 [Glycine max]
Length=247

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 71/127 (56%), Gaps = 19/127 (15%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL+               +
Sbjct  134  RESKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLRK------------KEE  181

Query  403  REHEDEDDMERGRVRPYLSEAWLI------KSPNSPLLNLRMPRASAAADVKRHLRHWAK  242
             E E+ED  E    RPYLSEAW +      K  NS L+N +MP  +   D+K  LR WA 
Sbjct  182  EEEENEDCDEISVPRPYLSEAWEVQEYDRRKKENS-LVNWKMPAINNETDMKESLRWWAH  240

Query  241  TVATVIR  221
            TVA+ +R
Sbjct  241  TVASTVR  247



>ref|XP_009385553.1| PREDICTED: uncharacterized protein LOC103972892 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 67/118 (57%), Gaps = 15/118 (13%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            ELE  EVKGFMDLGF+F KE  S + M+++PGLQRL           K         +E 
Sbjct  129  ELENYEVKGFMDLGFVFRKEELSMEIMNIIPGLQRLG----------KEGRDDEASREEK  178

Query  382  DMERGRVRPYLSEAWLIK--SPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
            + + G  RPYLSEAW+    S  SP L    PR+   AD+KR LR WA+ VA+VI  +
Sbjct  179  EEDEGVERPYLSEAWMRHDLSVVSPSLQ---PRSPYGADMKRQLRFWAREVASVIHHK  233



>gb|KEH38854.1| DUF1685 family protein [Medicago truncatula]
Length=261

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +SL ELE +E+KGFMDLGF+F +E      +S++PGL                  S+
Sbjct  131  KTARSLSELEFKELKGFMDLGFVFSEEDKDSGLVSLIPGL------------------SK  172

Query  403  REHEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
             +H  ++ +     RPYLSEAW +   K   +PLLN R+P      D+K +L+ WA TVA
Sbjct  173  NQHNVDESVIS---RPYLSEAWGVIKQKKVVNPLLNWRVPTLGNEIDMKDNLKFWAHTVA  229

Query  232  TVI  224
            ++ 
Sbjct  230  SIF  232



>ref|XP_008783125.1| PREDICTED: uncharacterized protein LOC103702463 [Phoenix dactylifera]
Length=265

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 23/125 (18%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            +R  KSL +LE  EV+GF DLGF+FD++ +S    +V+PGL+                  
Sbjct  164  ERKWKSLSDLEFIEVQGFKDLGFVFDEQGSSASLANVIPGLR------------------  205

Query  406  QREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
             R+  + DD  R   RPYLSEAW ++    P++     R  +AAD+K  LR WA+ VA  
Sbjct  206  GRKAGEGDDKVR---RPYLSEAWFVQGSAPPMIQWVDKR--SAADIKEQLRFWARAVACN  260

Query  226  IRQES  212
            + QES
Sbjct  261  VWQES  265



>gb|AFK41310.1| unknown [Medicago truncatula]
Length=239

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 8/151 (5%)
 Frame = -1

Query  664  TTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKT  485
            T+++    + D+A  K +   S     R  +SL ELE +E+KGFMDLGF+F +E    K 
Sbjct  94   TSSENHHQKEDVAYTKKKQSQSYRRRRRRSRSLSELEFKELKGFMDLGFVFSEEDKDSKL  153

Query  484  MSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLI---KSPNSP  314
            +S++PGLQRL       E          EH+  D+      +PYLSEAW +   +   +P
Sbjct  154  VSLIPGLQRLGRENDDAEEG-----EDEEHKKIDENVLSDNKPYLSEAWDVFDQRERKNP  208

Query  313  LLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            L+N R+P   +  D+K +L+ WA  VA++ R
Sbjct  209  LVNWRVPDKGSEIDMKDNLKFWAHAVASIAR  239



>ref|XP_003607621.1| hypothetical protein MTR_4g080340 [Medicago truncatula]
 gb|AES89818.1| DUF1685 family protein [Medicago truncatula]
Length=239

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 8/151 (5%)
 Frame = -1

Query  664  TTAKERLTRLDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKT  485
            T+++    + D+A  K +   S     R  +SL ELE +E+KGFMDLGF+F +E    K 
Sbjct  94   TSSENHHQKEDVAYTKKKQSQSYRRRRRKSRSLSELEFKELKGFMDLGFVFSEEDKDSKL  153

Query  484  MSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLI---KSPNSP  314
            +S++PGLQRL       E          EH+  D+      +PYLSEAW +   +   +P
Sbjct  154  VSLIPGLQRLGRENDDAEEG-----EDEEHKKIDENVLSDNKPYLSEAWDVFDQRERKNP  208

Query  313  LLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            L+N R+P   +  D+K +L+ WA  VA++ R
Sbjct  209  LVNWRVPDKGSEIDMKDNLKFWAHAVASIAR  239



>ref|XP_006451767.1| hypothetical protein CICLE_v10010201mg [Citrus clementina]
 ref|XP_006464821.1| PREDICTED: uncharacterized protein LOC102621220 [Citrus sinensis]
 gb|ESR65007.1| hypothetical protein CICLE_v10010201mg [Citrus clementina]
 gb|KDO58529.1| hypothetical protein CISIN_1g018815mg [Citrus sinensis]
Length=350

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 71/123 (58%), Gaps = 23/123 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EEV+GF DLGF F+K+  S   ++++PGLQ                  +++ 
Sbjct  247  KSLNDLETEEVQGFKDLGFTFEKKDLSPNVVNILPGLQ------------------EKKQ  288

Query  394  EDEDDMERGRVRPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
            E    M+    RPYLSEAW+++S   P +P+ N  +P+ S   D+K  L+ WA+ VA+ +
Sbjct  289  EKLSQMDYKMRRPYLSEAWVVQSCAPPAAPVPNC-VPKNS-TEDMKEQLKFWARAVASNV  346

Query  223  RQE  215
            RQE
Sbjct  347  RQE  349



>ref|XP_008226466.1| PREDICTED: uncharacterized protein LOC103326040 [Prunus mume]
Length=333

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 23/119 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE+EE++GF DLGF FDK+  S   ++++PGLQ                    E 
Sbjct  237  KSLSDLEIEELQGFKDLGFTFDKKELSPSVVNILPGLQ--------------------EK  276

Query  394  EDEDDMERGRV-RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            +  +D+   +V RPYLSEAWL++S   P  NL   R  +A D+K  ++ WA+ VA+ +R
Sbjct  277  KGTEDLNPEKVRRPYLSEAWLVQSCAPPPPNLGASR--SAEDMKAQIKFWARAVASNVR  333



>gb|KJB13283.1| hypothetical protein B456_002G066500 [Gossypium raimondii]
Length=308

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 22/121 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KS  +L  +E++GF DLGF FDKE  S   ++++PGLQ  ++                  
Sbjct  208  KSYSDLAFQELQGFKDLGFTFDKEDLSPDIVNILPGLQGDKI------------------  249

Query  394  EDEDDMERGRV-RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQ  218
              ED+++  +V +PYLSEAWL++ P  P +   + + S A D+K  ++ WA+ VAT +RQ
Sbjct  250  --EDELQPDKVKKPYLSEAWLVQGPAPPPIPTCVSKNS-AKDMKAQIKFWARAVATNVRQ  306

Query  217  E  215
            E
Sbjct  307  E  307



>ref|XP_008228946.1| PREDICTED: uncharacterized protein LOC103328331 [Prunus mume]
Length=268

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 72/132 (55%), Gaps = 24/132 (18%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL +LE +E+KGFMDLGF+F +E    K +S++PGLQRL  I  +           R+
Sbjct  148  SKSLSDLEFDELKGFMDLGFVFTEEDKDSKLVSIIPGLQRLGSIGEQ----------DRD  197

Query  397  HEDE---------DDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHL  257
             ED+         D      V RPYLSEAW     +   + L+N R+P A+    +K +L
Sbjct  198  GEDQRNNNNDNNIDPSSHHVVSRPYLSEAWDALDQRKKENKLVNWRIP-ANLGKGMKHNL  256

Query  256  RHWAKTVATVIR  221
            R WA TVA+ +R
Sbjct  257  RFWAHTVASTVR  268



>emb|CDP15956.1| unnamed protein product [Coffea canephora]
Length=242

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 18/128 (14%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + KSL ELE EE+KGFMDLGF+F  E      +S++PGLQRL           ++ + + 
Sbjct  125  NSKSLSELEFEELKGFMDLGFVFSDEDKESSLVSIIPGLQRLG----------RNVDEEE  174

Query  400  EHEDEDDMERGRVRPYLSEAWLI-------KSPNSPLLNLRM-PRASAAADVKRHLRHWA  245
            E +D  D +    RPYLSEAW +       +     L+N ++ P      ++K  LR WA
Sbjct  175  EKKDFADEKPVVSRPYLSEAWDVLDEKKAERKVKKKLMNWKINPGLGNEMEIKDQLRFWA  234

Query  244  KTVATVIR  221
             TVA+ +R
Sbjct  235  HTVASTVR  242



>ref|XP_007213579.1| hypothetical protein PRUPE_ppa014990mg [Prunus persica]
 gb|EMJ14778.1| hypothetical protein PRUPE_ppa014990mg [Prunus persica]
Length=333

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 23/119 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE+EE++GF DLGF FDK+  S   ++++PGLQ                    E 
Sbjct  237  KSLSDLEIEELQGFKDLGFTFDKKELSPSVVNILPGLQ--------------------EK  276

Query  394  EDEDDMERGRV-RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            +  +D+   +V RPYLSEAWL++S   P  NL   R  +A D+K  ++ WA+ VA+ +R
Sbjct  277  KRTEDLNPEKVRRPYLSEAWLVQSCAPPPPNLGASR--SAEDMKAQIKFWARAVASNVR  333



>ref|XP_006591846.1| PREDICTED: uncharacterized protein LOC100527250 isoform X1 [Glycine 
max]
 gb|KHN28084.1| hypothetical protein glysoja_007816 [Glycine soja]
Length=331

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 21/120 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL +LE EEV+GF DLGF F+KE  S    S++PGLQ                  +R+ 
Sbjct  232  RSLSDLEFEEVQGFKDLGFSFEKEALSPSLASILPGLQ----------------EKKRDE  275

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
             +ED   R   RPYLSEAWL++S   P+ N    ++S   D+K  ++ WA+ VA+ + QE
Sbjct  276  TEEDKAAR---RPYLSEAWLVQSCAPPIPNWASHKSS--GDMKEQIKFWARAVASNVHQE  330



>ref|XP_008366054.1| PREDICTED: uncharacterized protein LOC103429701 [Malus domestica]
Length=257

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 17/116 (15%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHED  389
            L +L+ EE+KGFMDLGF+F +E      +S++PGLQRL           K  +S+ E  +
Sbjct  127  LTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLG----------KKDDSREERFB  176

Query  388  EDDMERGRVRPYLSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
            E  +     RPYLSEAW ++       PL+N R P      D+K +L+ WA TVA+
Sbjct  177  ESAIS----RPYLSEAWEVREKRKREKPLMNWRFPALENEIDMKDNLKWWAHTVAS  228



>ref|XP_004303200.1| PREDICTED: uncharacterized protein LOC101313135 [Fragaria vesca 
subsp. vesca]
Length=264

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 72/137 (53%), Gaps = 31/137 (23%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRLQLIKAKPERVLKSWNSQ  404
            S KSL +LE +E+KGFMDLGF+F +E      + +++PGLQRL++             S 
Sbjct  142  SSKSLSDLEFDELKGFMDLGFVFTEEDNKDSNLVAIIPGLQRLRV-------------SD  188

Query  403  REHEDEDDMERGRV-------------RPYLSEAW---LIKSPNSPLLNLRMPRASAAAD  272
               E + D E  R+             RPYLSEAW     +   + L+N R+P A    D
Sbjct  189  EGEEQDRDHEEKRIDASHHHHHSQVVSRPYLSEAWDALEYQRKENQLMNWRVPSA-LDKD  247

Query  271  VKRHLRHWAKTVATVIR  221
            +K HL+ WA TVA+ +R
Sbjct  248  MKHHLKFWAHTVASTVR  264



>gb|KDO63416.1| hypothetical protein CISIN_1g041944mg [Citrus sinensis]
Length=249

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 67/130 (52%), Gaps = 29/130 (22%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            +LE EE+KGFMDLGF+F +E       S++PGLQRL+           S +S R  ED  
Sbjct  133  DLEFEELKGFMDLGFVFSEEDKDSSLASILPGLQRLR----------GSGSSAR--EDGR  180

Query  382  DMERGRV-----------RPYLSEAWLI-----KSPNSPLLNLRMPRASAAADVKRHLRH  251
            D E   V           RPYLSEAW +     K  NS L+N R+P      ++K  LR 
Sbjct  181  DHEEASVNNNHNNKPTVSRPYLSEAWAVLDHQRKVENS-LMNWRIPSVGHDVNMKDQLRF  239

Query  250  WAKTVATVIR  221
            WA TVA+  R
Sbjct  240  WAHTVASTAR  249



>ref|XP_006446825.1| hypothetical protein CICLE_v10016386mg [Citrus clementina]
 gb|ESR60065.1| hypothetical protein CICLE_v10016386mg [Citrus clementina]
Length=249

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 67/130 (52%), Gaps = 29/130 (22%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            +LE EE+KGFMDLGF+F +E       S++PGLQRL+           S +S R  ED  
Sbjct  133  DLEFEELKGFMDLGFVFSEEDKDSSLASILPGLQRLR----------GSGSSAR--EDGR  180

Query  382  DMERGRV-----------RPYLSEAWLI-----KSPNSPLLNLRMPRASAAADVKRHLRH  251
            D E   V           RPYLSEAW +     K  NS L+N R+P      ++K  LR 
Sbjct  181  DHEEASVNNNHNNKPTVSRPYLSEAWAVLDHQRKVENS-LMNWRIPSVGHDVNMKDQLRF  239

Query  250  WAKTVATVIR  221
            WA TVA+  R
Sbjct  240  WAHTVASTAR  249



>ref|XP_010524072.1| PREDICTED: uncharacterized protein LOC104802264 [Tarenaya hassleriana]
Length=271

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 21/131 (16%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KSL +LE +E+KGFMDLGF+F +E       +S++PGLQR+              N 
Sbjct  152  RRRKSLSDLEYQELKGFMDLGFVFSEEDHKDSDLVSILPGLQRIGRN-----------NG  200

Query  406  QREHEDEDDMERG---RVRPYLSEAWLI------KSPNSPLLNLRMPRASAAADVKRHLR  254
            + +  DE+  +R      RPYLSEAW        K P  P +  + P  +   D+K HLR
Sbjct  201  EDDETDENKEKRSGNRGGRPYLSEAWKFRGERTEKKPPPPAMRWKFPAPANEVDMKDHLR  260

Query  253  HWAKTVATVIR  221
             WA  VA+ +R
Sbjct  261  LWAHNVASSVR  271



>ref|XP_007025324.1| Uncharacterized protein TCM_029658 [Theobroma cacao]
 gb|EOY27946.1| Uncharacterized protein TCM_029658 [Theobroma cacao]
Length=239

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 17/122 (14%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +LE EE+KGFMDLGF+F +E     + + ++PGLQRL   + +          + +
Sbjct  131  KSLSDLEFEELKGFMDLGFVFSEEDNKDSRLVEIIPGLQRLGKKEGE---------EESK  181

Query  397  HEDEDDMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
              D+ ++     RPYLSEAW +   +   +PL+N R+P      D+K  LR WA TVA+ 
Sbjct  182  EADKAEVS----RPYLSEAWEVSGRRRKENPLMNWRVPALGNEIDMKDSLRLWAHTVAST  237

Query  226  IR  221
            +R
Sbjct  238  VR  239



>ref|XP_010916028.1| PREDICTED: uncharacterized protein LOC105040958 isoform X1 [Elaeis 
guineensis]
Length=276

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 23/121 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMS-VVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +LE  EV+GF DLGF+FD+E TS  +++ V+PGL+                  ++ 
Sbjct  177  KSLSDLEFIEVQGFKDLGFVFDEEGTSSASLANVIPGLR-----------------DKKA  219

Query  397  HEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQ  218
             E  DD  R   RPYLSEAW ++    P++     R  +AAD+K  L+ WA+ VA  +RQ
Sbjct  220  GELGDDKVR---RPYLSEAWFVQRSAPPMIKWVDKR--SAADMKEQLKFWARAVACNVRQ  274

Query  217  E  215
            E
Sbjct  275  E  275



>ref|XP_008455295.1| PREDICTED: uncharacterized protein LOC103495495 [Cucumis melo]
 ref|XP_008455296.1| PREDICTED: uncharacterized protein LOC103495495 [Cucumis melo]
Length=216

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (57%), Gaps = 20/123 (16%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +LE EE+KGFMDLGF+F +E  +   + S++PGL RL      P+          E
Sbjct  109  KSLSDLEFEELKGFMDLGFVFSEEDKNDSNLGSIIPGLHRL-----GPQIT-------EE  156

Query  397  HEDEDDMERGRVRPYLSEAW-LIKSPNSP--LLNLRMPRASAA-ADVKRHLRHWAKTVAT  230
              +E+ + R   RPYLSEAW  I+  N    L+  R+P   A   D+K HL+ WA TVA+
Sbjct  157  KRNENGVLR---RPYLSEAWEAIEEENEKMVLMKWRVPSLGATEMDIKHHLKFWAHTVAS  213

Query  229  VIR  221
             +R
Sbjct  214  TVR  216



>ref|XP_007021600.1| Serine/arginine repetitive matrix protein 2, putative [Theobroma 
cacao]
 gb|EOY13125.1| Serine/arginine repetitive matrix protein 2, putative [Theobroma 
cacao]
Length=337

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 24/120 (20%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL +L  EE++GF DLGF FDKE  S   ++++PGLQ  ++                  
Sbjct  241  RSLSDLAFEELQGFKDLGFTFDKEDLSPSVVNILPGLQENKI------------------  282

Query  394  EDEDDMERGRV-RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQ  218
               +D+++ +V RPYLSEAWL +S   P+ N       +A D+K  ++ WA+ VAT +RQ
Sbjct  283  ---EDLKQDKVRRPYLSEAWLAQSRGPPIPNCV--SKDSADDMKAQIKFWARAVATNVRQ  337



>ref|XP_010916029.1| PREDICTED: uncharacterized protein LOC105040958 isoform X2 [Elaeis 
guineensis]
Length=250

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 23/121 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMS-VVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +LE  EV+GF DLGF+FD+E TS  +++ V+PGL+                  ++ 
Sbjct  151  KSLSDLEFIEVQGFKDLGFVFDEEGTSSASLANVIPGLR-----------------DKKA  193

Query  397  HEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQ  218
             E  DD  R   RPYLSEAW ++    P++     R  +AAD+K  L+ WA+ VA  +RQ
Sbjct  194  GELGDDKVR---RPYLSEAWFVQRSAPPMIKWVDKR--SAADMKEQLKFWARAVACNVRQ  248

Query  217  E  215
            E
Sbjct  249  E  249



>ref|XP_006294801.1| hypothetical protein CARUB_v10023852mg [Capsella rubella]
 gb|EOA27699.1| hypothetical protein CARUB_v10023852mg [Capsella rubella]
Length=267

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 75/131 (57%), Gaps = 17/131 (13%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQR  L+K K + V     +
Sbjct  144  RKGKSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQR-SLLK-KDDGV-----A  196

Query  406  QREHEDEDDMERGR--VRPYLSEAW------LIKSPNSPLLNLRMPRASAA-ADVKRHLR  254
            Q   E+E+DM  G    RPYLSEAW        K    P +  R+P  +A   D+K +LR
Sbjct  197  QAVTEEEEDMSNGNRVARPYLSEAWDHCGGRKGKKQLKPEIKWRVPAPAANEVDLKDNLR  256

Query  253  HWAKTVATVIR  221
             WA  VA+ IR
Sbjct  257  LWAHAVASTIR  267



>ref|XP_010508532.1| PREDICTED: uncharacterized protein LOC104785090 [Camelina sativa]
Length=275

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 12/130 (9%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQR  L+K   + +++  N 
Sbjct  149  RKGKSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQR--LVKKDHDGLVQVTNK  206

Query  406  QREHEDEDDMERGRV-RPYLSEAW------LIKSPNSPLLNLRMPR-ASAAADVKRHLRH  251
            + E E+ED     RV RPYLSEAW        K+  +  +  R+P  A+   D+K +LR 
Sbjct  207  E-EGEEEDKSNGNRVARPYLSEAWDHCGGRKGKTQITTDIKWRVPAPATKEVDLKDNLRL  265

Query  250  WAKTVATVIR  221
            WA  VA+ IR
Sbjct  266  WAHAVASTIR  275



>ref|XP_009404523.1| PREDICTED: forkhead box protein G1-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 63/120 (53%), Gaps = 10/120 (8%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EE+KG +DLGF F    T  + + +VP LQRL L + +         S+ E 
Sbjct  161  KSLTDLEFEELKGLVDLGFTFSDAETDPRLLEIVPALQRLGLGRNR--------ASEEEA  212

Query  394  EDEDDMERGRVRPYLSEAWLI--KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
                 ++    RPYLSEAW +    P   LL   +P   A AD+K  LR WA  VA+ +R
Sbjct  213  PPAAPVDAAVSRPYLSEAWEVAEAKPEERLLMNLIPAGVAGADLKGQLRSWAHAVASTVR  272



>ref|XP_003563777.1| PREDICTED: uncharacterized protein LOC100825390 [Brachypodium 
distachyon]
Length=251

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 68/124 (55%), Gaps = 17/124 (14%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPE-RVLKSWNSQREH  395
            SL ELE EEVKG  DLGF F       +  S+VPGL+R   I+A+ + R  K+       
Sbjct  138  SLSELEFEEVKGLQDLGFTFSDADVDAELASIVPGLRR---IRAEEDARKAKA-------  187

Query  394  EDEDDMERGRV----RPYLSEAWLIKSPN--SPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            E+E+   R R     RPYLSEAW  +       L N R+P A   AD+K HLR WA +VA
Sbjct  188  EEEEAWSRNRAAAPRRPYLSEAWEDEEAEVRRMLNNFRIPAAQEGADLKEHLRLWAHSVA  247

Query  232  TVIR  221
            + +R
Sbjct  248  SAVR  251



>gb|KEH38674.1| hypothetical protein MTR_2g078620 [Medicago truncatula]
Length=322

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 26/119 (22%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL +LE EEV+GF DLGF F+KE  S    +++PGLQ                   R+ 
Sbjct  225  RSLSDLEYEEVQGFKDLGFSFEKEALSPSLANIIPGLQE----------------KNRDE  268

Query  394  EDEDDMERGRVRPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
             +ED   RG   PYLSEAWL++S   P  P    +M    +A D+K+H++ WA+ VA+ 
Sbjct  269  SEEDKAARG---PYLSEAWLVQSCATPPVPNWGNKM----SADDMKKHIKFWARAVAST  320



>ref|XP_006467617.1| PREDICTED: uncharacterized protein LOC102628675 [Citrus sinensis]
 gb|KDO77904.1| hypothetical protein CISIN_1g026058mg [Citrus sinensis]
Length=244

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 25/120 (21%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +LE EE+KGFMDLGF+F +E     + + +VPGLQRL                   
Sbjct  139  KSLSDLEFEELKGFMDLGFVFTEEDNKDSRLVEIVPGLQRLG------------------  180

Query  397  HEDEDDMERGRV-RPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
             + +D ++   V RPYLSEAW I    +  NS L+N ++   +   D+K +LR WA TVA
Sbjct  181  -KKDDTVDNSPVSRPYLSEAWEIMDTTRKENSLLINWKISALNNEMDIKDNLRWWAHTVA  239



>ref|XP_007149427.1| hypothetical protein PHAVU_005G069500g [Phaseolus vulgaris]
 gb|ESW21421.1| hypothetical protein PHAVU_005G069500g [Phaseolus vulgaris]
Length=317

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 22/120 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL +LE EEV+GF DLGF F+KE  S    +++PGLQ                  +R+ 
Sbjct  219  RSLSDLEYEEVQGFKDLGFSFEKETLSPSLANILPGLQ----------------EKKRDE  262

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
             +ED   R   RPYLSEAWL++S  +P+ N       +A D+K+ ++ WA+ VA+ + QE
Sbjct  263  TEEDKAAR---RPYLSEAWLVQS-CAPIPNWA--SNKSAGDMKQQIKFWARAVASNVHQE  316



>ref|XP_006449540.1| hypothetical protein CICLE_v10016436mg [Citrus clementina]
 gb|ESR62780.1| hypothetical protein CICLE_v10016436mg [Citrus clementina]
Length=244

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 25/120 (21%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL +LE EE+KGFMDLGF+F +E   + + + +VPGLQRL                   
Sbjct  139  KSLSDLEFEELKGFMDLGFVFTEEDNKNSRLVEIVPGLQRL-------------------  179

Query  397  HEDEDDMERGRV-RPYLSEAWLI----KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
             + +D ++   V RPYLSEAW I    +  NS L+N  +   +   D+K +LR WA TVA
Sbjct  180  GKKDDTVDNSPVSRPYLSEAWEIMDTTRKDNSLLINWEISALNNEMDIKDNLRWWAHTVA  239



>ref|XP_010102120.1| hypothetical protein L484_021354 [Morus notabilis]
 ref|XP_010113102.1| hypothetical protein L484_000078 [Morus notabilis]
 gb|EXB92370.1| hypothetical protein L484_021354 [Morus notabilis]
 gb|EXC64798.1| hypothetical protein L484_000078 [Morus notabilis]
Length=280

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 74/134 (55%), Gaps = 16/134 (12%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTS-KKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            S KSL +LE EE+KGFMDLGF+F +E     + +S++PGLQR    K   +      + +
Sbjct  149  SSKSLPDLEFEELKGFMDLGFVFTEEECKDSRLVSMIPGLQR--FCKKCTDGSDHDDDQE  206

Query  403  REHEDEDDMERGR------VRPYLSEAWLI-------KSPNSPLLNLRMPRASAAADVKR  263
               +++++ E  R       RPYLSEAW +       K     ++NL++P   +  D+K 
Sbjct  207  DHDKEKNNYEIKRNSDQVISRPYLSEAWDVLDLEYQRKKEMKQVVNLKIPTLVSDIDMKD  266

Query  262  HLRHWAKTVATVIR  221
             LR WA TVA+ +R
Sbjct  267  QLRFWAHTVASTVR  280



>ref|XP_002881871.1| hypothetical protein ARALYDRAFT_483373 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58130.1| hypothetical protein ARALYDRAFT_483373 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 72/126 (57%), Gaps = 15/126 (12%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQRL     K + V+     Q  
Sbjct  143  KSMSDLEYEELKGFMDLGFVFSEEDHKDSNLVSILPGLQRLV---KKDDGVV-----QVT  194

Query  397  HEDEDDMERGRV-RPYLSEAW----LIKSPNSPLLNLRMPRASA-AADVKRHLRHWAKTV  236
             E+ED     RV RPYLSEAW      K   +  +  R+P   A   D+K +LRHWA  V
Sbjct  195  KEEEDKSSGNRVARPYLSEAWDHCGGRKGKITTEIKWRVPAPVANEVDLKDNLRHWAHAV  254

Query  235  ATVIRQ  218
            A+ IR+
Sbjct  255  ASTIRR  260



>emb|CDP15954.1| unnamed protein product [Coffea canephora]
Length=232

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 61/117 (52%), Gaps = 18/117 (15%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            ELE EE+KGFMDLGF+F +E  S    S++PGLQR              W  Q  +E   
Sbjct  131  ELEYEELKGFMDLGFVFTEEDKSSSLASIIPGLQR--------------WGKQGSNELVH  176

Query  382  DMERGRVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            D +    RPYLSEAW +   +  N   +  R P      ++K  L+ WA+TVA+ +R
Sbjct  177  D-KYAVSRPYLSEAWGVLNQRKVNKLPVRRRFPDVDNEINMKDQLKAWAQTVASTVR  232



>ref|XP_010686232.1| PREDICTED: uncharacterized protein LOC104900508 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 67/126 (53%), Gaps = 13/126 (10%)
 Frame = -1

Query  577  CKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
             KSL +LE EE+KGF+DLGFIF +E      +S++PGLQRL +             +   
Sbjct  123  SKSLSDLEFEELKGFIDLGFIFSEEDKDSNLVSIIPGLQRLSISNHNINI------NNDI  176

Query  397  HEDEDDMERGRV-RPYLSEAW---LIKSPNSPLLNLRMPRASA---AADVKRHLRHWAKT  239
            +    D   G   RPYLSEAW     K   + LLN R+PR        ++K +LR WA T
Sbjct  177  NGSIIDKSGGLFSRPYLSEAWDDLEKKRRENVLLNWRVPRLPPHDNQIEMKDYLRFWAHT  236

Query  238  VATVIR  221
            VA+ ++
Sbjct  237  VASTVK  242



>ref|XP_004136833.1| PREDICTED: uncharacterized protein LOC101209175 [Cucumis sativus]
 gb|KGN43634.1| hypothetical protein Csa_7G049160 [Cucumis sativus]
Length=218

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 20/119 (17%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRLQLIKAKPERVLKSWNSQREHEDE  386
            +LE EE+KGFMDLGF+F +E  +   + S++PGL RL   K + +R             E
Sbjct  115  DLEFEELKGFMDLGFVFSEEDKNDSNLGSIIPGLHRLGPKKTEEKR------------SE  162

Query  385  DDMERGRVRPYLSEAW-LIKSPNSP--LLNLRMPRASAA-ADVKRHLRHWAKTVATVIR  221
            + + R   RPYLSEAW  I+  N    L+  R+P   A   D+K HL+ WA TVA+ +R
Sbjct  163  NGVLR---RPYLSEAWKAIEEENEKMILMKWRVPSLGATEMDIKHHLKFWAHTVASTVR  218



>ref|XP_009794562.1| PREDICTED: uncharacterized protein LOC104241317 [Nicotiana sylvestris]
Length=218

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 67/122 (55%), Gaps = 18/122 (15%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +S  +LELEE+KGFMDLGF F +E  + + +++VPGL++              W  + E 
Sbjct  111  RSSSDLELEELKGFMDLGFEFSEEDKNSRLVTIVPGLEK--------------WGKRAEE  156

Query  394  EDEDDMERG-RVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
              E+  +R    RPYLSE W I   +     LL  R+P  +   ++K +LR WA+TVA+ 
Sbjct  157  IIENSKKRDVNSRPYLSEVWEILEKRKMTKKLLKWRVPAMNNEINMKDNLRVWAQTVAST  216

Query  226  IR  221
             R
Sbjct  217  FR  218



>ref|XP_009339321.1| PREDICTED: uncharacterized protein LOC103931537 [Pyrus x bretschneideri]
Length=324

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 28/122 (23%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE+EE++GF DLGF FDKE  S   ++++PGLQ                    E 
Sbjct  227  KSLSDLEIEELQGFKDLGFTFDKEELSPSVVNILPGLQ--------------------EK  266

Query  394  EDEDDMERGRV-RPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
            +  +D+    V RPYLSE WL +S   P  P L        +A D+K  ++ WA++VA+ 
Sbjct  267  KTSEDLNPAHVRRPYLSEVWLAQSCAAPPPPNLGA----TKSAEDMKAQIKFWARSVASN  322

Query  226  IR  221
            +R
Sbjct  323  VR  324



>emb|CBI20241.3| unnamed protein product [Vitis vinifera]
Length=184

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 83/161 (52%), Gaps = 31/161 (19%)
 Frame = -1

Query  673  QNETTAKERLTR--------LDLAACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGF  518
            QN  T + RL R        +++A    + + +  ++ R  KSL +LE EEV+GF DLGF
Sbjct  46   QNYGTPRHRLLRKQEEGTMSMNVAKEMRRRYLNQTNVIR--KSLSDLEYEEVQGFKDLGF  103

Query  517  IFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAW  338
             F+KE  S   ++++PGLQ    +K             R    E+D  R   RPYLSEAW
Sbjct  104  TFEKEDLSPSVVNILPGLQ----VK------------DRGGPVEEDSVR---RPYLSEAW  144

Query  337  LIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
            + +    P+ N      S+A D+K  ++ WA+ VA+ + QE
Sbjct  145  IEQCSAPPIPNWVG--KSSAQDMKAQIKFWARAVASNVHQE  183



>ref|XP_009593785.1| PREDICTED: uncharacterized protein LOC104090403 [Nicotiana tomentosiformis]
Length=238

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 25/129 (19%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            + KSL ELE EE+KGFMDLGF F  +      +S++PGL+RL                 R
Sbjct  126  NSKSLSELEFEELKGFMDLGFEFSDKDKDSSLVSILPGLRRL----------------GR  169

Query  400  EHEDE---DDMERGRVRPYLSEAWLI-----KSPNSPLLNLRM-PRASAAADVKRHLRHW  248
            E+E+    +++E    RP+LSEAW +     K   +PL + ++ P      ++K  LR W
Sbjct  170  ENEENMRFEELEASVSRPHLSEAWAVWEEKKKMEKNPLKSWKINPVLGNEMEIKDQLRFW  229

Query  247  AKTVATVIR  221
            A TVA+ +R
Sbjct  230  AHTVASTVR  238



>ref|XP_006428825.1| hypothetical protein CICLE_v10013612mg, partial [Citrus clementina]
 gb|ESR42065.1| hypothetical protein CICLE_v10013612mg, partial [Citrus clementina]
Length=202

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 17/90 (19%)
 Frame = -1

Query  667  ETTAKERLTRLDLAACKS-QSHTSSPSL----------------DRSCKSLGELELEEVK  539
            +T  ++R TRL+L   KS +S +SSP+                  +SC+SL ELELEEVK
Sbjct  84   DTNLEQRPTRLNLTRGKSNRSQSSSPATLKRLKKRCYSKSLPQKSKSCRSLMELELEEVK  143

Query  538  GFMDLGFIFDKERTSKKTMSVVPGLQRLQL  449
            GFMDLGF F+KE  S + MSV+PGLQR++L
Sbjct  144  GFMDLGFRFNKECLSPRMMSVLPGLQRVKL  173



>gb|KCW74140.1| hypothetical protein EUGRSUZ_E02771 [Eucalyptus grandis]
Length=263

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRL-QLIKAKPERVLKSWNSQR  401
            KSL ELE EEVKGFMDLGF+F +E +   ++ S++PGLQRL + IK   E      + Q 
Sbjct  138  KSLSELEFEEVKGFMDLGFVFAEEDSVDSSLVSIIPGLQRLGKKIKDGDEDDEDGDHHQE  197

Query  400  EHEDEDDMERGRV--RPYLSEAWLIKSPNS---PLLNLRMPRASAAADVKRHLRHWAKTV  236
            + ++++ +    V  RPYLSEAW          PL+N ++P      D++  L+ WA TV
Sbjct  198  DGDEKEIVGEPAVVARPYLSEAWEWWEEKKEEDPLMNWKVPALGNETDMRESLKSWAHTV  257

Query  235  A-TVIR  221
            A TV+R
Sbjct  258  ASTVVR  263



>ref|XP_009390733.1| PREDICTED: uncharacterized protein LOC103977053 [Musa acuminata 
subsp. malaccensis]
Length=320

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 24/121 (20%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +S  +LE  E++GF DLGF+FDKE ++     V+PGL                    RE 
Sbjct  222  RSYSDLESFEIQGFKDLGFVFDKEASNAGLADVIPGL--------------------RER  261

Query  394  EDEDDMERGRV-RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQ  218
             + DD   GRV RPYLSEAW ++    P L     R  +A D+K  LR WA+ VA   +Q
Sbjct  262  RNSDDGH-GRVPRPYLSEAWFVERSAPPRLEWAEKR--SATDMKEQLRFWARAVACNAKQ  318

Query  217  E  215
            +
Sbjct  319  D  319



>ref|XP_009586598.1| PREDICTED: uncharacterized protein LOC104084453 [Nicotiana tomentosiformis]
Length=214

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 18/122 (15%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +S  +LELEE+KGFMDLGF F +E  + + ++++PGL++              W  + E 
Sbjct  107  RSSSDLELEELKGFMDLGFEFSEEDKNSRLVTIIPGLEK--------------WGKRAEE  152

Query  394  EDEDDMERG-RVRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
              E+  +R    RPYLSEAW I      +  LL  R P      ++K +LR WA+TVA+ 
Sbjct  153  IVENSKKRDVNSRPYLSEAWEILEKGKMSKKLLKWRFPALHNEINMKDNLRVWAQTVAST  212

Query  226  IR  221
             R
Sbjct  213  FR  214



>emb|CAN63558.1| hypothetical protein VITISV_034122 [Vitis vinifera]
Length=399

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 21/120 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EEV+GF DLGF F+KE  S   ++++PGLQ    +K             R  
Sbjct  300  KSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGLQ----VK------------DRGG  343

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
              E+D  R   RPYLSEAW+ +    P+ N      S+A D+K  ++ WA+ VA+ + QE
Sbjct  344  PVEEDSVR---RPYLSEAWIEQCSAPPIPNWV--GKSSAQDMKAQIKFWARAVASNVHQE  398



>ref|XP_006411544.1| hypothetical protein EUTSA_v10017132mg [Eutrema salsugineum]
 gb|ESQ52997.1| hypothetical protein EUTSA_v10017132mg [Eutrema salsugineum]
Length=254

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 67/129 (52%), Gaps = 17/129 (13%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQRL         V K    
Sbjct  135  RRGKSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQRL---------VKKDDGG  185

Query  406  QREHEDEDDMERGRVRPYLSEAWLI------KSPNSPLLNLRMPR-ASAAADVKRHLRHW  248
             R  E+         RPYLSEAW +      K   +P +  R+P  A    ++K HL+ W
Sbjct  186  LRVTEENISNGNRVARPYLSEAWDLCGGRKGKRQMTPEIKWRVPAPAVKEVELKDHLKLW  245

Query  247  AKTVATVIR  221
            A  VA+ IR
Sbjct  246  AHAVASTIR  254



>ref|XP_002285236.1| PREDICTED: uncharacterized protein LOC100257151 [Vitis vinifera]
Length=399

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 21/120 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EEV+GF DLGF F+KE  S   ++++PGLQ    +K             R  
Sbjct  300  KSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGLQ----VK------------DRGG  343

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
              E+D  R   RPYLSEAW+ +    P+ N      S+A D+K  ++ WA+ VA+ + QE
Sbjct  344  PVEEDSVR---RPYLSEAWIEQCSAPPIPNWV--GKSSAQDMKAQIKFWARAVASNVHQE  398



>ref|NP_181804.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD21731.1| unknown protein [Arabidopsis thaliana]
 gb|ABF83685.1| At2g42760 [Arabidopsis thaliana]
 gb|AEC10165.1| uncharacterized protein AT2G42760 [Arabidopsis thaliana]
Length=267

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 73/130 (56%), Gaps = 14/130 (11%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F + +      +S++PGLQRL     K +  +     
Sbjct  142  RKGKSMSDLEYEELKGFMDLGFVFSEDDHKDSDLVSILPGLQRL----VKKDDGVTKEEE  197

Query  406  QREHEDEDDMERGRVRPYLSEAW------LIKSPNSPLLNLRMPRASAAA--DVKRHLRH  251
            + E ED+    R   RPYLSEAW        K   +P +  R+P  +AA+  D+K +LR 
Sbjct  198  EEEEEDKIGGNRA-ARPYLSEAWDHCGGRKGKKQITPEIKWRVPAPAAASEVDLKDNLRL  256

Query  250  WAKTVATVIR  221
            WA  VA+ IR
Sbjct  257  WAHAVASTIR  266



>ref|XP_010059032.1| PREDICTED: uncharacterized protein LOC104446940 [Eucalyptus grandis]
Length=466

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 74/125 (59%), Gaps = 7/125 (6%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRL-QLIKAKPERVLKSWNSQR  401
            KSL ELE EEVKGFMDLGF+F +E +   ++ S++PGLQRL + IK   E      + Q 
Sbjct  138  KSLSELEFEEVKGFMDLGFVFAEEDSVDSSLVSIIPGLQRLGKKIKDGDEDDEDGDHHQE  197

Query  400  EHEDEDDMERGRV--RPYLSEAWLIKSPNS---PLLNLRMPRASAAADVKRHLRHWAKTV  236
            + ++++ +    V  RPYLSEAW          PL+N ++P      D++  L+ WA TV
Sbjct  198  DGDEKEIVGEPAVVARPYLSEAWEWWEEKKEEDPLMNWKVPALGNETDMRESLKSWAHTV  257

Query  235  ATVIR  221
            A+ ++
Sbjct  258  ASTVQ  262



>ref|XP_004243270.1| PREDICTED: uncharacterized protein LOC101267910 [Solanum lycopersicum]
Length=231

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 28/145 (19%)
 Frame = -1

Query  628  AACKSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQL  449
            A C+S+   S+ S     KSL ELE EE+KGFMDLGF F ++      +S++PGL+RL +
Sbjct  106  ANCRSRKKKSNNS-----KSLSELEFEELKGFMDLGFEFSEKDKDSNLVSIIPGLKRLGM  160

Query  448  IKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLN-----LRMPRAS  284
               + ER            DE+D E G  RP+LSEAW +      + +     L++ +  
Sbjct  161  ---ENERGF----------DEND-ESGVSRPHLSEAWGVWEEQKKMEDWKKNSLKIWKFD  206

Query  283  A----AADVKRHLRHWAKTVATVIR  221
            +      ++K  L+ WA TVA+ +R
Sbjct  207  SDFGNEMEIKHQLKFWAHTVASTVR  231



>ref|XP_003541833.1| PREDICTED: uncharacterized protein LOC100803315 [Glycine max]
 gb|KHN36857.1| hypothetical protein glysoja_001588 [Glycine soja]
Length=334

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 64/117 (55%), Gaps = 21/117 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +SL +LE EEV+GF DLGF F+KE  S    S++PGLQ                  +R+ 
Sbjct  235  RSLSDLEFEEVQGFKDLGFSFEKETLSPSLASILPGLQ----------------EKKRDE  278

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
             +ED   R   RPYLSEAWL++S    + N    ++S   D+K  ++ WA+ VA+ +
Sbjct  279  TEEDKAAR---RPYLSEAWLVQSCAPAIPNWTSHKSS--GDMKVQIKFWARAVASNV  330



>ref|XP_010059037.1| PREDICTED: uncharacterized protein LOC104446945 [Eucalyptus grandis]
Length=174

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 9/118 (8%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQR  401
            KSL ELE EE+KGF+DLGF+F +E R +   +S++P LQRL + IK   E      N +R
Sbjct  50   KSLSELEFEELKGFVDLGFVFSEEDRVNSSLVSIIPRLQRLDKKIKDGNEDDEDG-NHRR  108

Query  400  EHEDEDDM--ERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWA  245
            E  DE ++  E   V RPYLSEAW     K    PL+N ++P      D++  L+ W 
Sbjct  109  EDGDEKEIVSEPSVVGRPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMRESLKWWG  166



>ref|XP_010506114.1| PREDICTED: uncharacterized protein LOC104782786 [Camelina sativa]
Length=268

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 13/130 (10%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQR  L+K   + +++  N 
Sbjct  144  RKGKSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQR--LVKKDHDGLVQVTN-  200

Query  406  QREHEDEDDMERGRVRPYLSEAW----LIKSPNSPLLNL--RMPRASAA-ADVKRHLRHW  248
             +E ED+ ++     RPYLSEAW      K      + +  R+P  +A   D+K +LR W
Sbjct  201  -KEEEDKSNIN-TVARPYLSEAWDHCGGRKGEKQITMEIKWRVPVPAAKEVDLKDNLRLW  258

Query  247  AKTVATVIRQ  218
            A  VA+ IR+
Sbjct  259  AHAVASTIRR  268



>ref|XP_009142082.1| PREDICTED: uncharacterized protein LOC103865964 [Brassica rapa]
 emb|CDY47987.1| BnaA04g24650D [Brassica napus]
Length=244

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 69/127 (54%), Gaps = 24/127 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KS+ +LE EE+KGF+DLGF+F +E +   + +S++PGLQRL     K + V         
Sbjct  133  KSMSDLEFEELKGFIDLGFVFSEEDQRDSELVSILPGLQRL----VKKDDVT--------  180

Query  397  HEDEDDMERGRVRPYLSEAW------LIKSPNSPLLNLRMPRASAAADV--KRHLRHWAK  242
              +E+DM     RPYLSEAW        K   +P +  ++P      +V  K HL+ WA 
Sbjct  181  --EEEDMSNVN-RPYLSEAWDHCGGRKGKRHITPAIKWKVPAVPEVKEVELKDHLKQWAH  237

Query  241  TVATVIR  221
             VA+ IR
Sbjct  238  AVASTIR  244



>gb|KCW74145.1| hypothetical protein EUGRSUZ_E02780 [Eucalyptus grandis]
Length=250

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 19/114 (17%)
 Frame = -1

Query  541  KGFMDLGFIF-DKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQREHEDEDDMERG  368
            KGF+DLGF+F +++R     +S++PGLQRL   IK              E +DED  E  
Sbjct  149  KGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGNKIK------------DGEEDDEDAGESV  196

Query  367  RV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA-TVIR  221
             V RPYLSEAW     K    PL+N ++P      D+K  L+ WA TVA TV+R
Sbjct  197  VVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKESLKWWAHTVASTVVR  250



>emb|CDY14852.1| BnaC04g48490D [Brassica napus]
Length=252

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (55%), Gaps = 20/130 (15%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGF+DLGF+F +E +   + +S++PGLQRL          +K  + 
Sbjct  134  RRGKSMSDLEFEELKGFIDLGFVFSEEDQRDSELVSILPGLQRL----------VKKDDG  183

Query  406  QREHEDEDDMERGRVRPYLSEAW------LIKSPNSPLLNLRMPRASAAADV--KRHLRH  251
              +  +E+D+     RPYLSEAW        K   +P +  ++P      +V  K HL+ 
Sbjct  184  VGDVTEEEDISNIN-RPYLSEAWDHCGGRKGKRHITPAIKWKVPAVPEVKEVELKDHLKQ  242

Query  250  WAKTVATVIR  221
            WA  VA+ IR
Sbjct  243  WAHAVASTIR  252



>ref|XP_002523267.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39106.1| conserved hypothetical protein [Ricinus communis]
Length=342

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 69/120 (58%), Gaps = 24/120 (20%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KS  +LE +EV+GF DLGF F+K+      + ++PGLQ+               +++R+ 
Sbjct  245  KSQSDLESQEVQGFKDLGFTFNKQDLDPSVVGILPGLQQ---------------DNKRQD  289

Query  394  EDEDDMERGRVRPYLSEAWLIKS--PNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            +D+ D  +   RPYLSEAW ++S  P  PL   +    ++A D+K  L++WA+ VA+ +R
Sbjct  290  QDQKDEVK---RPYLSEAWHVQSCAPPIPLWATK----NSAEDMKVQLKYWARAVASNVR  342



>ref|XP_010040852.1| PREDICTED: uncharacterized protein LOC104429715 [Eucalyptus grandis]
 gb|KCW44864.1| hypothetical protein EUGRSUZ_L01560 [Eucalyptus grandis]
Length=250

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 19/114 (17%)
 Frame = -1

Query  541  KGFMDLGFIF-DKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQREHEDEDDMERG  368
            KGF+DLGF+F +++R     +S++PGLQRL   IK              E +DED  E  
Sbjct  149  KGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGNKIK------------DGEEDDEDAGESV  196

Query  367  RV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA-TVIR  221
             V RPYLSEAW     K    PL+N ++P      D+K  L+ WA TVA TV+R
Sbjct  197  VVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKESLKWWAHTVASTVVR  250



>ref|XP_011082714.1| PREDICTED: uncharacterized protein LOC105165412 [Sesamum indicum]
Length=315

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 63/118 (53%), Gaps = 23/118 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL  LE +E++GF DLGF FDK+  +   +S++PGLQ  + I                 
Sbjct  221  KSLSYLESKELQGFRDLGFDFDKKDLNPNVVSIIPGLQEKKRI-----------------  263

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
              EDD E+ R RPYLSEAW     ++P+      + S   ++K  ++ WA+ VA+ +R
Sbjct  264  --EDDEEKNRTRPYLSEAWN----SAPMAPKWGGKRSKEDNIKAQIKFWARAVASNVR  315



>ref|XP_010059038.1| PREDICTED: uncharacterized protein LOC104446946 [Eucalyptus grandis]
 gb|KCW74144.1| hypothetical protein EUGRSUZ_E02779 [Eucalyptus grandis]
Length=250

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 19/114 (17%)
 Frame = -1

Query  541  KGFMDLGFIF-DKERTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNSQREHEDEDDMERG  368
            KGF+DLGF+F +++R     +S++PGLQRL   IK              E +DED  E  
Sbjct  149  KGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGNKIK------------DGEEDDEDAGESV  196

Query  367  RV-RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA-TVIR  221
             V RPYLSEAW     K    PL+N ++P      D+K  L+ WA TVA TV+R
Sbjct  197  VVGRPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKESLKWWAHTVASTVVR  250



>ref|XP_010098450.1| hypothetical protein L484_012165 [Morus notabilis]
 gb|EXB75041.1| hypothetical protein L484_012165 [Morus notabilis]
Length=353

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 23/121 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFD-KERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            +SL ELE+EEV+GF DLGF FD K+  S   ++++PGLQ                  +R+
Sbjct  254  RSLSELEIEEVQGFKDLGFKFDNKDLLSPNVVNILPGLQ------------------ERK  295

Query  397  HEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIRQ  218
             ED     + R RPYLSEAW+ +S   P  N    R+S   ++K  ++ WA++VA+ +RQ
Sbjct  296  EEDMGLQNKVR-RPYLSEAWMAQSA-PPTPNWAASRSS--QEMKAQIKFWARSVASNVRQ  351

Query  217  E  215
            E
Sbjct  352  E  352



>ref|XP_009341291.1| PREDICTED: uncharacterized protein LOC103933323 [Pyrus x bretschneideri]
Length=324

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 28/122 (23%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE+EE++GF DLGF FD +  S   ++++PGLQ                    E 
Sbjct  227  KSLSDLEIEELQGFKDLGFTFDTKELSPNVVNILPGLQ--------------------EK  266

Query  394  EDEDDMERGRV-RPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
            +  +D+    V RPYLSE WL +S   P  P+L        +  D+K  ++ WA++VA+ 
Sbjct  267  KRSEDLNLIHVRRPYLSEVWLAQSCAAPPPPILGA----TRSTEDIKAQIKFWARSVASN  322

Query  226  IR  221
            +R
Sbjct  323  VR  324



>ref|XP_009115260.1| PREDICTED: uncharacterized protein LOC103840505 [Brassica rapa]
Length=139

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (56%), Gaps = 19/120 (16%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +S+ +LE EE KGF+DLGF+F +E  + +   ++PGL+                   RE 
Sbjct  37   ESVSDLEAEETKGFIDLGFVFTEEDLNSELPEILPGLRTFL---------------HREE  81

Query  394  EDEDDMERGRVRPYLSEAWLIKS--PNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            + + D      RPYLSEAW + S   +S +L+LRM +  +  ++K  L+ WA++VA+ ++
Sbjct  82   QSKTD--SSVPRPYLSEAWELHSNKKDSIVLDLRMAKICSETNMKDCLKWWARSVASSLK  139



>ref|XP_010062846.1| PREDICTED: uncharacterized protein LOC104450110 [Eucalyptus grandis]
 gb|KCW69982.1| hypothetical protein EUGRSUZ_F03292 [Eucalyptus grandis]
Length=349

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 25/122 (20%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EEV+GF +LGF F+++  + K + ++PGLQ                  ++  
Sbjct  250  KSLSDLEDEEVRGFKELGFSFEEKHLNPKLVDILPGLQ------------------EKTQ  291

Query  394  EDEDDMERGRVRPYLSEAWLIKS--PNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            E+ED    G   PYLSE WL +S  P  P  N    +  +  D+K  ++ WA+ VA+ +R
Sbjct  292  ENEDG--NGNEAPYLSEGWLAQSYAPAVPKWNA---KGGSPEDMKAQIKFWARVVASNVR  346

Query  220  QE  215
            QE
Sbjct  347  QE  348



>ref|XP_008363621.1| PREDICTED: uncharacterized protein LOC103427337 [Malus domestica]
Length=320

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 28/122 (23%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE+EE++GF DLGF F KE  +   ++++PGLQ                    + 
Sbjct  223  KSLSDLEIEELQGFKDLGFTFXKEELTPSVVNILPGLQ--------------------DK  262

Query  394  EDEDDMERGRV-RPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
            +  +D+    V RPYLSE WL +S   P  P L        +A D+K  ++ WA++VA+ 
Sbjct  263  KRSEDLNPAHVRRPYLSEVWLAQSCAAPPPPNLGA----TQSAEDMKAQIKFWARSVASN  318

Query  226  IR  221
            +R
Sbjct  319  VR  320



>emb|CDY50782.1| BnaA09g54110D [Brassica napus]
Length=145

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 25/126 (20%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +S+ +LE EE KGF+DLGF+F +E  + +   ++PGLQ                   RE 
Sbjct  37   ESVSDLEAEETKGFIDLGFVFTEEDLNSELPEILPGLQTFL---------------HREE  81

Query  394  EDEDDMERGRVRPYLSEAWLIKS--------PNSPLLNLRMPRASAAADVKRHLRHWAKT  239
            + + D      RPYLSEAW + S         +S +L+LRM +  +  ++K  L+ WA++
Sbjct  82   QSKTD--SSVPRPYLSEAWELHSNKWSERAKKDSIVLDLRMAKICSETNMKDCLKWWARS  139

Query  238  VATVIR  221
            VA+ ++
Sbjct  140  VASSLK  145



>ref|XP_010675463.1| PREDICTED: uncharacterized protein LOC104891465 [Beta vulgaris 
subsp. vulgaris]
Length=327

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 25/130 (19%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFD-KERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            +S KSL +LE+EE++GF DLGF FD K+  S     ++P LQR                 
Sbjct  215  KSQKSLTDLEVEELQGFKDLGFSFDNKDDLSPGVTQILPALQR-----------------  257

Query  406  QREHEDEDDMER-GRV-RPYLSEAWLIK--SPNS--PLLNLRMPRASAAADVKRHLRHWA  245
             R   D ++++  G+V RPYLSE+W  K  SP S  P L     +AS++ D+K  ++ WA
Sbjct  258  -RASLDSNNVDNIGKVRRPYLSESWQQKTSSPISAPPALKWDDQKASSSEDMKAQIKFWA  316

Query  244  KTVATVIRQE  215
            + VA+ +RQE
Sbjct  317  RAVASNVRQE  326



>dbj|BAK07204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 4/118 (3%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRL--QLIKAKPERVLKSWNSQREHED  389
            ELE EEVKG  DLGF F +     +  S+VPGL+RL  +    + +   +    +R    
Sbjct  145  ELEFEEVKGLQDLGFTFSETEVDAELASIVPGLRRLRAEEEAKRAKAEAEEEACRRNRAA  204

Query  388  EDDMERGRVRPYLSEAWLIKSP--NSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
             +       RPYLSEAW  +       L N R+P A+  AD+K +LR WA TVA+ +R
Sbjct  205  AEASHAAPRRPYLSEAWEDEEAEVRRMLSNFRIPAAADGADLKENLRLWAHTVASAVR  262



>ref|XP_004967336.1| PREDICTED: uncharacterized protein LOC101777454 [Setaria italica]
Length=383

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 60/124 (48%), Gaps = 22/124 (18%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  +S G+LE  EV+GF DLGF+FDKE   +    V+PGL++    K    R       
Sbjct  281  DKKWRSSGDLESIEVQGFRDLGFVFDKEDLRESLAGVLPGLKQQAAGKTGRSRSSSG---  337

Query  406  QREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATV  227
                           RPYLSEAW       P L      A +AA+VK  LR WA+ VA  
Sbjct  338  ---------------RPYLSEAWQ----RPPALVRVQSEARSAAEVKDQLRMWAQAVACN  378

Query  226  IRQE  215
            +RQE
Sbjct  379  VRQE  382



>ref|XP_006348891.1| PREDICTED: uncharacterized protein LOC102578884 [Solanum tuberosum]
Length=238

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 75/146 (51%), Gaps = 24/146 (16%)
 Frame = -1

Query  628  AACKSQSHTSS-PSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQ  452
            AA K++++  S     ++ KSL ELE EE+KGFMDLGF F  +      +S++PGL+RL 
Sbjct  107  AAVKNRANVRSRKKRSKNSKSLSELEFEELKGFMDLGFEFSDKDKDSNLVSIIPGLKRLG  166

Query  451  LIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASA---  281
            +   + ER            DE+D E G  RP+LSEAW +      + + +     +   
Sbjct  167  M---ENERGF----------DEND-ESGVSRPHLSEAWGVWEEKKKMEDWKKNALKSWKI  212

Query  280  ------AADVKRHLRHWAKTVATVIR  221
                    ++K  L+ WA TVA+ +R
Sbjct  213  NSDFGNEMEIKDQLKFWAHTVASTVR  238



>gb|AFW86969.1| hypothetical protein ZEAMMB73_882946 [Zea mays]
Length=171

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 62/124 (50%), Gaps = 7/124 (6%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHE  392
            S+ ELE EEVKG  DLGF F       +  S+VPGL+R +  +    R   +  S    E
Sbjct  48   SMSELEFEEVKGLQDLGFTFADAEVDAELASIVPGLRRKRSEEDNNSRATAASTSSARPE  107

Query  391  DEDDMERGRV----RPYLSEAW---LIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
              DD     V    RPYLSEAW     +     L + R+P A    ++K HLR WA TVA
Sbjct  108  AADDASVAAVVAPRRPYLSEAWDSEEEEEVRRALRSWRIPPAGDGNELKEHLRMWAHTVA  167

Query  232  TVIR  221
            + +R
Sbjct  168  SAVR  171



>ref|XP_010517817.1| PREDICTED: uncharacterized protein LOC104793203 [Camelina sativa]
Length=265

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (57%), Gaps = 10/130 (8%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQRL + K     V  +   
Sbjct  138  RKGKSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQRL-VTKDHDGLVQVTKEE  196

Query  406  QREHEDEDDMERGRVRPYLSEAW------LIKSPNSPLLNLRMP-RASAAADVKRHLRHW  248
            + E ED+ ++ R   RPYLSEAW        +   +  +  R+P  A+   D+K +LR W
Sbjct  197  EGEEEDKSNINRV-ARPYLSEAWDHCGGRKGEKQITTKIKWRVPVLAAKEVDLKDNLRLW  255

Query  247  AKTVATVIRQ  218
            A  VA+ IR+
Sbjct  256  AHAVASTIRR  265



>ref|XP_010230679.1| PREDICTED: uncharacterized protein LOC100823668 [Brachypodium 
distachyon]
Length=406

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 72/132 (55%), Gaps = 8/132 (6%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  KS   LE  EV+GF DLGF+FDKE   +    V+PGL+  +  K+       S ++
Sbjct  274  DKMWKSSSALESIEVQGFKDLGFVFDKEELRESLADVLPGLRDSKAAKSSGSVSAGSGSA  333

Query  406  QREHEDEDDMERGRV----RPYLSEAWLIKSPNSPL----LNLRMPRASAAADVKRHLRH  251
              +++D +    G      RPYLSEAW   + ++P     + L+   A +AA++K  +R 
Sbjct  334  SDDNDDTNGSAVGDGETVRRPYLSEAWHHGARSAPPAAAGIRLQQADARSAAEMKDQIRM  393

Query  250  WAKTVATVIRQE  215
            WA+ VA  +RQE
Sbjct  394  WAQAVACNVRQE  405



>ref|XP_009790979.1| PREDICTED: uncharacterized protein LOC104238348 [Nicotiana sylvestris]
Length=222

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 61/120 (51%), Gaps = 20/120 (17%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHED  389
            L ELE EE+KGFMDLGF F  +      +S++PGL+RL                 RE+E+
Sbjct  118  LSELEFEELKGFMDLGFEFSDKDKDSSLVSILPGLRRL----------------GRENEE  161

Query  388  E---DDMERGRV-RPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
                +++E   V RP+LSEAW +      +     P      ++K  LR WA TVA+ +R
Sbjct  162  NMRFEELEEAAVSRPHLSEAWAVWEEKKKISWKINPVLRNEMEIKDQLRFWAHTVASTVR  221



>gb|KFK37122.1| hypothetical protein AALP_AA4G215600 [Arabis alpina]
Length=251

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (52%), Gaps = 21/130 (16%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            R  KS+ +LE EE+KGFMDLGF+F +E       +S++PGLQR  L+K +   V  +   
Sbjct  134  RRGKSMSDLECEEIKGFMDLGFVFSEEDHKDSDLVSILPGLQR--LVKREDGVVKVTEEE  191

Query  406  QREHEDEDDMERGRVRPYLSEAW------LIKSPNSPLLNLRMPR--ASAAADVKRHLRH  251
            + ++           RPY+SE W        K   +P +  R+P    +   D K HL+ 
Sbjct  192  EEDNR----------RPYMSEVWDRCERRKGKKQFTPEIKWRVPAPVTTNEVDYKDHLKL  241

Query  250  WAKTVATVIR  221
            WA  VA+ IR
Sbjct  242  WAHAVASTIR  251



>ref|XP_008659691.1| PREDICTED: uncharacterized protein LOC103638600 [Zea mays]
 ref|XP_008659692.1| PREDICTED: uncharacterized protein LOC103638601 isoform X1 [Zea 
mays]
 ref|XP_008659693.1| PREDICTED: uncharacterized protein LOC103638601 isoform X2 [Zea 
mays]
 gb|AFW86967.1| hypothetical protein ZEAMMB73_603245 [Zea mays]
 gb|AFW86968.1| hypothetical protein ZEAMMB73_418121 [Zea mays]
Length=264

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 62/124 (50%), Gaps = 7/124 (6%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHE  392
            S+ ELE EEVKG  DLGF F       +  S+VPGL+R +  +    R   +  S    E
Sbjct  141  SMSELEFEEVKGLQDLGFTFADAEVDAELASIVPGLRRKRSEEDNNSRATAASTSSARPE  200

Query  391  DEDDMERGRV----RPYLSEAW---LIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
              DD     V    RPYLSEAW     +     L + R+P A    ++K HLR WA TVA
Sbjct  201  AADDASVAAVVAPRRPYLSEAWDSEEEEEVRRALRSWRIPPAGDGNELKEHLRMWAHTVA  260

Query  232  TVIR  221
            + +R
Sbjct  261  SAVR  264



>emb|CDX99803.1| BnaC05g22250D [Brassica napus]
Length=145

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 25/126 (20%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            +S+ +LE EE KGF+DLGF+F +E  + +   ++PGL+                      
Sbjct  37   ESVSDLEAEETKGFIDLGFVFTEEDLNSELPEILPGLRTF-----------------LHG  79

Query  394  EDEDDMERGRVRPYLSEAWLIKS--------PNSPLLNLRMPRASAAADVKRHLRHWAKT  239
            E++   +    RPYLSEAW + S         +S +L+LRM +  +  ++K  L+ WA++
Sbjct  80   EEQSKTDSSVPRPYLSEAWELHSNKWSERAKKDSIVLDLRMAKICSETNMKDCLKWWARS  139

Query  238  VATVIR  221
            VA+ ++
Sbjct  140  VASSLK  145



>ref|XP_003629798.1| hypothetical protein MTR_8g086670 [Medicago truncatula]
Length=97

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = -1

Query  532  MDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRV-RP  356
            MDLGF+F +E      + ++PGLQRL     K        N + E E+ED  +   V RP
Sbjct  1    MDLGFVFSEEDKDSSLVEIIPGLQRL----GKK-------NEEEEEEEEDVYDESVVQRP  49

Query  355  YLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            YLSEAW +   +    PL+N ++P  +   D+K  LR WA+TVA+ +R
Sbjct  50   YLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTVASTVR  97



>emb|CBI30714.3| unnamed protein product [Vitis vinifera]
Length=177

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 19/101 (19%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE +E+KGF+DLGF+F +       +S++PGL RL                +++ 
Sbjct  77   KSLSDLEFDELKGFIDLGFVFSEGAKDSSLVSIIPGLHRL---------------GKKDG  121

Query  394  EDEDDMERGRV-RPYLSEAWLI---KSPNSPLLNLRMPRAS  284
            E+E  ++   V RPYLSEAW +   +   +PL+N R+P  S
Sbjct  122  EEEKTVDESAVPRPYLSEAWEVLDRRKKENPLMNWRVPALS  162



>ref|XP_007148013.1| hypothetical protein PHAVU_006G173300g [Phaseolus vulgaris]
 gb|ESW20007.1| hypothetical protein PHAVU_006G173300g [Phaseolus vulgaris]
Length=220

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 15/82 (18%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE EE+KGFMDLGF+F +E       S++PGLQRL                + + 
Sbjct  119  KSLSDLESEELKGFMDLGFVFSEEDKDSSLASIIPGLQRL---------------GKSDE  163

Query  394  EDEDDMERGRVRPYLSEAWLIK  329
            E+ED       RPYLSEAW ++
Sbjct  164  EEEDSDGSAVQRPYLSEAWKVQ  185



>ref|XP_006303202.1| hypothetical protein CARUB_v10011127mg [Capsella rubella]
 gb|EOA36100.1| hypothetical protein CARUB_v10011127mg [Capsella rubella]
Length=145

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 24/125 (19%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHE  392
            S+ +LE EE KGFMDLGF+F +E  + +   ++PGL           R   S   Q+  E
Sbjct  37   SVSDLEAEETKGFMDLGFVFTEEDLNSELPEILPGL-----------RTFLSREEQKRTE  85

Query  391  DEDDMERGRVRPYLSEAWLIKSPN--------SPLLNLRMPRASAAADVKRHLRHWAKTV  236
                 E    RPYLSE W   S N        S +++  M ++    ++K  L+ WA++V
Sbjct  86   -----ESSVRRPYLSETWDFNSDNWSGRTDEESMVIDFTMAKSCGENNMKESLKWWARSV  140

Query  235  ATVIR  221
            A+ ++
Sbjct  141  ASNLK  145



>gb|ACU17606.1| unknown [Glycine max]
Length=220

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 10/94 (11%)
 Frame = -1

Query  619  KSQSHTSSPSLDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKA  440
            KS  H       R+ +SL ELE +E+KGFMDLGF+F +E    K  S++PGLQRL     
Sbjct  118  KSFGHGRRARKVRTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRLG----  173

Query  439  KPERVLKSWNSQREHEDEDDMERGRVRPYLSEAW  338
                  +  + + + +D+  +     +PYLSEAW
Sbjct  174  ------REEDEEGQGDDQSVVSDNNNKPYLSEAW  201



>ref|XP_010059036.1| PREDICTED: uncharacterized protein LOC104446944 [Eucalyptus grandis]
Length=133

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 60/103 (58%), Gaps = 7/103 (7%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRL-QLIKAKPERVLKSWNS  407
            S KSL E E +E+KGFMDLGF+F  E + +   +S++PGLQRL + IK   E    S N 
Sbjct  24   SSKSLSEPEFKELKGFMDLGFVFSGEDKVNSSLVSIIPGLQRLGKKIKDGDEDDEDSDNH  83

Query  406  QREHEDEDDMERGRV--RPYLSEAWLI---KSPNSPLLNLRMP  293
            + +  ++  +    V  RPYLSEAW     K    PL+N ++P
Sbjct  84   REDGNEKASIGEPAVVGRPYLSEAWEWWEEKRKEDPLMNWKIP  126



>gb|EMT32203.1| hypothetical protein F775_12035 [Aegilops tauschii]
Length=214

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (48%), Gaps = 29/151 (19%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  KS   LE  EV+GF DLGF+FD+E   +    V+PGL+  +    KP +   S + 
Sbjct  65   DKMWKSSSALESIEVQGFKDLGFVFDQEELRESLADVLPGLRDDKT--NKPHKSSGSVSG  122

Query  406  QREHEDED---------------------DMERGRV-RPYLSEAWLIKSPNSP-----LL  308
                 D D                     D+  G V RPYLSEAW   + ++P      +
Sbjct  123  SGSTSDNDDSTANANGIVIGTSNSNAAGNDVGDGVVRRPYLSEAWQHGARSAPPTAAAAI  182

Query  307  NLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
             L+   A +AA++K  +R WA+ VA  +RQE
Sbjct  183  RLQQADARSAAEMKDQIRMWAQAVACNVRQE  213



>gb|KCW74143.1| hypothetical protein EUGRSUZ_E02775 [Eucalyptus grandis]
Length=219

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGFMDLGF+F +E R     +S++PGLQRL       +   +  +  RE
Sbjct  139  KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSIIPGLQRLGKKIKDGDEDDEDGDHHRE  198

Query  397  HEDEDDM--ERGRVRPYLSEA  341
              DE ++  E    RPYLSEA
Sbjct  199  DGDEKEIVGEPAVARPYLSEA  219



>ref|XP_006643978.1| PREDICTED: uncharacterized protein LOC102712021 [Oryza brachyantha]
Length=374

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 71/130 (55%), Gaps = 6/130 (5%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERV--LKSW  413
            D+  +S  +LE  EV+GF DLGF+FD+E   ++   V+PGL+      +       + + 
Sbjct  244  DKRWESSSDLESIEVQGFRDLGFVFDQEELRERLADVLPGLRGKSKTPSGSGSASDVDND  303

Query  412  NSQREHEDEDDMERGRV-RPYLSEAWL-IKSPNSPLLNLRMPRASA--AADVKRHLRHWA  245
            ++          + G V RPYLSEAW  ++ P +    LR+ ++ A  AA++K  +R WA
Sbjct  304  DANTTAAAATGSDNGTVRRPYLSEAWYHVRRPAATAAALRLQQSDARSAAEMKDQIRMWA  363

Query  244  KTVATVIRQE  215
            + VA  +RQE
Sbjct  364  QAVACNVRQE  373



>emb|CDM82557.1| unnamed protein product [Triticum aestivum]
Length=399

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 71/149 (48%), Gaps = 27/149 (18%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  KS   LE  EV+GF DLGF+FD+E   +    V+PGL+  +    KP +   S + 
Sbjct  252  DKMWKSSSALESIEVQGFKDLGFVFDQEELRESLADVLPGLRDDK--ANKPHKSSGSVSG  309

Query  406  QREHEDEDDMER-------------------GRV-RPYLSEAWLIKSPNSP-----LLNL  302
                 D DD                      G V RPYLSEAW   + ++P      + L
Sbjct  310  SGSTSDNDDSSANANGIGIGTSNAACNDGGDGIVRRPYLSEAWQHGARSAPPTAAAAIRL  369

Query  301  RMPRASAAADVKRHLRHWAKTVATVIRQE  215
            +   A +AA++K  +R WA+ VA  +RQE
Sbjct  370  QQADARSAAEMKDQIRMWAQAVACNVRQE  398



>ref|XP_006303781.1| hypothetical protein CARUB_v10012027mg [Capsella rubella]
 gb|EOA36679.1| hypothetical protein CARUB_v10012027mg [Capsella rubella]
Length=170

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (51%), Gaps = 24/124 (19%)
 Frame = -1

Query  568  LGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHED  389
            + +LE EE+KGFMDLGF+F KE  + +   ++PGL+        PE  L+   S      
Sbjct  63   VSDLEAEEIKGFMDLGFVFTKEDLNSELPKILPGLRAFLC----PEEHLEKEPSVLP---  115

Query  388  EDDMERGRVRPYLSEAWLIKS--------PNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
                     RPYLSEAW +           +S +++ RM +     ++K  L+ WA++VA
Sbjct  116  ---------RPYLSEAWDVYDDKCSRLTEKDSTVIDFRMAKLRGEKNMKDSLKLWARSVA  166

Query  232  TVIR  221
            + ++
Sbjct  167  SSLK  170



>ref|XP_002457038.1| hypothetical protein SORBIDRAFT_03g000320 [Sorghum bicolor]
 gb|EES02158.1| hypothetical protein SORBIDRAFT_03g000320 [Sorghum bicolor]
Length=341

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 68/145 (47%), Gaps = 34/145 (23%)
 Frame = -1

Query  631  LAACKSQSHTSSPS-----LDRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPG  467
            +A C S+  TS         D+  KS  +LE  EV+GF DLGF+F+ E   +    V+PG
Sbjct  224  VARCSSKKQTSGGFHQLQLQDKKWKSSSDLESIEVQGFRDLGFVFEHEELRESLADVLPG  283

Query  466  LQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAW-LIKSPNSPLLNLRMPR  290
            L++                     + +      R RPYLSEAW  ++ P        + R
Sbjct  284  LKQ---------------------QTKSTSTSPRPRPYLSEAWQQVRRPA-------LAR  315

Query  289  ASAAADVKRHLRHWAKTVATVIRQE  215
              +AA++K  LR WA+ VA  +RQE
Sbjct  316  VQSAAEMKDQLRMWAQAVACNVRQE  340



>ref|NP_001042550.1| Os01g0241000 [Oryza sativa Japonica Group]
 dbj|BAB40104.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04464.1| Os01g0241000 [Oryza sativa Japonica Group]
 gb|EAY73235.1| hypothetical protein OsI_01112 [Oryza sativa Indica Group]
 gb|EAZ11208.1| hypothetical protein OsJ_01062 [Oryza sativa Japonica Group]
 dbj|BAG99776.1| unnamed protein product [Oryza sativa Japonica Group]
Length=383

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 70/138 (51%), Gaps = 22/138 (16%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  KS  +LE  EV+GF DLGF+FD+E   +    V+PGL      + KP        S
Sbjct  253  DKKWKSSSDLESIEVQGFRDLGFVFDQEELRESLADVLPGL------RGKP--TPTGSGS  304

Query  406  QREHEDED--------DMERGRVRPYLSEAWL------IKSPNSPLLNLRMPRASAAADV  269
              +++D +        D      RPYLSEAW        +SP +  + L+   A +AA++
Sbjct  305  ASDNDDANTATTATGSDAVAAVRRPYLSEAWYHVRRPAPRSPAAAAMRLQQADARSAAEM  364

Query  268  KRHLRHWAKTVATVIRQE  215
            K  LR WA+ VA  +RQE
Sbjct  365  KDQLRMWAQAVACNVRQE  382



>ref|XP_002978809.1| hypothetical protein SELMODRAFT_443974 [Selaginella moellendorffii]
 gb|EFJ20256.1| hypothetical protein SELMODRAFT_443974 [Selaginella moellendorffii]
Length=371

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 59/125 (47%), Gaps = 27/125 (22%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +S  ELE +EV+G  DLGF   K R                     P RV+    S 
Sbjct  271  KTTRSWSELEFDEVRGLRDLGF---KPREGD----------------LMPRRVVSLATST  311

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRAS--AAADVKRHLRHWAKTVAT  230
                        R R Y S AW I+ P+SPLLNLRMP  +     D+K HL+ WA+ VA+
Sbjct  312  ARSSPR------RERIYPSHAWSIRRPDSPLLNLRMPDPNRQGVEDMKAHLKFWARAVAS  365

Query  229  VIRQE  215
             +RQE
Sbjct  366  TVRQE  370



>ref|XP_002984723.1| hypothetical protein SELMODRAFT_423830 [Selaginella moellendorffii]
 gb|EFJ14368.1| hypothetical protein SELMODRAFT_423830 [Selaginella moellendorffii]
Length=374

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 61/125 (49%), Gaps = 27/125 (22%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            ++ +S  ELE +EV+G  DLGF     + S+  +               P RV+    S 
Sbjct  274  KTTRSWSELEFDEVRGLRDLGF-----KPSEGDL--------------MPRRVVSLATST  314

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRAS--AAADVKRHLRHWAKTVAT  230
                        R R Y S AW I+ P+SPLLNLRMP  +     D+K HL+ WA+ VA+
Sbjct  315  ARSSPR------RERIYPSHAWSIRRPDSPLLNLRMPDPNRQGVEDMKAHLKFWARAVAS  368

Query  229  VIRQE  215
             +RQE
Sbjct  369  TVRQE  373



>ref|XP_008366658.1| PREDICTED: uncharacterized protein LOC103430300 [Malus domestica]
Length=93

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 51/107 (48%), Gaps = 17/107 (16%)
 Frame = -1

Query  532  MDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPY  353
            MDLGF+F +E      +S++ GLQRL                + + +DE   E    R Y
Sbjct  1    MDLGFVFSEEDKDSNLVSIIHGLQRL--------------GKKDDSKDESSDEFAITRLY  46

Query  352  LSEAWLIKSP---NSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            LSEAW +K       PL+N   P      D+K +L+ WA  VA+ I+
Sbjct  47   LSEAWEVKEKRKIEKPLMNSGFPALENEIDMKDNLKWWAHIVASAIK  93



>gb|EPS61787.1| hypothetical protein M569_13011, partial [Genlisea aurea]
Length=95

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 57/115 (50%), Gaps = 32/115 (28%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KS  ELE+EE+KGFMDLGF F +E  S + + ++PGL+RL                  E 
Sbjct  11   KSSAELEMEELKGFMDLGFEFRRENLSDRLILLIPGLRRL----------------ADED  54

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVAT  230
             + ++      RPYLSE+W+  S                 D+K  L+ WA+TVA+
Sbjct  55   PEIEEETEITERPYLSESWVWGS----------------QDLKWRLKLWARTVAS  93



>ref|XP_010314075.1| PREDICTED: uncharacterized protein LOC104644911 [Solanum lycopersicum]
Length=192

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 23/112 (21%)
 Frame = -1

Query  541  KGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDMERGRV  362
            KGFMDLGF F +E  +   + +VPGL++  ++                  DE+  ++  V
Sbjct  99   KGFMDLGFEFSEEDKNSSLVRIVPGLEKWGIV------------------DENVKKKDIV  140

Query  361  --RPYLSEAWLI---KSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
              RPYLSEAW I   +  +  LL  R P      ++K +LR WA+TVA+  +
Sbjct  141  HKRPYLSEAWEILEKRKMSKKLLKWRFPAMKNDMNMKHNLRFWAQTVASTFK  192



>ref|XP_001753980.1| predicted protein [Physcomitrella patens]
 gb|EDQ81302.1| predicted protein [Physcomitrella patens]
Length=512

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            +  KSL +LE EE++G  DLGF   K+  +   + + PGLQR  +      +     + Q
Sbjct  392  KGTKSLTDLEYEELRGLKDLGFEVSKDDLTPPVVRMFPGLQRQGIPPYNSPQSQSQASVQ  451

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
              H +++ + + R  P     W  + P+SPL+N   P    + D+K  L+ WA  +A+++
Sbjct  452  NTHPNQNVLSQSRFTPVQHLLW-PRRPDSPLIN--TPFLDPSIDMKGQLKTWASEMASIV  508

Query  223  RQE  215
              E
Sbjct  509  STE  511



>gb|KCW75609.1| hypothetical protein EUGRSUZ_E04347, partial [Eucalyptus grandis]
Length=244

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 7/114 (6%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EEVKGFMDLGF+F +E +   ++ S++PGLQRL       +   +  +  RE
Sbjct  131  KSLSELEFEEVKGFMDLGFVFSEEDSVDSSLVSIIPGLQRLGKKIKDGDEDDEDGDHHRE  190

Query  397  HEDEDDM--ERGRV-RPYLSEAWLIKSPN---SPLLNLRMPRASAAADVKRHLR  254
              DE ++  E   V RPYLSEAW          PL+N ++P      D++  L+
Sbjct  191  DGDEKEIVGEPAVVARPYLSEAWEWWEEERKEDPLMNWKVPALGNETDMRESLK  244



>dbj|BAJ89671.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 70/157 (45%), Gaps = 34/157 (22%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  KS   LE  EV+GF DLGF+FD+E   +    V+PGL R   I  KP +   S + 
Sbjct  215  DKMWKSSSALESIEVQGFKDLGFVFDQEELRESLADVLPGL-RDDKITNKPHKSSVSGSV  273

Query  406  QREHEDEDDMERGRV----------------------------RPYLSEAWLIKSPNSP-  314
                   D+ +   V                            RPYLSEAW   + ++P 
Sbjct  274  SGSGSASDNDDSTTVNNANGIGIGIGIGTGTGTSNSNDDGVVRRPYLSEAWQHGARSAPP  333

Query  313  ----LLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
                 + L+   A +AA++K  +R WA+ VA  +RQE
Sbjct  334  TAAAAIRLQQADARSAAEMKDQIRMWAQAVACNVRQE  370



>dbj|BAJ89680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 70/157 (45%), Gaps = 34/157 (22%)
 Frame = -1

Query  586  DRSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNS  407
            D+  KS   LE  EV+GF DLGF+FD+E   +    V+PGL R   I  KP +   S + 
Sbjct  243  DKMWKSSSALESIEVQGFKDLGFVFDQEELRESLADVLPGL-RDDKITNKPHKSSVSGSV  301

Query  406  QREHEDEDDMERGRV----------------------------RPYLSEAWLIKSPNSP-  314
                   D+ +   V                            RPYLSEAW   + ++P 
Sbjct  302  SGSGSASDNDDSTTVNNANGIGIGIGIGTGTGTSNSNDDGVVRRPYLSEAWQHGARSAPP  361

Query  313  ----LLNLRMPRASAAADVKRHLRHWAKTVATVIRQE  215
                 + L+   A +AA++K  +R WA+ VA  +RQE
Sbjct  362  TAAAAIRLQQADARSAAEMKDQIRMWAQAVACNVRQE  398



>gb|ABK23726.1| unknown [Picea sitchensis]
Length=178

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 64/122 (52%), Gaps = 32/122 (26%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KS  +LE++E+KGFM+LGF F +++ S + + ++PGL+RL         + +++N +
Sbjct  87   RGPKSTCDLEIQELKGFMELGFDFSQDKLSPRLLDLLPGLKRL--------LIGRNFNKK  138

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASA-AADVKRHLRHWAKTVATV  227
             E  +                       SPL N  +P  +A   D+K HL+ WA++VA+ 
Sbjct  139  IEFRE-----------------------SPLENWELPTLNATGGDLKEHLKLWARSVASS  175

Query  226  IR  221
            ++
Sbjct  176  LK  177



>gb|EYU30762.1| hypothetical protein MIMGU_mgv1a022590mg [Erythranthe guttata]
Length=157

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 59/132 (45%), Gaps = 44/132 (33%)
 Frame = -1

Query  598  SPSLDRSCKSLGELELEEVKGFMDLGFIF---------DKERTSKKTMSVVPGLQRLQLI  446
            SP    + +SL ELE EE+KGFMDLGF+F         DK     + +S+VPGLQ  +  
Sbjct  56   SPKSVLTGRSLSELEFEELKGFMDLGFVFRPELEEVKMDKYYNYSRLVSIVPGLQIFRH-  114

Query  445  KAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVK  266
                       + +R+H++E           L + W            ++P      D+K
Sbjct  115  -----------SRRRDHKNE-----------LLDYW------------KIPAFVNEIDLK  140

Query  265  RHLRHWAKTVAT  230
             HLR WA +V +
Sbjct  141  NHLRFWAHSVVS  152



>ref|XP_010059033.1| PREDICTED: uncharacterized protein LOC104446941 [Eucalyptus grandis]
Length=231

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGFMDLGF+F +E R     +S++PGLQRL       +   +  +  RE
Sbjct  139  KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSIIPGLQRLGKKIKDGDEDDEDGDHHRE  198

Query  397  HEDEDDM--ERGRV-RPYLSEAWLI  332
              DE ++  E   V RPYLSE  ++
Sbjct  199  DGDEKEIVGEPAVVARPYLSERGMV  223



>gb|ABK22856.1| unknown [Picea sitchensis]
Length=161

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 64/122 (52%), Gaps = 32/122 (26%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  KS  +LE++E+KGFM+LGF F +++ S + + ++PGL+RL         + +++N +
Sbjct  70   RGPKSTCDLEIQELKGFMELGFDFSQDKLSPRLLDLLPGLKRL--------LIGRNFNKK  121

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASA-AADVKRHLRHWAKTVATV  227
             E  +                       SPL N  +P  +A   D+K HL+ WA++VA+ 
Sbjct  122  IEFRE-----------------------SPLENWELPTLNATGVDLKEHLKLWARSVASS  158

Query  226  IR  221
            ++
Sbjct  159  LK  160



>gb|EYU28109.1| hypothetical protein MIMGU_mgv1a022012mg, partial [Erythranthe 
guttata]
Length=149

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 19/119 (16%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMS-VVPGLQRLQLIKAKPERVLKSWNSQREHEDE  386
            ELE EE+KGFMDLGF+F +E     +++ ++PGL +L   K K +  L       EHE  
Sbjct  45   ELEFEELKGFMDLGFVFSEEDKLDSSLADIIPGLHKLGQ-KKKMDCNLSDDYYHEEHE--  101

Query  385  DDMERGRVRPYLSEAW---LIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTV-ATVIR  221
                  R RPYLSE W   L+K    P     +       D+K  L+ WA +V A+ +R
Sbjct  102  ------RERPYLSEVWERELLKKWRVP-----VDIVGNEIDMKDSLKWWAHSVIASAVR  149



>ref|XP_009390133.1| PREDICTED: uncharacterized protein LOC103976591 [Musa acuminata 
subsp. malaccensis]
Length=201

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 55/117 (47%), Gaps = 23/117 (20%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  +S  E+E  EV+GF DLGF+F +E  S +   VV  L+  + I              
Sbjct  102  RKWRSYSEMEAFEVQGFRDLGFVFVEEGPSARLADVVRCLRDKRPISG------------  149

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
                     + G  R YLSEAWLI+    P L     R  +AAD K  LR WA+TVA
Sbjct  150  ---------DGGGCRAYLSEAWLIERTAPPKLAWEERR--SAADAKEQLRLWARTVA  195



>ref|XP_004155514.1| PREDICTED: uncharacterized protein LOC101232662 [Cucumis sativus]
Length=202

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 30/116 (26%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTM-SVVPGLQRLQLIKAKPERVLKSWNSQREHEDE  386
            +LE EE+KGFMDLGF+F +E  +   + S++PGL RL      P++       QR+ E  
Sbjct  115  DLEFEELKGFMDLGFVFSEEDKNDSNLGSIIPGLHRL-----GPKK-------QRKKESI  162

Query  385  DDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAA-ADVKRHLRHWAKTVATVIR  221
            ++     +                L+  R+P   A   D+K HL+ WA TVA+ +R
Sbjct  163  EEENEKMI----------------LMKWRVPSLGATEMDIKHHLKFWAHTVASTVR  202



>ref|NP_001057835.1| Os06g0550800 [Oryza sativa Japonica Group]
 dbj|BAD53711.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF19749.1| Os06g0550800 [Oryza sativa Japonica Group]
 gb|EAZ37306.1| hypothetical protein OsJ_21644 [Oryza sativa Japonica Group]
Length=283

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 63/146 (43%), Gaps = 41/146 (28%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQR----------------------  458
            S+ ELE EEVKG  DLGF F ++    +  S+VPGL+R                      
Sbjct  150  SMSELEFEEVKGLQDLGFTFSEDDVDAELASIVPGLRRRRSDEDDAREAPAAAAASAEEE  209

Query  457  ---LQLIKAKPERVLKSWNSQREHEDEDDMERGRVRPYLSEAWLIKSPN--SPLLNLRMP  293
                + I + P     S++S               RPYLSEAW  +       L N R+P
Sbjct  210  AASSRRIGSAPAGTSSSFSSAPR------------RPYLSEAWDDEEEEMRRMLRNWRIP  257

Query  292  RA--SAAADVKRHLRHWAKTVATVIR  221
             A     AD+K  LR WA TVA+ +R
Sbjct  258  PAGDGDGADLKEQLRLWAHTVASAVR  283



>gb|KCW45545.1| hypothetical protein EUGRSUZ_L00734 [Eucalyptus grandis]
Length=224

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 35/120 (29%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE+EE+KGF+DLGF+F +++R     +S++PGLQRL               ++ +
Sbjct  138  KSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRL--------------GNKIK  183

Query  397  HEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA-TVIR  221
              +EDD + G                     L +       D+K  L+ WA TVA TV+R
Sbjct  184  DGEEDDEDAGEF-------------------LLLGTIGNETDMKESLKWWAHTVASTVVR  224



>gb|KCW74141.1| hypothetical protein EUGRSUZ_E02773 [Eucalyptus grandis]
Length=220

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGFMDLGF+F +E R     +S++PGLQRL     K  +     +   +
Sbjct  139  KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSIIPGLQRL----GKKIKDGDEDDEDGD  194

Query  397  HEDEDDMERGRVRPYLSEAWLI  332
            H  ED +     RPYLSE  ++
Sbjct  195  HHREDVV----ARPYLSERGMV  212



>gb|AFG65733.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65734.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65735.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65736.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65737.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65738.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65739.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65740.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65741.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65742.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65743.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65744.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65745.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65746.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65747.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65748.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65749.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
Length=141

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 32/122 (26%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQR  401
            S KS  +LEL+E+KG M+LGF F ++  + + +S++PGL+RL                  
Sbjct  42   SPKSRVDLELQELKGLMELGFEFRRDHLTPRLLSLLPGLKRLA-----------------  84

Query  400  EHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAA-ADVKRHLRHWAKTVATVI  224
            +HE+                  +    SPL N  +P  +AA  D+K+HL+ WA++VA+ +
Sbjct  85   DHENSSKN--------------LGFQESPLENWELPNPNAADVDMKKHLKLWARSVASKL  130

Query  223  RQ  218
            ++
Sbjct  131  KR  132



>gb|ADE77004.1| unknown [Picea sitchensis]
Length=160

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 64/122 (52%), Gaps = 32/122 (26%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R+ KS  + EL+E+KG M+LGF F K++ + + ++++PGL+RL                 
Sbjct  59   RAPKSRIDSELQELKGSMELGFEFRKDQLTPRLLNLLPGLKRLL----------------  102

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAA-ADVKRHLRHWAKTVATV  227
             +HE+  D              ++    SPL N  +P  +AA  D+K H++ WA++VA+ 
Sbjct  103  -DHENSTD--------------ILGFEESPLENWELPNLNAAEVDMKEHIKLWARSVAST  147

Query  226  IR  221
            ++
Sbjct  148  LK  149



>ref|XP_004965581.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Setaria 
italica]
Length=264

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 58/127 (46%), Gaps = 10/127 (8%)
 Frame = -1

Query  571  SLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQR--------LQLIKAKPERVLKS  416
            S+ ELE EEVKG  DLGF F       +  S+VPGL+R             A       +
Sbjct  138  SMSELEFEEVKGLQDLGFTFSDAEVDAELASIVPGLRRKRSEEENSRATASAPAAPRAAA  197

Query  415  WNSQREHEDEDDMERGRVRPYLSEAWLIKSP--NSPLLNLRMPRASAAADVKRHLRHWAK  242
             +S    E+         RPYLSEAW  +       L N R+P      D+K HLR WA 
Sbjct  198  SSSALREEEATAAAPAPRRPYLSEAWDDEEEEVRRALRNWRIPPPGNGNDLKEHLRMWAH  257

Query  241  TVATVIR  221
            TVA+ +R
Sbjct  258  TVASAVR  264



>gb|KGN65040.1| hypothetical protein Csa_1G181530 [Cucumis sativus]
Length=167

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 37/132 (28%)
 Frame = -1

Query  562  ELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDED  383
            ELE EE+KGFMDLGF+F +E       S+VPGL               +W  +RE E+E+
Sbjct  55   ELEFEELKGFMDLGFVFSEEDKGSILASIVPGL---------------NWLGKREEEEEE  99

Query  382  DMER-GRV-RPYLSEAW----------------LIKSPNSPLLNLRMPRASAAADVKRHL  257
            + +  G + RPYLSEAW                 +K P   ++  R P  S    +K +L
Sbjct  100  EQKLCGEISRPYLSEAWETMEEEEEEEEEEEKVELKKP--LMMKWRFP--SNEIHMKVNL  155

Query  256  RHWAKTVATVIR  221
            + WA  VA+ I+
Sbjct  156  KWWAHAVASTIK  167



>gb|KCW74142.1| hypothetical protein EUGRSUZ_E02774 [Eucalyptus grandis]
Length=174

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            S KSL E E +E+KGFMDLGF+F  E + +   +S++PGLQRL     K  +     +  
Sbjct  65   SSKSLSEPEFKELKGFMDLGFVFSGEDKVNSSLVSIIPGLQRL----GKKMKDGDEDDED  120

Query  403  REHEDEDDMERGRV-------RPYLSEAWLIKSPN---SPLLNLRMP  293
             ++  ED  E+  +       RPYLSEAW          PL+N ++P
Sbjct  121  SDNHREDGNEKASIGEPAVVGRPYLSEAWEWWEEERKEDPLMNWKIP  167



>ref|XP_010059034.1| PREDICTED: uncharacterized protein LOC104446942 [Eucalyptus grandis]
Length=149

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = -1

Query  580  SCKSLGELELEEVKGFMDLGFIFDKE-RTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            S KSL E E +E+KGFMDLGF+F  E + +   +S++PGLQRL     K  +     +  
Sbjct  40   SSKSLSEPEFKELKGFMDLGFVFSGEDKVNSSLVSIIPGLQRL----GKKMKDGDEDDED  95

Query  403  REHEDEDDMERGRV-------RPYLSEAWLIKSPN---SPLLNLRMP  293
             ++  ED  E+  +       RPYLSEAW          PL+N ++P
Sbjct  96   SDNHREDGNEKASIGEPAVVGRPYLSEAWEWWEEERKEDPLMNWKIP  142



>ref|XP_010040037.1| PREDICTED: uncharacterized protein LOC104428800 [Eucalyptus grandis]
Length=225

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 57/120 (48%), Gaps = 34/120 (28%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE+EE+KGF+DLGF+F +++R     +S++PGLQRL               ++ +
Sbjct  138  KSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRL--------------GNKIK  183

Query  397  HEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVA-TVIR  221
              +EDD + G                               D+K  L+ WA TVA TV+R
Sbjct  184  DGEEDDEDAGESVVVSVG------------------GVGMTDMKESLKWWAHTVASTVVR  225



>ref|XP_001752059.1| predicted protein [Physcomitrella patens]
 gb|EDQ83494.1| predicted protein [Physcomitrella patens]
Length=578

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 60/120 (50%), Gaps = 3/120 (3%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            +  KSL +LE EE++G+ DLGF   K+  +   + + PGL+R  +      + L    + 
Sbjct  296  KGTKSLTDLEYEELRGWKDLGFEVSKDDLTPHVVRMFPGLERQGIPPYNSPQSLSKNPAH  355

Query  403  REHEDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVI  224
              + +++ +   R  P     W  + P+SPL N   P    + D+K  L+ WA  +A+++
Sbjct  356  NVNPNQNALPHNRAPPVQHLLW-PRRPDSPLTN--TPFLDPSIDMKGQLKSWASEMASIV  412



>ref|XP_004159879.1| PREDICTED: uncharacterized protein LOC101225687 [Cucumis sativus]
Length=443

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 63/123 (51%), Gaps = 27/123 (22%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  +S  ELE EE++GF DLGF FDK+  +   + ++PG                     
Sbjct  344  RKRRSQSELESEELQGFKDLGFTFDKKDINPTVVDIIPG--------------------L  383

Query  403  REHEDEDDMERGRVRPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            RE ++E+       RPYLSEAW++++   P  P  + R     +A D+K+ ++ WA+ VA
Sbjct  384  REKKEEELESERTRRPYLSEAWMLQTHLLPPIPKWDNR----KSAEDMKQQIKFWARAVA  439

Query  232  TVI  224
            + +
Sbjct  440  SNV  442



>gb|KGN57636.1| hypothetical protein Csa_3G236040 [Cucumis sativus]
Length=484

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 63/123 (51%), Gaps = 27/123 (22%)
 Frame = -1

Query  583  RSCKSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQ  404
            R  +S  ELE EE++GF DLGF FDK+  +   + ++PG                     
Sbjct  385  RKRRSQSELESEELQGFKDLGFTFDKKDINPTVVDIIPG--------------------L  424

Query  403  REHEDEDDMERGRVRPYLSEAWLIKS---PNSPLLNLRMPRASAAADVKRHLRHWAKTVA  233
            RE ++E+       RPYLSEAW++++   P  P  + R     +A D+K+ ++ WA+ VA
Sbjct  425  REKKEEELESERTRRPYLSEAWMLQTHLLPPIPKWDNR----KSAEDMKQQIKFWARAVA  480

Query  232  TVI  224
            + +
Sbjct  481  SNV  483



>gb|KCW74146.1| hypothetical protein EUGRSUZ_E02782 [Eucalyptus grandis]
Length=230

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 19/111 (17%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIF-DKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQRE  398
            KSL ELE EE+KGF+DLGF+F +++R     +S++ GL    +IK            + +
Sbjct  114  KSLSELEFEELKGFVDLGFVFLEEDRVDSSLVSIISGL--CNIIKD---------GEEDD  162

Query  397  HEDEDDMERGR----VRPYLSEAWLI---KSPNSPLLNLRMPRASAAADVK  266
             + ++ +  G      RPYLSEAW     K    PL+  ++P      D+K
Sbjct  163  EDGDEKLTAGESVVVARPYLSEAWKWWEEKGKEDPLMKWKVPSLGNETDIK  213



>ref|XP_007212450.1| hypothetical protein PRUPE_ppa017283mg, partial [Prunus persica]
 gb|EMJ13649.1| hypothetical protein PRUPE_ppa017283mg, partial [Prunus persica]
Length=203

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 19/81 (23%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL +LE +E+KGFMDLGF         K +S++PGLQRL  I  +           R+ 
Sbjct  82   KSLSDLEFDELKGFMDLGF-------DSKLVSIIPGLQRLGSIGEQ----------DRDE  124

Query  394  EDEDDMERGRVRP--YLSEAW  338
            ED+ +     + P  +LSEAW
Sbjct  125  EDQRNNNNNNIDPSSHLSEAW  145



>gb|KDP45851.1| hypothetical protein JCGZ_15295 [Jatropha curcas]
Length=307

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 60/118 (51%), Gaps = 20/118 (17%)
 Frame = -1

Query  574  KSLGELELEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREH  395
            KSL  LE  +++GF DL F F+K+  +     ++P                 S N ++++
Sbjct  210  KSLSNLE-SQIEGFKDLEFPFNKQDLNPSKAGIIPV----------------SENKKKQN  252

Query  394  EDEDDMERGRVRPYLSEAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKTVATVIR  221
            +D D  ++ R RP LSE W ++S  SP+        S+  D+K  L+ WA+ VA+ +R
Sbjct  253  QDLD-QDKVRRRPCLSETWHVQSCASPIPIWAA--KSSTQDMKAQLKCWARAVASNVR  307



>gb|KGN65608.1| hypothetical protein Csa_1G470240 [Cucumis sativus]
Length=251

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 25/126 (20%)
 Frame = -1

Query  553  LEEVKGFMDLGFIFDKERTSKKTMSVVPGLQRLQLIKAKPERVLKSWNSQREHEDEDDME  374
             EE+KGFMDLGF+F +E       S+VPGL RL       +R  K      E E+E + E
Sbjct  136  FEELKGFMDLGFVFSEEDKGSSLASIVPGLNRLG------KREEKGNKEGEEEEEEKEEE  189

Query  373  R---GRV-RPYLS-----------EAWLIKSPNSPLLNLRMPRASAAADVKRHLRHWAKT  239
            R   G + RPYLS           +  L+K P   ++  R P  S   D+K +L+ WA  
Sbjct  190  RKLGGEISRPYLSEAWEAIAEEEEKEELLKRPL--MMKWRFP--SNQIDMKDNLKWWAHA  245

Query  238  VATVIR  221
            VA+ +R
Sbjct  246  VASTVR  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680