BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022K03

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    281   7e-84   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    280   1e-83   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    277   2e-82   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    275   9e-82   Nicotiana tomentosiformis
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    274   2e-81   Solanum peruvianum [Peruvian tomato]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    273   3e-81   Nicotiana sylvestris
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    273   3e-81   Solanum pennellii
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    273   3e-81   Solanum lycopersicum
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    272   1e-80   Tarenaya hassleriana [spider flower]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           271   3e-80   Glycine max [soybeans]
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    270   4e-80   Solanum tuberosum [potatoes]
gb|KHN13035.1|  Leucine-rich repeat receptor-like serine/threonin...    266   5e-80   Glycine soja [wild soybean]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    270   5e-80   Tarenaya hassleriana [spider flower]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    270   5e-80   Morus notabilis
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    270   9e-80   Pyrus x bretschneideri [bai li]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    269   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    269   1e-79   
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    269   1e-79   
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    269   1e-79   
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           268   2e-79   
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    268   2e-79   Sesamum indicum [beniseed]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    268   2e-79   Gossypium arboreum [tree cotton]
gb|KHN42601.1|  Leucine-rich repeat receptor-like serine/threonin...    264   3e-79   Glycine soja [wild soybean]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    268   4e-79   Nicotiana tomentosiformis
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    267   5e-79   Sesamum indicum [beniseed]
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         267   6e-79   Jatropha curcas
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    267   7e-79   Ricinus communis
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    267   9e-79   Fragaria vesca subsp. vesca
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    266   1e-78   
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    266   1e-78   Vitis vinifera
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             266   2e-78   Phaseolus vulgaris [French bean]
emb|CDP02660.1|  unnamed protein product                                266   2e-78   Coffea canephora [robusta coffee]
gb|KJB43996.1|  hypothetical protein B456_007G228700                    264   2e-78   Gossypium raimondii
dbj|BAF01968.1|  receptor protein kinase like protein                   247   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             265   4e-78   Prunus persica
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    265   5e-78   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    264   6e-78   Gossypium raimondii
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    264   7e-78   Cicer arietinum [garbanzo]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    264   8e-78   Citrus sinensis [apfelsine]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   264   8e-78   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             264   8e-78   Citrus clementina [clementine]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    263   1e-77   
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    263   2e-77   
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    263   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    262   3e-77   Populus euphratica
gb|KJB48795.1|  hypothetical protein B456_008G087500                    262   4e-77   Gossypium raimondii
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             262   5e-77   Populus trichocarpa [western balsam poplar]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    262   5e-77   Dimocarpus longan [longan]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    261   5e-77   Gossypium arboreum [tree cotton]
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    261   6e-77   Nelumbo nucifera [Indian lotus]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           261   1e-76   Glycine max [soybeans]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             260   1e-76   Capsella rubella
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    260   2e-76   Cucumis melo [Oriental melon]
gb|AES94465.2|  LRR receptor-like kinase family protein                 260   2e-76   Medicago truncatula
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    260   2e-76   Cucumis sativus [cucumbers]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             259   4e-76   Phaseolus vulgaris [French bean]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    259   5e-76   Phoenix dactylifera
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    259   5e-76   Camelina sativa [gold-of-pleasure]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    259   6e-76   Arabis alpina [alpine rockcress]
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    254   8e-76   Glycine soja [wild soybean]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          258   8e-76   
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    258   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             258   1e-75   
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             258   2e-75   
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    257   2e-75   Phoenix dactylifera
ref|NP_001237688.1|  receptor-like protein kinase precursor             257   3e-75   Glycine max [soybeans]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    257   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003608587.1|  Receptor-like protein kinase                       256   4e-75   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       257   4e-75   
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...    254   5e-75   Glycine soja [wild soybean]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    256   6e-75   
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    256   6e-75   Camelina sativa [gold-of-pleasure]
gb|KJB18113.1|  hypothetical protein B456_003G034400                    256   6e-75   Gossypium raimondii
emb|CDY45620.1|  BnaCnng13280D                                          255   7e-75   Brassica napus [oilseed rape]
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                255   1e-74   Erythranthe guttata [common monkey flower]
emb|CDY08759.1|  BnaA06g24650D                                          254   1e-74   Brassica napus [oilseed rape]
ref|XP_008785758.1|  PREDICTED: leucine-rich repeat receptor-like...    253   1e-74   
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    254   2e-74   Brassica rapa
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    253   5e-74   Elaeis guineensis
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...    252   7e-74   
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    253   9e-74   
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                    251   1e-73   Eucalyptus grandis [rose gum]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    252   2e-73   Oryza brachyantha
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         251   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             251   2e-73   Capsella rubella
gb|EAZ02682.1|  hypothetical protein OsI_24796                          251   2e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    251   2e-73   
emb|CDY02112.1|  BnaA03g40550D                                          251   3e-73   
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    251   4e-73   
emb|CDY23037.1|  BnaC07g31500D                                          251   4e-73   Brassica napus [oilseed rape]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          251   4e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    251   4e-73   Brassica rapa
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    251   4e-73   Arabis alpina [alpine rockcress]
ref|NP_001051418.1|  Os03g0773700                                       249   5e-73   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          250   5e-73   Sorghum bicolor [broomcorn]
gb|EAY92008.1|  hypothetical protein OsI_13698                          250   6e-73   Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 250   7e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    250   8e-73   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ84911.1|  predicted protein                                      250   9e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE60014.1|  hypothetical protein OsJ_12761                          249   9e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             249   1e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    248   2e-72   Oryza brachyantha
gb|AAO26313.1|  receptor-like protein kinase                            240   2e-72   Elaeis guineensis
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    249   2e-72   Setaria italica
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    248   3e-72   Elaeis guineensis
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...    246   4e-72   Triticum urartu
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             248   4e-72   
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    248   6e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    247   9e-72   Brachypodium distachyon [annual false brome]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    246   1e-71   Camelina sativa [gold-of-pleasure]
gb|ADB85328.1|  putative receptor protein kinase                        244   1e-71   Phyllostachys edulis [kikko-chiku]
gb|AAY32333.1|  RLK1                                                    244   2e-71   Phyllostachys praecox [zaozhu]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-71   
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-71   Eucalyptus grandis [rose gum]
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                        244   3e-71   
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    245   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    244   6e-71   Brachypodium distachyon [annual false brome]
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    244   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS74129.1|  hypothetical protein M569_00625                         243   2e-70   Genlisea aurea
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          242   5e-70   Sorghum bicolor [broomcorn]
emb|CBI35733.3|  unnamed protein product                                241   6e-70   Vitis vinifera
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    241   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    240   1e-69   Triticum urartu
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    239   5e-69   Zea mays [maize]
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        238   5e-69   
dbj|BAJ89729.1|  predicted protein                                      239   5e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN35202.1|  unknown                                                 226   6e-69   Zea mays [maize]
ref|NP_001169902.1|  uncharacterized protein LOC100383797               227   1e-67   
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    235   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    231   3e-66   Nicotiana sylvestris
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    229   2e-65   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    227   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...    226   2e-64   Elaeis guineensis
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             226   2e-64   
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    226   2e-64   Oryza brachyantha
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    226   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    226   2e-64   Nicotiana tomentosiformis
ref|XP_006858565.1|  hypothetical protein AMTR_s00071p00176900          225   3e-64   
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    226   3e-64   Solanum lycopersicum
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...    224   8e-64   Elaeis guineensis
gb|ACL54651.1|  unknown                                                 216   9e-64   Zea mays [maize]
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   224   9e-64   Citrus sinensis [apfelsine]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    224   9e-64   Citrus sinensis [apfelsine]
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    224   1e-63   Solanum tuberosum [potatoes]
ref|NP_001049453.1|  Os03g0228800                                       224   1e-63   
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase         224   1e-63   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99137.1|  predicted protein                                      223   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC74807.1|  hypothetical protein OsI_10619                          223   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    223   3e-63   
gb|EMT21762.1|  Receptor protein kinase CLAVATA1                        211   3e-63   
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...    222   4e-63   Tarenaya hassleriana [spider flower]
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    223   4e-63   Pyrus x bretschneideri [bai li]
ref|XP_006859064.1|  hypothetical protein AMTR_s00068p00198250          221   4e-63   
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...    222   5e-63   Tarenaya hassleriana [spider flower]
emb|CDO97616.1|  unnamed protein product                                222   5e-63   Coffea canephora [robusta coffee]
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    222   6e-63   
ref|XP_003592924.1|  Receptor-like protein kinase                       222   7e-63   Medicago truncatula
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    221   9e-63   
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             221   1e-62   Prunus persica
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    221   1e-62   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    221   1e-62   Setaria italica
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         221   2e-62   Jatropha curcas
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    221   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    221   2e-62   Fragaria vesca subsp. vesca
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    220   3e-62   Prunus mume [ume]
emb|CBI29704.3|  unnamed protein product                                219   3e-62   Vitis vinifera
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    220   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    220   3e-62   Malus domestica [apple tree]
gb|AHJ14779.1|  CLAVATA1                                                220   4e-62   Rhododendron ovatum
gb|KJB32855.1|  hypothetical protein B456_005G265400                    219   4e-62   Gossypium raimondii
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    219   4e-62   Gossypium arboreum [tree cotton]
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    219   4e-62   Vitis vinifera
gb|KDO77158.1|  hypothetical protein CISIN_1g012213mg                   213   4e-62   Citrus sinensis [apfelsine]
ref|NP_001145765.1|  uncharacterized protein LOC100279272               218   5e-62   
gb|EMT15500.1|  hypothetical protein F775_52402                         218   6e-62   
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...    219   7e-62   Phoenix dactylifera
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    219   8e-62   
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    219   9e-62   
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    219   1e-61   
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         218   1e-61   Jatropha curcas
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                218   1e-61   Erythranthe guttata [common monkey flower]
emb|CAN71863.1|  hypothetical protein VITISV_023530                     218   1e-61   Vitis vinifera
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    218   1e-61   
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    218   2e-61   Populus trichocarpa [western balsam poplar]
emb|CDP04113.1|  unnamed protein product                                218   2e-61   Coffea canephora [robusta coffee]
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    218   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             217   3e-61   Prunus persica
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    218   3e-61   Sesamum indicum [beniseed]
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...    217   3e-61   Cicer arietinum [garbanzo]
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    217   3e-61   
gb|KJB16198.1|  hypothetical protein B456_002G217000                    216   4e-61   Gossypium raimondii
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    217   5e-61   Ricinus communis
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    216   6e-61   Citrus sinensis [apfelsine]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    216   7e-61   Populus euphratica
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    216   7e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    216   7e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    216   7e-61   Nelumbo nucifera [Indian lotus]
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    216   7e-61   Gossypium arboreum [tree cotton]
gb|AAX96206.1|  Similar to receptor-like protein kinase 3               217   7e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KJB32927.1|  hypothetical protein B456_005G268400                    216   8e-61   Gossypium raimondii
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             216   1e-60   Populus trichocarpa [western balsam poplar]
gb|EEC67924.1|  hypothetical protein OsI_35629                          216   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    216   1e-60   Populus euphratica
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    216   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    216   1e-60   Pyrus x bretschneideri [bai li]
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    216   1e-60   Gossypium arboreum [tree cotton]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    216   1e-60   Gossypium raimondii
gb|KCW57119.1|  hypothetical protein EUGRSUZ_I02765                     214   2e-60   Eucalyptus grandis [rose gum]
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             215   2e-60   Citrus clementina [clementine]
dbj|BAJ90459.1|  predicted protein                                      215   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    215   2e-60   Phoenix dactylifera
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    214   2e-60   Populus euphratica
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     214   4e-60   Eucalyptus grandis [rose gum]
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    214   5e-60   Eucalyptus grandis [rose gum]
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    214   6e-60   Eucalyptus grandis [rose gum]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    213   7e-60   Prunus mume [ume]
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...    214   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...    213   1e-59   Morus notabilis
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    213   1e-59   
gb|EEE51888.1|  hypothetical protein OsJ_33462                          212   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    213   1e-59   Nicotiana tomentosiformis
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...    212   1e-59   
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    213   1e-59   Elaeis guineensis
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    212   2e-59   Vitis vinifera
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    211   3e-59   Nicotiana sylvestris
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...    212   4e-59   Morus notabilis
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...    210   8e-59   Cicer arietinum [garbanzo]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    210   1e-58   Glycine max [soybeans]
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    210   2e-58   Ricinus communis
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    209   3e-58   Elaeis guineensis
gb|KHN12015.1|  Leucine-rich repeat receptor-like serine/threonin...    207   4e-58   Glycine soja [wild soybean]
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    208   4e-58   Solanum lycopersicum
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             209   5e-58   Phaseolus vulgaris [French bean]
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...    207   6e-58   Glycine soja [wild soybean]
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    208   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    207   1e-57   
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    207   1e-57   Glycine max [soybeans]
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    207   1e-57   Glycine max [soybeans]
gb|EPS62062.1|  protein kinase                                          207   2e-57   Genlisea aurea
gb|KHM99687.1|  Leucine-rich repeat receptor-like serine/threonin...    204   2e-57   Glycine soja [wild soybean]
emb|CDX93999.1|  BnaC07g36330D                                          206   2e-57   
emb|CDX98665.1|  BnaA03g44500D                                          206   2e-57   
emb|CDY54567.1|  BnaA08g30460D                                          205   3e-57   Brassica napus [oilseed rape]
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...    207   3e-57   Brachypodium distachyon [annual false brome]
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    206   4e-57   Solanum tuberosum [potatoes]
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    206   4e-57   
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...    206   4e-57   Brassica rapa
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    205   6e-57   Brassica rapa
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             205   6e-57   Eutrema salsugineum [saltwater cress]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             205   7e-57   
emb|CDY31445.1|  BnaC03g63790D                                          204   7e-57   Brassica napus [oilseed rape]
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    205   9e-57   
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    205   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    205   9e-57   Camelina sativa [gold-of-pleasure]
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        204   9e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        204   1e-56   Gossypium arboreum [tree cotton]
emb|CBI27382.3|  unnamed protein product                                199   1e-56   Vitis vinifera
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             204   1e-56   Capsella rubella
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        204   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    204   1e-56   Glycine soja [wild soybean]
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                    204   2e-56   Arabis alpina [alpine rockcress]
gb|KJB29653.1|  hypothetical protein B456_005G112100                    204   2e-56   Gossypium raimondii
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    204   2e-56   Fragaria vesca subsp. vesca
ref|NP_001170600.1|  uncharacterized protein LOC100384637               190   2e-56   
gb|KEH33614.1|  LRR receptor-like kinase family protein                 203   3e-56   Medicago truncatula
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    203   4e-56   Cucumis sativus [cucumbers]
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...    203   5e-56   Tarenaya hassleriana [spider flower]
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    202   6e-56   Gossypium arboreum [tree cotton]
gb|KJB47871.1|  hypothetical protein B456_008G045400                    202   6e-56   Gossypium raimondii
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        201   1e-55   
ref|XP_003617299.1|  Receptor-like protein kinase                       201   1e-55   Medicago truncatula
emb|CBI19895.3|  unnamed protein product                                200   1e-55   Vitis vinifera
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             201   2e-55   
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    201   2e-55   
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    201   2e-55   Populus euphratica
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   201   2e-55   Citrus sinensis [apfelsine]
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             201   2e-55   Citrus clementina [clementine]
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         201   3e-55   
ref|XP_002307734.1|  receptor protein kinase                            201   3e-55   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        200   4e-55   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        199   7e-55   
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          199   9e-55   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    199   1e-54   
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    198   2e-54   
gb|KJB58082.1|  hypothetical protein B456_009G193600                    198   2e-54   
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...    198   3e-54   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    197   5e-54   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    196   5e-54   
ref|XP_002300697.2|  receptor protein kinase                            197   7e-54   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    196   1e-53   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    196   1e-53   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    196   2e-53   
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        196   2e-53   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        195   2e-53   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        195   2e-53   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...    195   2e-53   
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             195   3e-53   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    195   3e-53   
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    194   5e-53   
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    194   5e-53   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        194   7e-53   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        194   7e-53   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    194   8e-53   
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...    194   9e-53   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        194   9e-53   
emb|CDX87661.1|  BnaA07g32120D                                          194   9e-53   
gb|ADD64789.1|  CLAVATA1                                                194   1e-52   
emb|CDX73202.1|  BnaC06g36500D                                          194   1e-52   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        194   1e-52   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          193   1e-52   
gb|AAB58929.1|  CLV1 receptor kinase                                    193   1e-52   
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      193   1e-52   
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...    194   1e-52   
ref|NP_001140626.1|  uncharacterized LOC100272700                       183   2e-52   
emb|CDY62258.1|  BnaCnng39750D                                          192   2e-52   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        192   2e-52   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1        192   2e-52   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             192   4e-52   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             192   4e-52   
gb|AAP49010.1|  CLV1-like receptor kinase                               192   4e-52   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    191   9e-52   
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...    191   1e-51   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    191   1e-51   
gb|AAD02501.1|  receptor kinase                                         191   1e-51   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    191   1e-51   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        190   1e-51   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     190   2e-51   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        190   2e-51   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg                189   3e-51   
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...    189   6e-51   
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        188   1e-50   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        187   1e-50   
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   187   2e-50   
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        187   2e-50   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    185   1e-49   
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    185   3e-49   
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    184   3e-49   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    184   3e-49   
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480          184   4e-49   
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          184   4e-49   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    183   6e-49   
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    183   8e-49   
emb|CAD42335.1|  hypernodulation aberrant root formation protein        183   8e-49   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    182   1e-48   
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    182   1e-48   
gb|EEC79804.1|  hypothetical protein OsI_21242                          181   4e-48   
ref|NP_001174552.1|  Os05g0595950                                       181   4e-48   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              181   5e-48   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              181   5e-48   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    180   8e-48   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    180   8e-48   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    179   2e-47   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     179   2e-47   
dbj|BAC41332.1|  LRR receptor-like kinase                               179   2e-47   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    179   2e-47   
emb|CAD42181.1|  serine-threonine protein kinase                        178   3e-47   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        178   4e-47   
gb|AAW71475.1|  CLV1-like receptor kinase                               177   6e-47   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   177   8e-47   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          177   8e-47   
gb|KHN39812.1|  Receptor protein kinase CLAVATA1                        176   9e-47   
ref|XP_010941307.1|  PREDICTED: leucine-rich repeat receptor-like...    175   1e-46   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     176   2e-46   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             176   2e-46   
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    176   2e-46   
ref|XP_008645089.1|  PREDICTED: leucine-rich repeat receptor-like...    176   2e-46   
gb|EMT07441.1|  Receptor protein kinase CLAVATA1                        172   3e-46   
ref|NP_001058593.1|  Os06g0717200                                       175   6e-46   
gb|ABE79572.2|  Protein kinase                                          174   8e-46   
emb|CAA61510.1|  leucine-rich repeat/receptor protein kinase            174   9e-46   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             174   1e-45   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             174   1e-45   
gb|EAZ02372.1|  hypothetical protein OsI_24476                          173   3e-45   
gb|AAX94895.1|  Similar to receptor-like protein kinase                 159   4e-45   
gb|AIT55304.1|  nodulation autoregulation receptor kinase               172   6e-45   
gb|EMS49990.1|  Leucine-rich repeat receptor-like serine/threonin...    164   9e-45   
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...    171   1e-44   
gb|EPS70741.1|  hypothetical protein M569_04011                         169   6e-44   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                169   6e-44   
ref|XP_002439033.1|  hypothetical protein SORBIDRAFT_10g030270          169   9e-44   
dbj|BAJ98758.1|  predicted protein                                      167   4e-43   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    167   4e-43   
gb|EYU33270.1|  hypothetical protein MIMGU_mgv1a0010742mg               152   1e-42   
ref|XP_003560328.2|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    165   2e-42   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             164   2e-42   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             164   2e-42   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          164   3e-42   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    163   8e-42   
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                     162   2e-41   
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561             152   3e-38   
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    152   6e-38   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    152   7e-38   
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    151   1e-37   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-37   
ref|XP_010941444.1|  PREDICTED: leucine-rich repeat receptor-like...    148   8e-37   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             148   1e-36   
ref|XP_008781646.1|  PREDICTED: probable LRR receptor-like serine...    138   4e-36   
ref|XP_004986996.1|  PREDICTED: leucine-rich repeat receptor-like...    146   6e-36   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    143   8e-35   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    143   9e-35   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    142   1e-34   
ref|XP_004166710.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|XP_004146946.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    142   2e-34   
ref|XP_007038347.1|  Leucine-rich repeat protein kinase family pr...    142   2e-34   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             142   2e-34   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    141   3e-34   
ref|XP_010264363.1|  PREDICTED: leucine-rich repeat receptor-like...    141   3e-34   
gb|KHN07526.1|  Leucine-rich repeat receptor-like serine/threonin...    129   4e-34   
ref|XP_011018348.1|  PREDICTED: leucine-rich repeat receptor-like...    141   4e-34   
ref|XP_006837283.1|  hypothetical protein AMTR_s00111p00013770          141   4e-34   
ref|XP_008453906.1|  PREDICTED: leucine-rich repeat receptor-like...    141   4e-34   
gb|KHF97318.1|  Leucine-rich repeat receptor-like protein kinase TDR    140   5e-34   
gb|ABF73316.1|  clavata-like receptor                                   140   5e-34   
gb|KJB29385.1|  hypothetical protein B456_005G097600                    140   6e-34   
ref|XP_006490143.1|  PREDICTED: leucine-rich repeat receptor-like...    140   8e-34   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    140   8e-34   
gb|KJB07870.1|  hypothetical protein B456_001G049500                    140   8e-34   
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    140   9e-34   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    140   9e-34   
gb|KDP22440.1|  hypothetical protein JCGZ_26271                         140   1e-33   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    139   1e-33   
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    139   1e-33   
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    139   1e-33   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             139   1e-33   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    139   2e-33   
ref|XP_004240244.1|  PREDICTED: leucine-rich repeat receptor-like...    139   2e-33   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             139   2e-33   
ref|XP_010258856.1|  PREDICTED: leucine-rich repeat receptor-like...    139   2e-33   
ref|XP_010258857.1|  PREDICTED: leucine-rich repeat receptor-like...    139   2e-33   
ref|XP_006421630.1|  hypothetical protein CICLE_v10004254mg             139   2e-33   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    139   2e-33   
ref|XP_009333803.1|  PREDICTED: receptor protein kinase CLAVATA1-...    138   4e-33   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    137   5e-33   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    137   6e-33   
ref|XP_006355615.1|  PREDICTED: leucine-rich repeat receptor-like...    137   6e-33   
gb|ADU60070.2|  receptor-like kinase                                    132   7e-33   
ref|XP_008347571.1|  PREDICTED: receptor protein kinase CLAVATA1-...    137   8e-33   
ref|XP_010035036.1|  PREDICTED: leucine-rich repeat receptor-like...    137   8e-33   
ref|XP_010062386.1|  PREDICTED: leucine-rich repeat receptor-like...    137   9e-33   
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2     137   9e-33   
emb|CBI38662.3|  unnamed protein product                                136   1e-32   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315             137   1e-32   
gb|KHG23504.1|  Receptor-like protein kinase HAIKU2                     136   1e-32   
gb|AEP14546.1|  clavata 1-like protein                                  136   1e-32   
ref|XP_009627806.1|  PREDICTED: probable LRR receptor-like serine...    136   2e-32   
gb|KJB60035.1|  hypothetical protein B456_009G286600                    136   2e-32   
ref|XP_001774832.1|  CLL3 clavata1-like receptor S/T protein kina...    136   2e-32   
ref|XP_001776887.1|  CLL6 clavata1-like receptor S/T protein kina...    136   2e-32   
gb|KJB58765.1|  hypothetical protein B456_009G225300                    136   2e-32   
ref|XP_002890213.1|  leucine-rich repeat family protein                 136   2e-32   
gb|KDO81346.1|  hypothetical protein CISIN_1g047677mg                   128   3e-32   
ref|XP_009335176.1|  PREDICTED: probable LRR receptor-like serine...    135   3e-32   
ref|XP_008378672.1|  PREDICTED: receptor-like protein kinase HAIKU2     135   3e-32   
ref|XP_004307799.1|  PREDICTED: leucine-rich repeat receptor-like...    135   3e-32   
ref|XP_008381896.1|  PREDICTED: probable LRR receptor-like serine...    135   3e-32   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390             135   3e-32   
ref|XP_007200794.1|  hypothetical protein PRUPE_ppa024591mg             135   3e-32   
ref|XP_009342709.1|  PREDICTED: probable LRR receptor-like serine...    135   3e-32   
ref|XP_008237456.1|  PREDICTED: probable LRR receptor-like serine...    135   3e-32   
ref|XP_004253264.1|  PREDICTED: probable LRR receptor-like serine...    135   4e-32   
ref|XP_001754607.1|  CLL2 clavata1-like receptor S/T protein kina...    135   4e-32   
ref|XP_011042912.1|  PREDICTED: probable LRR receptor-like serine...    135   4e-32   
gb|KHG17335.1|  Receptor-like protein kinase HAIKU2                     135   4e-32   
ref|XP_009788025.1|  PREDICTED: leucine-rich repeat receptor-like...    135   4e-32   
emb|CDP05348.1|  unnamed protein product                                135   4e-32   
ref|NP_173166.2|  leucine-rich receptor-like protein kinase             135   5e-32   
ref|XP_011026324.1|  PREDICTED: probable LRR receptor-like serine...    135   5e-32   
ref|XP_002302156.2|  hypothetical protein POPTR_0002s06380g             135   5e-32   
gb|AAD50027.1|AC007651_22  Similar to leucine-rich receptor-like ...    135   5e-32   
emb|CDP00968.1|  unnamed protein product                                135   5e-32   
gb|KCW69145.1|  hypothetical protein EUGRSUZ_F02681                     134   5e-32   
ref|XP_011076386.1|  PREDICTED: leucine-rich repeat receptor-like...    135   6e-32   
gb|AGP76288.1|  floral organ number 1                                   124   6e-32   
ref|XP_006383645.1|  leucine-rich repeat transmembrane protein ki...    134   7e-32   
ref|XP_006358242.1|  PREDICTED: leucine-rich repeat receptor-like...    134   7e-32   
ref|XP_006306625.1|  hypothetical protein CARUB_v10008143mg             134   7e-32   
ref|XP_009611681.1|  PREDICTED: leucine-rich repeat receptor-like...    134   7e-32   
ref|XP_009768910.1|  PREDICTED: leucine-rich repeat receptor-like...    134   7e-32   
ref|XP_006359059.1|  PREDICTED: probable LRR receptor-like serine...    134   8e-32   
ref|XP_009606121.1|  PREDICTED: probable LRR receptor-like serine...    134   8e-32   
ref|XP_011073865.1|  PREDICTED: probable leucine-rich repeat rece...    134   9e-32   
ref|XP_004514509.1|  PREDICTED: leucine-rich repeat receptor-like...    134   9e-32   
ref|XP_004235172.1|  PREDICTED: leucine-rich repeat receptor-like...    134   9e-32   
ref|XP_006852580.1|  hypothetical protein AMTR_s00021p00211960          134   9e-32   
ref|XP_011044836.1|  PREDICTED: probable LRR receptor-like serine...    134   9e-32   
ref|XP_009335487.1|  PREDICTED: receptor-like protein kinase HAIKU2     134   9e-32   
ref|XP_010550816.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    134   9e-32   
ref|XP_004496421.1|  PREDICTED: probable LRR receptor-like serine...    134   9e-32   
ref|XP_010062076.1|  PREDICTED: probable LRR receptor-like serine...    134   1e-31   
ref|XP_006434540.1|  hypothetical protein CICLE_v10000119mg             134   1e-31   
gb|KDP24078.1|  hypothetical protein JCGZ_25735                         134   1e-31   
ref|XP_001774556.1|  predicted protein                                  134   1e-31   
ref|XP_006473875.1|  PREDICTED: probable LRR receptor-like serine...    134   1e-31   
gb|AGP76279.1|  floral organ number 1                                   123   1e-31   
ref|XP_008339015.1|  PREDICTED: receptor-like protein kinase HAIKU2     133   2e-31   
gb|AGP76284.1|  floral organ number 1                                   123   2e-31   



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   281 bits (718),  Expect = 7e-84, Method: Composition-based stats.
 Identities = 142/173 (82%), Positives = 148/173 (86%), Gaps = 8/173 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  835   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  894

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVR+MTDGKKEGV+KILD RLSTVP+HE MH+ YVA+LCVEEQAVE
Sbjct  895   KPVGEFGDGVDIVQWVRRMTDGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVE  954

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKD  226
             RPKMREVVQMLTELPK P G K E +T  ES      ALE P  T T  D KD
Sbjct  955   RPKMREVVQMLTELPK-PSGPKTEDSTITESPPSSGPALESP--TSTPGDTKD  1004



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   280 bits (717),  Expect = 1e-83, Method: Composition-based stats.
 Identities = 134/166 (81%), Positives = 147/166 (89%), Gaps = 6/166 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  835  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  894

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR+MTDGKKEGV+KILD+RLSTVP+HE MH+ YVA+LCVEEQAVE
Sbjct  895  KPVGEFGDGVDIVQWVRRMTDGKKEGVLKILDARLSTVPLHEVMHVFYVAMLCVEEQAVE  954

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDA  232
            RPKMREVVQMLTELP      KP G  + +S+  E PPS+G + ++
Sbjct  955  RPKMREVVQMLTELP------KPSGPKSGDSTITESPPSSGPASES  994



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   277 bits (708),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 142/190 (75%), Positives = 153/190 (81%), Gaps = 17/190 (9%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  832   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  891

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMT+GKKEGV+KILD RLSTVP+HE MH+ YVA+LCVEEQAVE
Sbjct  892   KPVGEFGDGVDIVQWVRKMTEGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVE  951

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-----------GTSDDAKDq  223
             RPKMREVVQ+LTELP       P GT + ES+  E PPS+           G + D    
Sbjct  952   RPKMREVVQILTELP------NPSGTKSGESTITESPPSSAPASELPTSAPGNTKDNHQP  1005

Query  222   qqppPDLLSI  193
               PPPDLLSI
Sbjct  1006  PSPPPDLLSI  1015



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   275 bits (703),  Expect = 9e-82, Method: Composition-based stats.
 Identities = 148/189 (78%), Positives = 157/189 (83%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  832   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  891

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+ YVA+LCVEEQAVE
Sbjct  892   KPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVE  951

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKD-----qq  220
             RP MREVVQ+LTELPK PPG+K   +T  ES     SALE P  T    D KD      Q
Sbjct  952   RPTMREVVQILTELPK-PPGSKSGDSTVTESPSPSASALESP--TSAPGDTKDHHQPTPQ  1008

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1009  SPPPDLLSI  1017



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   274 bits (700),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 147/189 (78%), Positives = 157/189 (83%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  830   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  889

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+ YVALLCVEEQAVE
Sbjct  890   KPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVE  949

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qq  220
             RP MREVVQ+LTELPK PPG K + +T  +     +SALE P  T    D KD      Q
Sbjct  950   RPTMREVVQILTELPK-PPGAKSDDSTGTDHSPPSASALESP--TSIPGDTKDHHQPTPQ  1006

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1007  SPPPDLLSI  1015



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   273 bits (699),  Expect = 3e-81, Method: Composition-based stats.
 Identities = 143/188 (76%), Positives = 156/188 (83%), Gaps = 10/188 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  833   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  892

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+ YVA+LCVEEQAVE
Sbjct  893   KPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVE  952

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACE------SSALEPPPS-TGTSDDAKDqqqpp  211
             RP MREVVQ+LTELPK PPG+K   +T  E      +SALE P S +G ++D        
Sbjct  953   RPTMREVVQILTELPK-PPGSKSGDSTVTELPPPSVASALESPASASGDTNDHHQPTPQS  1011

Query  210   --PDLLSI  193
               PDLLSI
Sbjct  1012  PPPDLLSI  1019



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   273 bits (699),  Expect = 3e-81, Method: Composition-based stats.
 Identities = 147/189 (78%), Positives = 157/189 (83%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  831   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  890

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+ YVALLCVEEQAVE
Sbjct  891   KPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVE  950

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qq  220
             RP MREVVQ+LTELPK PPG K + +T  +     +SALE P  T    D KD      Q
Sbjct  951   RPTMREVVQILTELPK-PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQ  1007

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1008  SPPPDLLSI  1016



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   273 bits (699),  Expect = 3e-81, Method: Composition-based stats.
 Identities = 147/189 (78%), Positives = 157/189 (83%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  831   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  890

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+ YVALLCVEEQAVE
Sbjct  891   KPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVE  950

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qq  220
             RP MREVVQ+LTELPK PPG K + +T  +     +SALE P  T    D KD      Q
Sbjct  951   RPTMREVVQILTELPK-PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQ  1007

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1008  SPPPDLLSI  1016



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   272 bits (695),  Expect = 1e-80, Method: Composition-based stats.
 Identities = 134/179 (75%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  838   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  897

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KE VVK++D RLS+VPI E  H+ YVA+LCVEEQAVE
Sbjct  898   KPVGEFGDGVDIVQWVRKMTDSNKESVVKVIDPRLSSVPIQEVTHVFYVAMLCVEEQAVE  957

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             RP MREVVQ+L E+PK PP +KP+ T   +S A E  P  G  DD  D  + PPDLLSI
Sbjct  958   RPTMREVVQILAEIPKMPP-SKPDPTAGEKSPAHESSPKGGRGDDGNDPGRVPPDLLSI  1015



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   271 bits (692),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 140/184 (76%), Positives = 154/184 (84%), Gaps = 7/184 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  831   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  890

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  891   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  950

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPD  205
             RP MREVVQ+LTELPK PPG+K    T  ESS     ALE  PS+ + +D    Q PPPD
Sbjct  951   RPTMREVVQILTELPK-PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPD  1008

Query  204   LLSI  193
             LLSI
Sbjct  1009  LLSI  1012



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   270 bits (691),  Expect = 4e-80, Method: Composition-based stats.
 Identities = 133/159 (84%), Positives = 142/159 (89%), Gaps = 4/159 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  831  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  890

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTDGKK+GV+KILD RLSTVP++E MH+ YVALLCVEEQAVE
Sbjct  891  KPVGEFGDGVDIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVE  950

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  253
            RP MREVVQ+LTELPK  PG K + +T  + S   PPPS
Sbjct  951  RPTMREVVQILTELPKS-PGAKSDDSTVTDQS---PPPS  985



>gb|KHN13035.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 154/184 (84%), Gaps = 7/184 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  543  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  602

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  603  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  662

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPD  205
            RP MREVVQ+LTELPK PPG+K    T  ESS     ALE  PS+ + +D    Q PPPD
Sbjct  663  RPTMREVVQILTELPK-PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPD  720

Query  204  LLSI  193
            LLSI
Sbjct  721  LLSI  724



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   270 bits (690),  Expect = 5e-80, Method: Composition-based stats.
 Identities = 133/179 (74%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVV+LEL++G+
Sbjct  834   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVILELITGR  893

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KE VVK+LD RLS+VPI+E MH+ YVA+LCVEE AVE
Sbjct  894   KPVGEFGDGVDIVQWVRKMTDSNKESVVKVLDPRLSSVPINEVMHVFYVAMLCVEELAVE  953

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             RP MREVVQ+LTE+PK  P  KPE   A +S A +  P  G+  D  D  + PPDLLSI
Sbjct  954   RPTMREVVQILTEIPKMRP-PKPEPNAAEDSPAYQSSPMAGSGKDGNDVSRDPPDLLSI  1011



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   270 bits (690),  Expect = 5e-80, Method: Composition-based stats.
 Identities = 134/162 (83%), Positives = 142/162 (88%), Gaps = 5/162 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  834  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  893

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VPIHE MH+ YVA+LCVEEQAVE
Sbjct  894  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPIHEVMHVFYVAMLCVEEQAVE  953

Query  369  RPKMREVVQMLTELPKQPPGTKP-EGTTACESSALEPPPSTG  247
            RP MREVVQ+LTELPK PPG+K  + TT  ESS   PPP  G
Sbjct  954  RPTMREVVQILTELPK-PPGSKQGDSTTITESS---PPPVGG  991



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   270 bits (689),  Expect = 9e-80, Method: Composition-based stats.
 Identities = 143/189 (76%), Positives = 152/189 (80%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  830   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  889

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  890   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  949

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---q  220
             RP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q
Sbjct  950   RPTMREVVQILTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQ  1006

Query  219   qppPDLLSI  193
              P PDLLSI
Sbjct  1007  SPQPDLLSI  1015



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   269 bits (688),  Expect = 1e-79, Method: Composition-based stats.
 Identities = 143/189 (76%), Positives = 152/189 (80%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  829   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  888

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  889   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHLFYVAMLCVEEQAVE  948

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKD---qq  220
             RP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KD    Q
Sbjct  949   RPTMREVVQILTELPKGPGSKLVEESAITESS---PPPATTASESQGTTSKDMKDQPPPQ  1005

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1006  SPPPDLLSI  1014



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   269 bits (688),  Expect = 1e-79, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 153/189 (81%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  830   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  889

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  890   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  949

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---q  220
             RP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q
Sbjct  950   RPTMREVVQILTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQ  1006

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1007  SPPPDLLSI  1015



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   269 bits (688),  Expect = 1e-79, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 153/189 (81%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  830   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  889

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  890   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  949

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---q  220
             RP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q
Sbjct  950   RPTMREVVQILTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQ  1006

Query  219   qppPDLLSI  193
              PPPDLLSI
Sbjct  1007  SPPPDLLSI  1015



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   269 bits (688),  Expect = 1e-79, Method: Composition-based stats.
 Identities = 143/189 (76%), Positives = 152/189 (80%), Gaps = 13/189 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  829   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  888

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  889   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLXSVPLHEVMHVFYVAMLCVEEQAVE  948

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTG-------TSDDAKDq---q  220
             RP MREVVQ+LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q
Sbjct  949   RPTMREVVQILTELPKGPGSKLVEESAITESS---PPPATXASESPGTTSKDTKDQPPPQ  1005

Query  219   qppPDLLSI  193
               PPDLLSI
Sbjct  1006  SLPPDLLSI  1014



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   268 bits (686),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 139/184 (76%), Positives = 153/184 (83%), Gaps = 7/184 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  831   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  890

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  891   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  950

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPD  205
             RP MREVVQ+LTELPK PP +K    T  ESS     ALE  PS+ + +D    Q PPPD
Sbjct  951   RPTMREVVQILTELPK-PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPD  1008

Query  204   LLSI  193
             LLSI
Sbjct  1009  LLSI  1012



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   268 bits (686),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 137/179 (77%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  832   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  891

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDG KEGV+K+LD RL TVP+HE MH+ YVA+LCVEEQAVE
Sbjct  892   KPVGEFGDGVDIVQWVRKMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVE  951

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             RP MREV+Q+LTELPK P   KP  +T  +SS   P   T T  + +  Q PPPDLLSI
Sbjct  952   RPTMREVIQILTELPK-PTAAKPGDSTITDSSVDSPATETKTH-NRQASQSPPPDLLSI  1008



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   268 bits (686),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 132/181 (73%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  896   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  955

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLS  196
             RP MREVVQ+LTELPK P    P     C  + L+PP +T T D  +         DLLS
Sbjct  956   RPTMREVVQILTELPKPPNSESPTSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDLLS  1013

Query  195   I  193
             I
Sbjct  1014  I  1014



>gb|KHN42601.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 153/184 (83%), Gaps = 7/184 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  543  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  602

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  603  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  662

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPD  205
            RP MREVVQ+LTELPK PP +K    T  ESS     ALE  PS+ + +D    Q PPPD
Sbjct  663  RPTMREVVQILTELPK-PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPD  720

Query  204  LLSI  193
            LLSI
Sbjct  721  LLSI  724



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   268 bits (684),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 140/187 (75%), Positives = 151/187 (81%), Gaps = 9/187 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  834   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  893

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDG+DIVQWVRKMT+GKKEGV+KILD RLSTVP+HE +H+ YVA+LCVEEQAVE
Sbjct  894   KPVGEFGDGIDIVQWVRKMTEGKKEGVLKILDPRLSTVPLHEVIHVFYVAMLCVEEQAVE  953

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS---TGTSDDAKD-----qqqp  214
             RPKMREVVQ+LTELP  P  TK   +T  ES     P S   T    + KD      Q P
Sbjct  954   RPKMREVVQILTELP-TPSNTKSGDSTITESLPSSAPASESPTSAPGNTKDNHQPPPQSP  1012

Query  213   pPDLLSI  193
              PDLLSI
Sbjct  1013  QPDLLSI  1019



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   267 bits (683),  Expect = 5e-79, Method: Composition-based stats.
 Identities = 139/183 (76%), Positives = 149/183 (81%), Gaps = 5/183 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  834   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  893

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDG KEGV+K+LD RL TVP+HE MH+ YVA+LCVEEQAVE
Sbjct  894   KPVGEFGDGVDIVQWVRKMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVE  953

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDL  202
             RP MREVVQ+L+ELPK P G KP      ES    S LE P +   S      Q PPPDL
Sbjct  954   RPTMREVVQILSELPK-PHGAKPGDPAPTESPPPASILESPATDPESHHPNPPQSPPPDL  1012

Query  201   LSI  193
             LSI
Sbjct  1013  LSI  1015



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   267 bits (683),  Expect = 6e-79, Method: Composition-based stats.
 Identities = 137/185 (74%), Positives = 150/185 (81%), Gaps = 7/185 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  830   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  889

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQA+E
Sbjct  890   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIE  949

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESS----ALEPPPSTGTSDDAKDqqqppP--  208
             RP MREVVQ+LTELPK PP +K    T  ESS    A    P+  T+ D KD Q P    
Sbjct  950   RPTMREVVQILTELPK-PPNSKQGDLTVTESSPQSAATLDSPNAATTRDQKDHQSPQSPP  1008

Query  207   DLLSI  193
             DLLSI
Sbjct  1009  DLLSI  1013



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   267 bits (682),  Expect = 7e-79, Method: Composition-based stats.
 Identities = 140/190 (74%), Positives = 155/190 (82%), Gaps = 14/190 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  835   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  894

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQA+E
Sbjct  895   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIE  954

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqpp--  211
             RP MREVVQ+LTELPK PP +K   +T  ESS     +L+ P +  TS D KD QQP   
Sbjct  955   RPTMREVVQILTELPK-PPNSKQGDSTVTESSPQSATSLDSPKA--TSKDPKDNQQPALP  1011

Query  210   ----PDLLSI  193
                 PDLLSI
Sbjct  1012  QSPPPDLLSI  1021



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   267 bits (682),  Expect = 9e-79, Method: Composition-based stats.
 Identities = 133/168 (79%), Positives = 144/168 (86%), Gaps = 9/168 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  839   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  898

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+KILDSRL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  899   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDSRLPSVPLHEVMHVFYVAMLCVEEQAVE  958

Query  369   RPKMREVVQMLTELPKQPPGTKP--EGTTACES------SALEPPPST  250
             RP MREVVQ+LTELP  PPG+K   E TT  +S      +A+E P +T
Sbjct  959   RPTMREVVQILTELPI-PPGSKQVGETTTVTDSPQQSAITAIESPTTT  1005



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   266 bits (681),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 132/168 (79%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  832  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  891

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  892  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  951

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD  226
            RP MREVVQ+LTELPK PP +K   +T  ES      PS GTS D+ +
Sbjct  952  RPTMREVVQILTELPK-PPNSKQGDSTVTESL-----PSPGTSLDSPN  993



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   266 bits (680),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 131/164 (80%), Positives = 141/164 (86%), Gaps = 5/164 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  833  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  892

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD+RL TVP+HE MH+ YVA+LCVEEQAVE
Sbjct  893  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVE  952

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESS----ALEPPPST  250
            RP MREVVQ+LTELPK PP +K   +   ESS     LE P +T
Sbjct  953  RPTMREVVQILTELPK-PPSSKQGDSIVTESSPPSCTLESPTTT  995



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   266 bits (679),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 137/182 (75%), Positives = 152/182 (84%), Gaps = 5/182 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  826   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  885

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQW RKMTD  KE V+K+LD RLS+VP+H+ MH+ YVA+LCVEEQAVE
Sbjct  886   KPVGEFGDGVDIVQWARKMTDSNKEEVLKVLDPRLSSVPLHDVMHVFYVAMLCVEEQAVE  945

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTA---CESSALEPPPSTGTSDDAKDqqqppPDLL  199
             RP MREVVQ+LTELP+ PPG+K E  T      S+ALE  PST + D     Q PPPDLL
Sbjct  946   RPTMREVVQILTELPR-PPGSKQEDLTESSLSSSNALE-SPSTASKDRQNPSQSPPPDLL  1003

Query  198   SI  193
             SI
Sbjct  1004  SI  1005



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   266 bits (680),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 134/174 (77%), Positives = 144/174 (83%), Gaps = 11/174 (6%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  832  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  891

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTDG KEGV+KILD RL TVP+HE MH+ YVA+LCVEEQAVE
Sbjct  892  KPVGEFGDGVDIVQWVRKMTDGNKEGVLKILDPRLPTVPLHEVMHVFYVAMLCVEEQAVE  951

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS------TGTSDDAKD  226
            RP MREVVQ+LTELPK P   K   +T  ES    PPP+      + T  D+KD
Sbjct  952  RPTMREVVQILTELPK-PANGKQGDSTDTES----PPPASTVESPSTTPVDSKD  1000



>gb|KJB43996.1| hypothetical protein B456_007G228700 [Gossypium raimondii]
Length=866

 Score =   264 bits (674),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 136/185 (74%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  682  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  741

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRK T+  KEGV+KILD RLS+VP++E MH+ YVA+LCVEEQAVE
Sbjct  742  KPVGEFGDGVDIVQWVRKTTNSNKEGVLKILDPRLSSVPLYEVMHVFYVAMLCVEEQAVE  801

Query  369  RPKMREVVQMLTELPKQPPGTKPEG-TTACESSALEPP-----PSTGTSDDAKDqqqppP  208
            RP MREVVQ+LTE+PK P   + +G +T  ESS +  P     P    + + KDQ  PPP
Sbjct  802  RPTMREVVQILTEVPKPPSSKQQQGDSTITESSPISQPTTLESPRDARTKEPKDQHTPPP  861

Query  207  DLLSI  193
            DLLSI
Sbjct  862  DLLSI  866



>dbj|BAF01968.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=243

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  72   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  131

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  132  KPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  191

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
            RP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  192  RPTMREVVQILTEIPKIPLSKQ----QAAESDVTEKAPAINES  230



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   265 bits (676),  Expect = 4e-78, Method: Composition-based stats.
 Identities = 128/164 (78%), Positives = 138/164 (84%), Gaps = 2/164 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  829  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  888

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  889  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  948

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQ+LTELPK P   +  G +A   S   PP  T  S+
Sbjct  949  RPTMREVVQILTELPKAPGSKQGGGDSAITESF--PPSGTSASE  990



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   265 bits (676),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 134/179 (75%), Positives = 148/179 (83%), Gaps = 4/179 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  835   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGR  894

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTDG KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  895   KPVGEFGDGVDIVQWVRKMTDGNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  954

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             RP MREVVQ+L E+PK PPGT P+   A   S LE P     +      + PPPDLLSI
Sbjct  955   RPTMREVVQILLEIPK-PPGTTPKQGDA---SPLESPQRPTDAIVGSPTKSPPPDLLSI  1009



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   264 bits (675),  Expect = 6e-78, Method: Composition-based stats.
 Identities = 132/181 (73%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  896   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  955

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLS  196
             RP MREVVQ+LTELPK PP ++   T+    + L+PP +T T D  +         DLLS
Sbjct  956   RPTMREVVQILTELPK-PPNSEST-TSPAPCTTLDPPTTTITKDQQQPPAPKSTPPDLLS  1013

Query  195   I  193
             I
Sbjct  1014  I  1014



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   264 bits (675),  Expect = 7e-78, Method: Composition-based stats.
 Identities = 131/179 (73%), Positives = 144/179 (80%), Gaps = 4/179 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  831   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVAGR  890

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  891   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  950

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             RP MREVVQMLTELPK P     E  T      +   PS  +S+  +   + P DLLSI
Sbjct  951   RPTMREVVQMLTELPKPPTSKHVEDLTL----TITESPSLASSNSLESPSKEPKDLLSI  1005



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   264 bits (675),  Expect = 8e-78, Method: Composition-based stats.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 8/158 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD KKEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  887  KPVGEFGDGVDIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  946

Query  369  RPKMREVVQMLTELPKQPPGTK-------PEGTTACES  277
            RP MREVVQ+LTELPK PP +K       P GTT+ +S
Sbjct  947  RPTMREVVQILTELPK-PPTSKQGEESLPPSGTTSLDS  983



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   264 bits (674),  Expect = 8e-78, Method: Composition-based stats.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 8/158 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD KKEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  887  KPVGEFGDGVDIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  946

Query  369  RPKMREVVQMLTELPKQPPGTK-------PEGTTACES  277
            RP MREVVQ+LTELPK PP +K       P GTT+ +S
Sbjct  947  RPTMREVVQILTELPK-PPTSKQGEESLPPSGTTSLDS  983



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   264 bits (674),  Expect = 8e-78, Method: Composition-based stats.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 8/158 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  829  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  888

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD KKEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  889  KPVGEFGDGVDIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  948

Query  369  RPKMREVVQMLTELPKQPPGTK-------PEGTTACES  277
            RP MREVVQ+LTELPK PP +K       P GTT+ +S
Sbjct  949  RPTMREVVQILTELPK-PPTSKQGEESLPPSGTTSLDS  985



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   263 bits (673),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 128/164 (78%), Positives = 138/164 (84%), Gaps = 2/164 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  780  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  839

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  840  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  899

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQ+LTELPK P   +  G +A   S   PP  T  S+
Sbjct  900  RPTMREVVQILTELPKAPGSKQGGGDSAITESF--PPSGTSASE  941



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   263 bits (672),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 133/181 (73%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  830   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  889

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RLS+VP+HE  H+ YVA+LCVEEQAVE
Sbjct  890   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLSSVPLHEVTHVFYVAILCVEEQAVE  949

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS--TGTSDDAKDqqqppPDLLS  196
             RP MREVVQ+LTELP  PP +K   +T  ESS      S    + D+      PPPDLLS
Sbjct  950   RPTMREVVQILTELP-MPPESKQGDSTITESSLSNASESLTAASKDNQHPPPSPPPDLLS  1008

Query  195   I  193
             I
Sbjct  1009  I  1009



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   263 bits (672),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 127/163 (78%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
            RP MREVVQ+LTELPK PP +K   +T    + +E  PS   +
Sbjct  956  RPTMREVVQILTELPK-PPNSKQGDSTI---TTMESSPSLAAA  994



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   262 bits (670),  Expect = 3e-77, Method: Composition-based stats.
 Identities = 136/186 (73%), Positives = 150/186 (81%), Gaps = 8/186 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  896   KPVGEFGDGVDIVQWVRKMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  955

Query  369   RPKMREVVQMLTELPKQPPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqqqpp  211
             RP MREVVQ+LTELPK P         T+P   +A  ++AL+ P ST        QQ PP
Sbjct  956   RPTMREVVQILTELPKSPSSKQGDSIITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPP  1014

Query  210   PDLLSI  193
              DLLSI
Sbjct  1015  ADLLSI  1020



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   262 bits (669),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 137/184 (74%), Positives = 147/184 (80%), Gaps = 8/184 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  833   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  892

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMT+ KKEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  893   KPVGEFGDGVDIVQWVRKMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  952

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKDqqqppPD  205
             RP MREVVQ+LTELPK    +K    T  ES     S LE P +  T D       P PD
Sbjct  953   RPTMREVVQILTELPK-ASDSKQRDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPTPD  1009

Query  204   LLSI  193
             LLSI
Sbjct  1010  LLSI  1013



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   262 bits (669),  Expect = 5e-77, Method: Composition-based stats.
 Identities = 136/186 (73%), Positives = 150/186 (81%), Gaps = 8/186 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  896   KPVGEFGDGVDIVQWVRKMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  955

Query  369   RPKMREVVQMLTELPKQPPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqqqpp  211
             RP MREVVQ+LTELPK P         T+P   +A  ++AL+ P ST        QQ PP
Sbjct  956   RPTMREVVQILTELPKSPSSKQGDSVITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPP  1014

Query  210   PDLLSI  193
              DLLSI
Sbjct  1015  ADLLSI  1020



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   262 bits (669),  Expect = 5e-77, Method: Composition-based stats.
 Identities = 128/162 (79%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD   +GV+KILD RL TVP++E MH+ YVALLCVEEQAVE
Sbjct  888  KPVGEFGDGVDIVQWVRKMTDSNVDGVLKILDPRLPTVPLNEVMHVFYVALLCVEEQAVE  947

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGT  244
            RP MREVVQ+LTELPK PP +KP  +   ESS   P P+T T
Sbjct  948  RPTMREVVQILTELPK-PPSSKPADSAIPESS---PSPATTT  985



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   261 bits (668),  Expect = 5e-77, Method: Composition-based stats.
 Identities = 135/183 (74%), Positives = 146/183 (80%), Gaps = 6/183 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  833   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  892

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMT+ KKEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  893   KPVGEFGDGVDIVQWVRKMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  952

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDL  202
             RP MREVVQ+LTELPK     + + T    S    S LE P +  T D       P PDL
Sbjct  953   RPTMREVVQILTELPKASDSKQGDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPTPDL  1010

Query  201   LSI  193
             LSI
Sbjct  1011  LSI  1013



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   261 bits (668),  Expect = 6e-77, Method: Composition-based stats.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  833  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  892

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+KILD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  893  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  952

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
            RP MREVVQ+LTELPK P     +G++A   S+     + G +
Sbjct  953  RPTMREVVQILTELPKAP--ISKQGSSAMTESSPSAAATAGET  993



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   261 bits (666),  Expect = 1e-76, Method: Composition-based stats.
 Identities = 137/183 (75%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  827   HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  886

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LDSRL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  887   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVE  946

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDq----qqppPDL  202
             RP MREVVQ+LTELPK PP +K   T +  SS+      T  S + KD     Q PPPDL
Sbjct  947   RPTMREVVQILTELPK-PPSSKHAITESSLSSSNSLGSPTTASKEPKDNQHPPQSPPPDL  1005

Query  201   LSI  193
             LSI
Sbjct  1006  LSI  1008



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   260 bits (665),  Expect = 1e-76, Method: Composition-based stats.
 Identities = 122/156 (78%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  262
            RP MREVVQ+LTE+PK PP      T +   S L P
Sbjct  956  RPTMREVVQILTEIPKLPPSKDQTTTESTPESELSP  991



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   260 bits (664),  Expect = 2e-76, Method: Composition-based stats.
 Identities = 138/188 (73%), Positives = 154/188 (82%), Gaps = 10/188 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  791  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  850

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE VVKILD RLS+VP+HE MH+ YVA+LCVEEQAVE
Sbjct  851  KPVGEFGDGVDIVQWVRKMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVE  910

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-Dqqq  217
            RP MREV+Q+L+E+P QPP +K  G +           ++A    P+TGT +  +  QQQ
Sbjct  911  RPTMREVIQILSEIP-QPPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQ  969

Query  216  ppPDLLSI  193
            PPPDLLSI
Sbjct  970  PPPDLLSI  977



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   260 bits (665),  Expect = 2e-76, Method: Composition-based stats.
 Identities = 137/184 (74%), Positives = 150/184 (82%), Gaps = 7/184 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  833   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  892

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RLS+VP+ E MH+ YVA+LCVEEQAVE
Sbjct  893   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVE  952

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPD  205
             RP MREVVQ+LTELPK    +K   +T  ESS     ALE  P+  + D     Q PPPD
Sbjct  953   RPTMREVVQILTELPKSTE-SKLGDSTITESSLSSSNALE-SPTAASKDHQHPPQSPPPD  1010

Query  204   LLSI  193
             LLSI
Sbjct  1011  LLSI  1014



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   260 bits (664),  Expect = 2e-76, Method: Composition-based stats.
 Identities = 138/188 (73%), Positives = 154/188 (82%), Gaps = 10/188 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  833   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  892

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KE VVKILD RLS+VP+HE MH+ YVA+LCVEEQAVE
Sbjct  893   KPVGEFGDGVDIVQWVRKMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVE  952

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-Dqqq  217
             RP MREV+Q+L+E+P QPP +K  G +           ++A    P+TGT +  +  QQQ
Sbjct  953   RPTMREVIQILSEIP-QPPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQ  1011

Query  216   ppPDLLSI  193
             PPPDLLSI
Sbjct  1012  PPPDLLSI  1019



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   259 bits (662),  Expect = 4e-76, Method: Composition-based stats.
 Identities = 135/186 (73%), Positives = 148/186 (80%), Gaps = 8/186 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  834   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  893

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  894   KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  953

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTS--DDAKDqqqpp  211
             RP MREVVQ+LTELPK    +K    T  ESS     +LE P +      D+    Q  P
Sbjct  954   RPTMREVVQILTELPKS-ASSKQGDLTITESSLPSSNSLESPTTASMEPKDNQHLPQSSP  1012

Query  210   PDLLSI  193
             PDLLSI
Sbjct  1013  PDLLSI  1018



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   259 bits (661),  Expect = 5e-76, Method: Composition-based stats.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 5/179 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  846   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  905

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD KKEGVV +LD RL +VP+HEAMH+ YVA+LCVEEQ++E
Sbjct  906   KPVGEFGDGVDIVQWVRKMTDSKKEGVVIVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIE  965

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             RP MREVVQ+LTELP+ PP  + EG    E S   PPP+ G +   + + QP PDLLSI
Sbjct  966   RPTMREVVQILTELPRPPP-NQGEG----EDSPPPPPPAGGETPMKESKPQPQPDLLSI  1019



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   259 bits (661),  Expect = 5e-76, Method: Composition-based stats.
 Identities = 121/156 (78%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  262
            RP MREVVQ+LTE+PK PP      T +   + L P
Sbjct  956  RPTMREVVQILTEIPKLPPSKDQPTTESTPENELSP  991



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   259 bits (661),  Expect = 6e-76, Method: Composition-based stats.
 Identities = 123/164 (75%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD R+S++PIHE  H+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRMSSIPIHEVTHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQ+LTE+PK PP +K + TT         P + G  D
Sbjct  956  RPTMREVVQILTEIPKMPP-SKEQSTTELTGVEKSTPENEGPPD  998



>gb|KHN47566.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=725

 Score =   254 bits (650),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  544  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  603

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LDSRL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  604  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVE  663

Query  369  RPKMREVVQMLTELPKQPPGTK  304
            RP MREVVQ+LTELPK PP +K
Sbjct  664  RPTMREVVQILTELPK-PPSSK  684



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   258 bits (660),  Expect = 8e-76, Method: Composition-based stats.
 Identities = 135/186 (73%), Positives = 150/186 (81%), Gaps = 7/186 (4%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  832   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  891

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD KKEGV+ ILD RL TVP+HEAMH+ YVA+LCVEEQ+VE
Sbjct  892   KPVGEFGDGVDIVQWVRKMTDSKKEGVLNILDPRLPTVPLHEAMHVFYVAMLCVEEQSVE  951

Query  369   RPKMREVVQMLTELPKQP----PGTKPEGTTACESSALEPP-PSTGTSDDAKD--qqqpp  211
             RP MREVVQ+LT+LPK P    P T+  G      ++ EP  P+ G  +       Q PP
Sbjct  952   RPTMREVVQILTDLPKPPEQPSPTTQKHGGIGGGDASPEPNGPNVGVKEQQGQLPPQSPP  1011

Query  210   PDLLSI  193
             PDLLSI
Sbjct  1012  PDLLSI  1017



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   258 bits (659),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 122/165 (74%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  835  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  894

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  895  KPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  954

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDD  235
            RP MREVVQ+LTE+PK PP      T +   S L P     +  D
Sbjct  955  RPTMREVVQILTEIPKLPPSKDQPMTESAPESELSPKSGVQSPPD  999



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   258 bits (658),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 127/169 (75%), Positives = 137/169 (81%), Gaps = 5/169 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  835   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  894

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  895   KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  954

Query  369   RPKMREVVQMLTELPKQPPGTKPEGT--TACESSALE---PPPSTGTSD  238
             RP MREVVQ+LTE+PK PP      T  T  E S  E    P S G  D
Sbjct  955   RPTMREVVQILTEIPKMPPLKDQPATELTGVEKSTAENELSPKSGGPPD  1003



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   258 bits (658),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 121/156 (78%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  835  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  894

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  895  KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  954

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  262
            RP MREVVQ+LTE+PK PP      T +   + L P
Sbjct  955  RPTMREVVQILTEIPKLPPPKDQPTTESTPENELSP  990



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   257 bits (657),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 131/182 (72%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  809  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  868

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW+RKMTD  KE V  ILD RLSTVP+H+ MH+ YVA+LCVEEQ+VE
Sbjct  869  KPVGEFGDGVDIVQWMRKMTDSNKEAVTNILDPRLSTVPLHDVMHVFYVAMLCVEEQSVE  928

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP---DLL  199
            RP MREVVQ+L+ELP+  P    + +   ES A  P PS  T    + Q  P     DLL
Sbjct  929  RPTMREVVQILSELPRPTPKPGEDSSNDEESEAPAPVPSAETPSKEQQQPAPRSPPPDLL  988

Query  198  SI  193
            SI
Sbjct  989  SI  990



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   257 bits (656),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  827  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  887  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  946

Query  369  RPKMREVVQMLTELPKQPPGTK  304
            RP MREVVQ+LTELPK PP +K
Sbjct  947  RPTMREVVQILTELPK-PPSSK  967



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   257 bits (656),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  262
            RP MREVVQ+LTE+PK PP      T +   + + P
Sbjct  956  RPTMREVVQILTEIPKLPPSKDQPTTESTPENEVSP  991



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   256 bits (655),  Expect = 4e-75, Method: Composition-based stats.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  830  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVAGR  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP++E MH+ YVA+LCVEEQAVE
Sbjct  890  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLNEVMHVFYVAMLCVEEQAVE  949

Query  369  RPKMREVVQMLTELPKQPPGTK  304
            RP MREVVQMLTELPK PP +K
Sbjct  950  RPTMREVVQMLTELPK-PPSSK  970



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   257 bits (656),  Expect = 4e-75, Method: Composition-based stats.
 Identities = 130/170 (76%), Positives = 141/170 (83%), Gaps = 8/170 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  833  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  892

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RLS+VP+ E MH+ YVA+LCVEEQAVE
Sbjct  893  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVE  952

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDD  235
            RP MREVVQ+LTELPK    +K   +T  ESS     ALE P  T  S D
Sbjct  953  RPTMREVVQILTELPKSTE-SKLGDSTITESSLSSSNALESP--TAASKD  999



>gb|KHN01704.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=854

 Score =   254 bits (650),  Expect = 5e-75, Method: Composition-based stats.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  671  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  730

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KEGV+K+LD RL +VP+HE MH+ YVA+LCVEEQAVE
Sbjct  731  KPVGEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVE  790

Query  369  RPKMREVVQMLTELPKQPPGTK  304
            RP MREVVQ+LTELPK PP +K
Sbjct  791  RPTMREVVQILTELPK-PPSSK  811



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   256 bits (654),  Expect = 6e-75, Method: Composition-based stats.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  844  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  903

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD KKEGV+ +LD RL +VP+HEAMH+ YVA+LCVEEQ++E
Sbjct  904  KPVGEFGDGVDIVQWVRKMTDSKKEGVLSVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIE  963

Query  369  RPKMREVVQMLTELPKQP  316
            RP MREVVQ+LTELP+ P
Sbjct  964  RPTMREVVQILTELPRPP  981



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   256 bits (654),  Expect = 6e-75, Method: Composition-based stats.
 Identities = 120/156 (77%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  262
            RP MREVVQ+LTE+PK  P      T +   + L P
Sbjct  956  RPTMREVVQILTEIPKSLPSKDQPTTESTPENELSP  991



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   256 bits (654),  Expect = 6e-75, Method: Composition-based stats.
 Identities = 136/192 (71%), Positives = 148/192 (77%), Gaps = 14/192 (7%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+
Sbjct  836   HVADFGLAKFLQDSGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KE V+K+LD RL +VP+ E MH+ YVA+LCVEEQAVE
Sbjct  896   KPVGEFGDGVDIVQWVRKMTDSSKESVLKVLDPRLPSVPLQEVMHVFYVAMLCVEEQAVE  955

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP------PSTGTSDDAKDqq----  220
             RP MREVVQ+LTELPK PP +K   TT  E      P      P+T  + D KDQQ    
Sbjct  956   RPTMREVVQILTELPK-PPNSKEGDTTINEPPTSPSPDTTLDSPTTTITKDPKDQQQQPP  1014

Query  219   ---qppPDLLSI  193
                  PPDLLSI
Sbjct  1015  APKSTPPDLLSI  1026



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   255 bits (652),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  806  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  865

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  866  KPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  925

Query  369  RPKMREVVQMLTELPKQPPGTKPEGT  292
            RP MREVVQ+LTE+PK PP      T
Sbjct  926  RPTMREVVQILTEVPKMPPSKDQPAT  951



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   255 bits (652),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 121/158 (77%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  843  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  902

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMT+G K+G VK+LD RL  VP+HE  H+ YVA+LCVEEQAVE
Sbjct  903  KPVGEFGDGVDIVQWVRKMTEGNKQGAVKVLDPRLERVPLHEVTHVFYVAMLCVEEQAVE  962

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPP  256
            RP MREVVQMLTELP         G    E     PPP
Sbjct  963  RPTMREVVQMLTELPGDSGSEVKLGHQEQEMPISSPPP  1000



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   254 bits (650),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  804  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  863

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  864  KPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  923

Query  369  RPKMREVVQMLTELPKQPPGTKPEGT  292
            RP MREVVQ+LTE+PK PP      T
Sbjct  924  RPTMREVVQILTEVPKMPPSKDQPAT  949



>ref|XP_008785758.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Phoenix dactylifera]
Length=782

 Score =   253 bits (645),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  607  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  666

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR++TD  KEGV+KILD RLS+VP+HEAMH+ YVA+LCVEEQ+VE
Sbjct  667  KPVGEFGDGVDIVQWVREVTDSSKEGVLKILDPRLSSVPLHEAMHVFYVAMLCVEEQSVE  726

Query  369  RPKMREVVQMLTELPKQPP  313
            RP  REVVQ+LTELP  PP
Sbjct  727  RPTTREVVQILTELPGPPP  745



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   254 bits (650),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  830  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  K+ V+K+LD RLS++PIHE  H+ YVA+LCVEEQAVE
Sbjct  890  KPVGEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVE  949

Query  369  RPKMREVVQMLTELPKQPPGTKPEGT  292
            RP MREVVQ+LTE+PK PP      T
Sbjct  950  RPTMREVVQILTEVPKMPPSKDQAAT  975



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   253 bits (647),  Expect = 5e-74, Method: Composition-based stats.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  845  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  904

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRK+TD  KEG++KI+D RLS+VP+HEAMH+ YVA+LCVEEQ+VE
Sbjct  905  KPVGEFGDGVDIVQWVRKVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVE  964

Query  369  RPKMREVVQMLTELPKQP  316
            RP MREVVQ+LTELP  P
Sbjct  965  RPTMREVVQILTELPGTP  982



>ref|XP_010023395.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Eucalyptus grandis]
Length=875

 Score =   252 bits (643),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 125/172 (73%), Positives = 139/172 (81%), Gaps = 5/172 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  687  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  746

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW+RKMT+  KE V KILD RL  VP+HEAMH+ YVA+LCVEEQAVE
Sbjct  747  KPVGEFGDGVDIVQWMRKMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVE  806

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKD  226
            RP MREVVQ+LTE P+ PPG+    +    + +L P      S  T+ D K+
Sbjct  807  RPTMREVVQILTERPR-PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  857



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   253 bits (645),  Expect = 9e-74, Method: Composition-based stats.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSG S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GK
Sbjct  838   HVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGK  897

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWV+ MTD  KE V+KI+D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  898   KPVGEFGDGVDIVQWVKTMTDSNKEQVIKIMDPRLSTVPVHEVMHIFYVALLCVEEQSVQ  957

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGT----SDDAKD  226
             RP MREVVQML+ELPK       E  +  + +A  PP S  +    +D+AK+
Sbjct  958   RPTMREVVQMLSELPKPTSRQGDELPSGDDGAAPNPPVSADSVEALNDEAKE  1009



>gb|KCW59634.1| hypothetical protein EUGRSUZ_H023832 [Eucalyptus grandis]
Length=871

 Score =   251 bits (641),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 125/172 (73%), Positives = 139/172 (81%), Gaps = 5/172 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+
Sbjct  683  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGR  742

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW+RKMT+  KE V KILD RL  VP+HEAMH+ YVA+LCVEEQAVE
Sbjct  743  KPVGEFGDGVDIVQWMRKMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVE  802

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKD  226
            RP MREVVQ+LTE P+ PPG+    +    + +L P      S  T+ D K+
Sbjct  803  RPTMREVVQILTERPR-PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  853



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   252 bits (643),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 124/174 (71%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  829   HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  888

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIV WVR MTD  KE V+K+LD RLSTVP+HE MH+ YVALLC+EEQ+V+
Sbjct  889   KPVGEFGDGVDIVHWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHIFYVALLCIEEQSVQ  948

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  226
             RP MREVVQ+L+ELPK  P      + A + SA  PP   PS      + DAKD
Sbjct  949   RPTMREVVQILSELPKLAPRQGEVLSHAVDGSASNPPAPVPSGSAKAPTGDAKD  1002



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   251 bits (642),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  831  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  890

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  891  KPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  950

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
            RP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  951  RPTMREVVQILTEIPKIPLSKQ----QAAESDVTEKAPAINES  989



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   251 bits (642),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 121/168 (72%), Positives = 136/168 (81%), Gaps = 3/168 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  826  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  885

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  886  KPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  945

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSAL---EPPPSTGTSDD  235
            RP MREVVQ+LTE+PK P   + E  +     A    E  P +G+  D
Sbjct  946  RPTMREVVQILTEIPKLPLSKQQETESDVTEKAPRMNESSPDSGSPPD  993



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   251 bits (642),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 126/173 (73%), Positives = 142/173 (82%), Gaps = 9/173 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  896   KPVGEFGDGVDIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  955

Query  369   RPKMREVVQMLTELPKQPPGTK-----PEGTTACESSALEPPPSTGTSDDAKD  226
             RP MREVVQ+L+ELPK  P +K     P G  A   S L  P  +  +++AK+
Sbjct  956   RPTMREVVQILSELPK--PTSKQGEEPPSGEGAV--SDLVVPAESAEANEAKE  1004



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   251 bits (641),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 134/187 (72%), Positives = 149/187 (80%), Gaps = 8/187 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK
Sbjct  809  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  868

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW+RKMTD  K+ V  ILD RLS+VP+H+ MH+ YVA+LCVEEQ+VE
Sbjct  869  KPVGEFGDGVDIVQWMRKMTDSNKQAVTNILDPRLSSVPLHDVMHVFYVAMLCVEEQSVE  928

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESS-ALEPPPSTGT-SDDAKDqqqppP----  208
            RP MREVVQ+L+ELP+  P    E ++  E S A  P PS  T S + K+QQQ P     
Sbjct  929  RPTMREVVQILSELPRPTPKPGEEDSSNNEESGAPAPVPSAETPSKETKEQQQQPARQSP  988

Query  207  --DLLSI  193
              DLLSI
Sbjct  989  PPDLLSI  995



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   251 bits (640),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 120/164 (73%), Positives = 133/164 (81%), Gaps = 4/164 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  806  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  865

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+K++D RLS+VP+HE  H+ YVA+LCVEEQAV 
Sbjct  866  KPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVA  925

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQ+LTE+PK P   +     A ES   E  P+    D
Sbjct  926  RPTMREVVQILTEVPKIPLSEQ----LAVESDVTEKSPAVDEED  965



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   251 bits (640),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL+SG+
Sbjct  836  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELISGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMTD  +E V +ILD RLSTVP+HE +H+ +VA+LCVEEQ+VE
Sbjct  896  KPVGEFGDGVDIVQWVRKMTDSNREAVTEILDPRLSTVPLHEVLHVFHVAMLCVEEQSVE  955

Query  369  RPKMREVVQMLTELPKQPPG  310
            RP MREVVQ+L E PK  PG
Sbjct  956  RPTMREVVQILAEFPKPKPG  975



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   251 bits (640),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 120/159 (75%), Positives = 131/159 (82%), Gaps = 4/159 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  805  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  864

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+K++D RLS+VP+HE  H+ YVALLCVEEQAV 
Sbjct  865  KPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVALLCVEEQAVA  924

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  253
            RP MREVVQ+LTELPK P   +     A ES   E  P+
Sbjct  925  RPTMREVVQILTELPKIPLSKQ----LAVESDVTEKSPA  959



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   251 bits (640),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  896   KPVGEFGDGVDIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  955

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALE--PPPSTGTSDDAKD  226
             RP MREVVQ+L+ELPK P   + E   + E +  +   P  +  +++AK+
Sbjct  956   RPTMREVVQILSELPK-PTSKQGEEPPSGEGAVFDLVVPAESAEANEAKE  1004



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   251 bits (640),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 120/164 (73%), Positives = 133/164 (81%), Gaps = 4/164 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  830  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+K++D RLS+VP+HE  H+ YVA+LCVEEQAV 
Sbjct  890  KPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVA  949

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQ+LTE+PK P   +     A ES   E  P+    D
Sbjct  950  RPMMREVVQILTEVPKIPLSEQ----LAVESDVTEKSPAVDEED  989



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   251 bits (640),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 120/159 (75%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVL+EL++G+
Sbjct  827  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLMELITGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+K++D RLS+VPIHE  H+ YVALLCVEEQAVE
Sbjct  887  KPVGEFGDGVDIVQWVRSMTDSNKECVLKVIDLRLSSVPIHEVTHVFYVALLCVEEQAVE  946

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPS  253
            RP MREVVQ+LTE+PK      P    A ES+  E  P+
Sbjct  947  RPTMREVVQILTEIPK----ILPTKQHAAESNVTEISPA  981



>ref|NP_001051418.1| Os03g0773700 [Oryza sativa Japonica Group]
 dbj|BAF13332.1| Os03g0773700, partial [Oryza sativa Japonica Group]
Length=885

 Score =   249 bits (637),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 124/174 (71%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  693  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  752

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+ YVALLC+EEQ+V+
Sbjct  753  KPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQ  812

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  226
            RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  813  RPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  866



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   250 bits (639),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 119/155 (77%), Positives = 132/155 (85%), Gaps = 7/155 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GK
Sbjct  838  HVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGK  897

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWV+ MTD  KE V+KI+D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  898  KPVGEFGDGVDIVQWVKTMTDANKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  957

Query  369  RPKMREVVQMLTELPK-------QPPGTKPEGTTA  286
            RP MREVVQML+ELPK       +PP    +G+ A
Sbjct  958  RPTMREVVQMLSELPKPAARQGDEPPSVDDDGSAA  992



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   250 bits (639),  Expect = 6e-73, Method: Composition-based stats.
 Identities = 124/174 (71%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  837   HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  896

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+ YVALLC+EEQ+V+
Sbjct  897   KPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQ  956

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  226
             RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  957   RPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   250 bits (639),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 124/174 (71%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  837   HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  896

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+ YVALLC+EEQ+V+
Sbjct  897   KPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQ  956

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  226
             RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  957   RPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   250 bits (638),  Expect = 8e-73, Method: Composition-based stats.
 Identities = 123/164 (75%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  834  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  893

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMT   KE V KILD RL T PIHE MH+ YVA+LCVEEQ+V 
Sbjct  894  KPVGEFGDGVDIVQWVRKMTGSDKENVAKILDPRLPTAPIHEVMHVFYVAMLCVEEQSVG  953

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQMLTELP  P   + E +++   +A  PPP   + D
Sbjct  954  RPTMREVVQMLTELPI-PSLKQGEDSSSGNVTAQPPPPIVASVD  996



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   250 bits (638),  Expect = 9e-73, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  831  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  890

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIV W++  TD KKE V+KI+D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  891  KPVGEFGDGVDIVHWIKMTTDSKKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  950

Query  369  RPKMREVVQMLTELPK---QPPGTKPEGTTACESSALEPPPST  250
            RP MREVVQ+L+ELPK   +  G +  G++  +   L  PP T
Sbjct  951  RPTMREVVQILSELPKPIAKQGGEQLTGSSDGDEPGLSGPPET  993



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   249 bits (637),  Expect = 9e-73, Method: Composition-based stats.
 Identities = 124/174 (71%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  787  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  846

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+K+LD RLSTVP+HE MH+ YVALLC+EEQ+V+
Sbjct  847  KPVGEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQ  906

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  226
            RP MREVVQ+L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  907  RPTMREVVQILSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  960



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   249 bits (637),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  830  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  890  KPVGEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  949

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
            RP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  950  RPTMREVVQILTEIPKIPLLKQ----QAAESDVSEKAPAMNES  988



>ref|XP_006657429.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=864

 Score =   248 bits (633),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 9/173 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  672  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  731

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+ YVALLCVEEQ+++
Sbjct  732  KPVGEFGDGVDIVQWVKTMTDSNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSMQ  791

Query  369  RPKMREVVQMLTELPKQPPGTK-----PEGTTACESSALEPPPSTGTSDDAKD  226
            RP MREVVQ+L+ELPK  P +K     P G  A     L  P  +  +++AK+
Sbjct  792  RPTMREVVQILSELPK--PASKQGEEPPSGEGAVPD--LVVPAESAEANEAKE  840



>gb|AAO26313.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=481

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSEC+SAIAGSYGYIAPEYA TLKVDEKSDVYSFGVVLLELV+G+
Sbjct  307  HVADFGLAKFLQDSGTSECISAIAGSYGYIAPEYA-TLKVDEKSDVYSFGVVLLELVTGR  365

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRK+TD  KEG++KI+D RLS+VP+HEAMH+ YVA+LCVEEQ+VE
Sbjct  366  KPVGEFGDGVDIVQWVRKVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVE  425

Query  369  RPKMREVVQMLTELPKQP  316
            RP MREVVQ+LTELP  P
Sbjct  426  RPTMREVVQILTELPGTP  443



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   249 bits (636),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  837   HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  896

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQW + MTD  KE V+KILD RLSTVP+HE MH+ YVALLC EEQ+V+
Sbjct  897   KPVGEFGDGVDIVQWAKMMTDSSKEQVMKILDPRLSTVPLHEIMHVFYVALLCTEEQSVQ  956

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP-PPSTGTSDDA  232
             RP MREVVQ+L+ELPK       E   AC+ SA  P  P+   S++A
Sbjct  957   RPTMREVVQILSELPKPSTKQGEEVPNACDGSASGPLHPAPAGSNEA  1003



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   248 bits (634),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 121/168 (72%), Positives = 135/168 (80%), Gaps = 3/168 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL+SG+
Sbjct  836   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELISGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVRKMTD  KE V +ILD RLSTVP+ E +H+ +VA+LCVEEQ+VE
Sbjct  896   KPVGEFGDGVDIVQWVRKMTDSNKEAVSEILDPRLSTVPLQEVIHVFHVAMLCVEEQSVE  955

Query  369   RPKMREVVQMLTELPKQPPG---TKPEGTTACESSALEPPPSTGTSDD  235
             RP MREVVQ+L E PK  PG   +  EG+       +E   S  T +D
Sbjct  956   RPTMREVVQILAEFPKPKPGEDSSANEGSVPPPPVPVEETSSKETKED  1003



>gb|EMS57320.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=788

 Score =   246 bits (628),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 122/173 (71%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  596  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  655

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIV W++ MTD K+E V+KI+D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  656  KPVGEFGDGVDIVHWIKMMTDSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  715

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTAC----ESSALEPPPSTG-TSDDAKD  226
            RP MREVVQ+L+ELPK       E  T      ES  + PP +    +D+AK+
Sbjct  716  RPTMREVVQILSELPKPTTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  768



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   248 bits (633),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  843   HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  902

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVR MTD  K+ V+K++D RLS+VPIHE  H+ YVA+LCVEE+AVE
Sbjct  903   KPVGEFGDGVDIVQWVRGMTDSNKDCVLKVIDLRLSSVPIHEVTHVFYVAMLCVEERAVE  962

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
             RP MREVVQ+LTE+PK P   +     A ES   E  P+   S
Sbjct  963   RPTMREVVQILTEIPKIPISKQ---KAAAESDVTEKSPAMNES  1002



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   248 bits (632),  Expect = 6e-72, Method: Composition-based stats.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRK+T   KE V KILD RL T+P+HEAMH+ YVA+LCVEEQ+VE
Sbjct  896  KPVGEFGDGVDIVQWVRKVTGSNKEEVTKILDPRLPTLPVHEAMHVFYVAMLCVEEQSVE  955

Query  369  RPKMREVVQMLTELPKQP  316
            RP MREVVQ+LTELPK P
Sbjct  956  RPTMREVVQILTELPKPP  973



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score =   247 bits (630),  Expect = 9e-72, Method: Composition-based stats.
 Identities = 118/156 (76%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  831  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  890

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW++ MTD  KE V+KI+D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  891  KPVGEFGDGVDIVQWIKMMTDSSKERVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  950

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEP  262
            RP MREVVQ+L+E PK  P    E   + E   L+P
Sbjct  951  RPTMREVVQILSEPPKLIPKQGEELPGSGEGDELDP  986



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   246 bits (629),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 118/166 (71%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  829  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  888

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG GVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  889  KPVGEFGAGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  948

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDA  232
            RP MREVVQ+L E+PK P   + E  +     A   PP   +S D+
Sbjct  949  RPTMREVVQILAEIPKMPLTKQLETESDVTEKA---PPMNDSSPDS  991



>gb|ADB85328.1| putative receptor protein kinase [Phyllostachys edulis]
Length=743

 Score =   244 bits (622),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 119/167 (71%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  552  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  611

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR MTD  KE V+ I D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  612  KPVGEFGDGVDIVQWVRMMTDSNKEQVMMIRDPRLSTVPLHEVMHVFYVALLCVEEQSVQ  671

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSAL-EPPPSTGTSDDA  232
            RP MREVVQ+L++LPK  P    + + + + SA   P P+   S +A
Sbjct  672  RPTMREVVQILSDLPKPAPKQGEDLSLSGDGSASNSPAPAPSGSAEA  718



>gb|AAY32333.1| RLK1 [Phyllostachys praecox]
Length=804

 Score =   244 bits (624),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 119/172 (69%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  615  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  674

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPV EFGDGVDIV WV+ MTD  KE V+KILD RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  675  KPVWEFGDGVDIVHWVKMMTDLNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  734

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST----GTSDDAKD  226
            RP MREVVQ+L+ELP        E  +  + +A +PP +       +++AK+
Sbjct  735  RPTMREVVQILSELPSPTSKQGEEFPSGGDGAASDPPAAAESVEAVTNEAKE  786



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  841  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  900

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVR+MTD  KEGV+KILD RL TVP+ E MH+ YVA+LCVEEQ+V 
Sbjct  901  KPVGEFGDGVDIVQWVRRMTDSSKEGVLKILDHRLPTVPLDEVMHVFYVAMLCVEEQSVG  960

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALE  265
            RP MREVVQ+LT+LP+ P  T+ +    CE+   E
Sbjct  961  RPTMREVVQILTDLPR-PATTQADD---CEAPIRE  991



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 118/163 (72%), Positives = 132/163 (81%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG GVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  888  KPVGEFGAGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  947

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTS  241
            RP MREVVQ+L E+PK P   + E     ES   E  P+   S
Sbjct  948  RPTMREVVQILAEIPKMPLTKQLE----TESDVTEKAPAMNES  986



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  840  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  899

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG+GVDIVQWVR+MT   KEGV++I+D RL TVP+ E MH+ YVA+LCVEEQ+VE
Sbjct  900  KPVGEFGEGVDIVQWVRRMTGCNKEGVLEIVDPRLPTVPLDEVMHVFYVAMLCVEEQSVE  959

Query  369  RPKMREVVQMLTELPK--QPPGTKPEGTTACESSALEPPP  256
            RP MREVVQ+LT+LP   +  G   E  T  +  A E PP
Sbjct  960  RPTMREVVQILTDLPNPARKQGEDREAATKEQQQAAEKPP  999



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   246 bits (627),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 122/157 (78%), Positives = 131/157 (83%), Gaps = 4/157 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  845  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  904

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRKMT+  KE V  ILD RL+TVP+HEAMH+ YVA+LCVEEQAVE
Sbjct  905  KPVGEFGDGVDIVQWVRKMTNSNKEEVQLILDPRLNTVPLHEAMHLFYVAMLCVEEQAVE  964

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP  259
            RP MREVVQ+LTE PK     + E  T    S LE P
Sbjct  965  RPTMREVVQILTEFPKPCNVKQDEPLT----SPLESP  997



>gb|EMT14290.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=895

 Score =   244 bits (624),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 121/173 (70%), Positives = 139/173 (80%), Gaps = 5/173 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GK
Sbjct  703  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGK  762

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIV W++ MT  K+E V+KI+D RLSTVP+HE MH+ YVALLCVEEQ+V+
Sbjct  763  KPVGEFGDGVDIVHWIKMMTGSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQ  822

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTAC----ESSALEPPPST-GTSDDAKD  226
            RP MREVVQ+L+ELPK       E  T      ES  + PP +    +D+AK+
Sbjct  823  RPTMREVVQILSELPKPTTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  875



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   245 bits (626),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 124/178 (70%), Positives = 140/178 (79%), Gaps = 7/178 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  829  HVADFGLAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  888

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG GVDIVQWVR MTD  K+ V+K++D RLS+VP+HE  H+ YVALLCVEEQAVE
Sbjct  889  KPVGEFGAGVDIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVE  948

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLS  196
            RP MREVVQ+L E+PK P   + E     ES   E  P   T +++      PPDLLS
Sbjct  949  RPTMREVVQILAEIPKMPLTKQLE----TESDVTEKAP---TMNESSPDSGSPPDLLS  999



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   244 bits (624),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWV+ MTD  KE V+KILD RLSTVP+HE MH+ YVALLC+EEQ+V+
Sbjct  896  KPVGEFGDGVDIVQWVKMMTDSNKEQVMKILDPRLSTVPLHEVMHVFYVALLCIEEQSVQ  955

Query  369  RPKMREVVQMLTELPK  322
            RP MREVVQ+L+ELPK
Sbjct  956  RPTMREVVQILSELPK  971



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 126/183 (69%), Positives = 138/183 (75%), Gaps = 6/183 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG A+FLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836   HVADFGLARFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWVR++T  KK  V KILD RL TVP+HE MH+  VA+LCVEEQ+VE
Sbjct  896   KPVGEFGDGVDIVQWVREVTGLKKGEVTKILDPRLPTVPLHEVMHVFCVAMLCVEEQSVE  955

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKDqqqppPDL  202
             RP MREVVQ+LTELPK PP  K  G T      +  P    P T            P DL
Sbjct  956   RPTMREVVQILTELPKPPP--KQGGDTPTPRGDVSAPRYIIPETREQQQQPASDSLPSDL  1013

Query  201   LSI  193
             LS+
Sbjct  1014  LSM  1016



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   243 bits (621),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 115/135 (85%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWVRK+T G KE V+KI+DSRLST PI E  H+ YVA+LCVEEQAVE
Sbjct  896  KPVGEFGDGVDIVQWVRKITGGNKEEVMKIVDSRLSTPPIEEVTHVFYVAMLCVEEQAVE  955

Query  369  RPKMREVVQMLTELP  325
            RP MREVVQ+LTELP
Sbjct  956  RPTMREVVQILTELP  970



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   242 bits (617),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 119/163 (73%), Positives = 130/163 (80%), Gaps = 7/163 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  839  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  898

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW + MT+  KE V+KILD RLSTVP+ E MH+ YVALLC EEQ+V+
Sbjct  899  KPVGEFGDGVDIVQWAKMMTNSSKEQVMKILDPRLSTVPLQEVMHVFYVALLCTEEQSVQ  958

Query  369  RPKMREVVQMLTELPKQPPGTK-----PEGTTACESSALEPPP  256
            RP MREVVQ+L+ELPK  P  K     P       SS L P P
Sbjct  959  RPTMREVVQILSELPK--PANKQGEDVPNSGDGSASSPLHPAP  999



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   241 bits (616),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 120/151 (79%), Positives = 130/151 (86%), Gaps = 5/151 (3%)
 Frame = -1

Query  690  SGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIV  511
            SGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIV
Sbjct  777  SGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIV  836

Query  510  QWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVERPKMREVVQMLTE  331
            QWVRKMTD  KEGV+KILD+RL TVP+HE MH+ YVA+LCVEEQAVERP MREVVQ+LTE
Sbjct  837  QWVRKMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTE  896

Query  330  LPKQPPGTKPEGTTACESS----ALEPPPST  250
            LPK PP +K   +   ESS     LE P +T
Sbjct  897  LPK-PPSSKQGDSIVTESSPPSCTLESPTTT  926



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   241 bits (616),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 121/164 (74%), Positives = 134/164 (82%), Gaps = 9/164 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSGTSECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GK
Sbjct  838  HVADFGLAKFLQDSGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGK  897

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGE GDGVDIVQWVR+ TD KKEGV++ILD RL TVP+ EAMH+ YVA+LCVEEQ+VE
Sbjct  898  KPVGELGDGVDIVQWVRETTDSKKEGVLQILDRRLPTVPLDEAMHVFYVAMLCVEEQSVE  957

Query  369  RPKMREVVQMLTELPK----QPP--GTKPEGTTACESSALEPPP  256
            RP MREVVQ+L + PK      P    K +   A E+S   PPP
Sbjct  958  RPTMREVVQILMDRPKGHGCDAPIKEVKEQQQRAAENS---PPP  998



>gb|EMS67650.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=868

 Score =   240 bits (613),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 121/180 (67%), Positives = 136/180 (76%), Gaps = 17/180 (9%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  672  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  731

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWV+ MT   KE V+KILD RLSTVP+HE MH+ YVALLC EE +V+
Sbjct  732  KPVGEFGDGVDIVQWVKMMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQ  791

Query  369  RPKMREVVQMLTELPKQP------------PGTKPEGTTACESSALEPPPSTGTSDDAKD  226
            RP MREVVQ+L+ELPK               G  PE  T   +S+ + P     + DAKD
Sbjct  792  RPTMREVVQILSELPKPAANQGDGEEELPLSGEGPESNTPAPTSSTDAP-----TGDAKD  846



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   239 bits (611),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  833  HVADFGLAKFLQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  892

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQW +  T+  KE V+K+LD RLSTVP+HE  H+ YVALLC EEQ+V+
Sbjct  893  KPVGEFGDGVDIVQWAKMTTNSNKEQVMKVLDPRLSTVPLHEVTHVFYVALLCTEEQSVQ  952

Query  369  RPKMREVVQMLTELPKQPPGTK  304
            RP MREVVQ+L+ELPK PP TK
Sbjct  953  RPTMREVVQILSELPK-PPSTK  973



>gb|EMT20446.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=866

 Score =   238 bits (608),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 117/166 (70%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  672  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  731

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFGDGVDIVQWV+ MT   KE V+KILD RLSTVP+HE MH+ YVALLC EE +V+
Sbjct  732  KPVGEFGDGVDIVQWVKMMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQ  791

Query  369  RPKMREVVQMLTELPKQPP--GTKPEGTTACESSALEPPPSTGTSD  238
            RP MREVVQ+L+ELPK     G + E   + E     PP  T +++
Sbjct  792  RPTMREVVQILSELPKPAANQGDEEELPLSGEGPESNPPAPTSSTE  837



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   239 bits (610),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 119/170 (70%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  836   HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  895

Query  549   KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
             KPVGEFGDGVDIVQWV+ MT   KE V+KILD RLSTVP+HE MH+ YVALLC EE +V+
Sbjct  896   KPVGEFGDGVDIVQWVKMMTGPSKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQ  955

Query  369   RPKMREVVQMLTELPKQPPGTKPEGTTACESSA----LEPPPSTGTSDDA  232
             RP MREVVQ+L+ELPK P  ++ +G      S       PP  T +S +A
Sbjct  956   RPTMREVVQILSELPK-PAASQGDGEEELPLSGDGPESNPPAPTSSSTEA  1004



>gb|ACN35202.1| unknown [Zea mays]
Length=320

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GK
Sbjct  123  HVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGK  182

Query  549  KPVGEFGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            KPVGEFGDGVDIV WVR  T G  KE VVK++D RLS+VP+HE  H+  VALLCVEEQ+V
Sbjct  183  KPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSV  242

Query  372  ERPKMREVVQMLTELPK  322
            +RP MREVVQML ELPK
Sbjct  243  QRPTMREVVQMLGELPK  259



>ref|NP_001169902.1| uncharacterized protein LOC100383797 [Zea mays]
 gb|ACN27138.1| unknown [Zea mays]
Length=459

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GK
Sbjct  262  HVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGK  321

Query  549  KPVGEFGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            KPVGEFGDGVDIV WVR  T G  KE VVK++D RLS+VP+HE  H+  VALLCVEEQ+V
Sbjct  322  KPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSV  381

Query  372  ERPKMREVVQMLTELPK  322
            +RP MREVVQML ELPK
Sbjct  382  QRPTMREVVQMLGELPK  398



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   235 bits (600),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 118/164 (72%), Positives = 132/164 (80%), Gaps = 9/164 (5%)
 Frame = -1

Query  729  HVXDFGXAKFL-QDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKFL QD+G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G
Sbjct  839  HVADFGLAKFLLQDAGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTG  898

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFG+GVDIVQWVRKMTD  KEG +KILD RL T P  EAMH+ YVA LCV+EQ+V
Sbjct  899  RKPVGEFGEGVDIVQWVRKMTDSNKEGALKILDPRLPTAPPDEAMHVFYVATLCVQEQSV  958

Query  372  ERPKMREVVQMLTELPKQ-----PPGTKPEGTTACESSALEPPP  256
            ERP MREVVQ+LT+ PKQ      P  + E   A +S+   PPP
Sbjct  959  ERPTMREVVQILTDPPKQGEDRETPIKEAEQQQAAQST---PPP  999



>ref|XP_009787949.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=1000

 Score =   231 bits (589),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 101/147 (69%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  830  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIVQW +++T+ K+E V  I+D RL+TVP  EAMH+ +VA+LC++E +VE
Sbjct  890  RPVGEFGDGVDIVQWSKRVTNCKREQVTHIVDPRLTTVPEDEAMHLFFVAMLCIQENSVE  949

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTT  289
            RP MREV+QML+E P+Q P  +P  ++
Sbjct  950  RPTMREVIQMLSEFPRQSPEYQPSSSS  976



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   229 bits (584),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQDSG S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GK
Sbjct  840  HVADFGLAKFLQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGK  899

Query  549  KPVGEFGDGVDIVQWVRKMTDG-KKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            KPVGEFGDGVDIV WVR  T G  KE VVK++D RLS+VP+HE  H+  VALLCVEEQ+V
Sbjct  900  KPVGEFGDGVDIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSV  959

Query  372  ERPKMREVVQMLTELPK  322
            +RP MREVVQML ELPK
Sbjct  960  QRPTMREVVQMLGELPK  976



>ref|XP_009403711.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403712.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403713.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
Length=995

 Score =   227 bits (578),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 106/156 (68%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD G SE MSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  824  HVADFGLAKFLQDGGASESMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  883

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIVQW +++TD  ++ V  I D RLSTVPI E MH+ +VA+LCV+E +VE
Sbjct  884  RPVGEFGDGVDIVQWAKRVTDCSRDNVAAIADPRLSTVPIAEVMHVFFVAMLCVQENSVE  943

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTAC---ESSA  271
            RP MREVVQML+E P   P +    ++A    ESS+
Sbjct  944  RPTMREVVQMLSEFPHHVPESHSPSSSATALKESSS  979



>ref|XP_010912647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=992

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  823  HVADFGLAKFLQDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  882

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFG+GVDIVQW +++T+  K  V KI+DSRLSTVPI+E MH+ ++ +LC+ E ++E
Sbjct  883  RPVGEFGEGVDIVQWAKRITNCDKNNVAKIVDSRLSTVPINEVMHVFFITMLCIHENSIE  942

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTA  286
            RP MREVVQML+E P      +   ++A
Sbjct  943  RPTMREVVQMLSEFPHHASEDQSPSSSA  970



>ref|XP_006431638.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
 gb|ESR44878.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
Length=997

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  830  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW ++ T+G+KE  + ILD RLSTVP  EAMH+ +VA+LC++E ++E
Sbjct  890  RPVGDFGDGVDIVQWSKRATNGRKEEFLSILDPRLSTVPKEEAMHLLFVAMLCIQENSIE  949

Query  369  RPKMREVVQMLTELPKQ  319
            RP+MREVVQML+E P+ 
Sbjct  950  RPRMREVVQMLSEFPRH  966



>ref|XP_006649672.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1001

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 122/191 (64%), Positives = 135/191 (71%), Gaps = 21/191 (11%)
 Frame = -1

Query  729   HVXDFGXAKFLQDS-GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
             HV DFG AKFL+ S G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  820   HVADFGLAKFLRGSAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  879

Query  552   KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
             +KPVGEFGDGVDIVQWVR +T   KEGV KI D RLSTVP+HE  H+ YVA+LCV EQ+V
Sbjct  880   RKPVGEFGDGVDIVQWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSV  939

Query  372   ERPKMREVVQMLTELP-----------KQPPGTKPEGTTACESSALEPPPSTGTSDDAKD  226
             ERP MREVVQ+LT+LP              PG K +GTT          P      D   
Sbjct  940   ERPTMREVVQILTDLPGTAATPMDDAASHGPG-KDQGTTT--------SPEKPQQQDGSR  990

Query  225   qqqppPDLLSI  193
             +  P  DLLSI
Sbjct  991   ESPPQQDLLSI  1001



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 115/171 (67%), Positives = 132/171 (77%), Gaps = 17/171 (10%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKFLQDSG+SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+
Sbjct  838   HVADFGLAKFLQDSGSSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGR  897

Query  549   KPVGEFGDGVDIVQWVRKMTD--GKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
             KPVGEFG+GVDIVQWVRKMT+    + GV +I+D RL TVP+ EA+H+ +VA+LCVEEQ+
Sbjct  898   KPVGEFGEGVDIVQWVRKMTECGSNRGGVPQIVDPRLPTVPMDEAVHVFHVAMLCVEEQS  957

Query  375   VERPKMREVVQMLTELPKQPPGTKPEGTTACESSALE-----------PPP  256
             VERP MREVVQ+L + PK      PE    CE+   E           PPP
Sbjct  958   VERPTMREVVQILMDAPK----AAPEQGDDCEAPTKEAKEHQQPAQTSPPP  1004



>ref|XP_009603651.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=1000

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  830  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  889

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIVQW +++T+ K+E V  I+D RL+TVP  EAMH+ +VA+L ++E +VE
Sbjct  890  RPVGEFGDGVDIVQWSKRVTNCKREQVRHIVDPRLTTVPEDEAMHLFFVAMLSIQENSVE  949

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTT  289
            RP MREV+QML+E P+Q P  +P  ++
Sbjct  950  RPTMREVIQMLSEFPRQSPEYQPSSSS  976



>ref|XP_006858565.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
 gb|ERN20032.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
Length=803

 Score =   225 bits (573),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMS IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G 
Sbjct  607  HVADFGLAKFLQDTGGSECMSVIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGH  666

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW ++ T G +  V  ILDSRL+ VP+ E+MH+ ++A+LCV+E ++E
Sbjct  667  RPVGDFGDGVDIVQWAKRTTGGDRRKVTLILDSRLNQVPLEESMHLFFIAMLCVQENSIE  726

Query  369  RPKMREVVQMLTEL--PKQPPGTKP  301
            RP MREVVQML+E   PK P  T P
Sbjct  727  RPTMREVVQMLSEFPNPKPPSQTSP  751



>ref|XP_004230451.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=995

 Score =   226 bits (575),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 97/139 (70%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  823  HVADFGLAKFLVDGGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  882

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIVQW +K+T+ K+E V  I+D RL++VP  EAMH+ ++++LC++E +VE
Sbjct  883  RPVGEFGDGVDIVQWSKKVTNCKREQVTHIVDPRLTSVPQDEAMHLFFISMLCIQENSVE  942

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREV+QML+E P+Q P
Sbjct  943  RPTMREVIQMLSEFPRQSP  961



>ref|XP_010930574.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=994

 Score =   224 bits (572),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 99/134 (74%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD G SECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  824  HVADFGLAKFLQDGGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  883

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFG+GVDIVQW +++T+  ++ V  I+DSRLSTVPI+E MH+ +VA+LCV+E +VE
Sbjct  884  RPVGEFGNGVDIVQWAKRITNCNRDNVATIIDSRLSTVPINEVMHVFFVAMLCVQENSVE  943

Query  369  RPKMREVVQMLTEL  328
            RP MREVVQML+E 
Sbjct  944  RPTMREVVQMLSEF  957



>gb|ACL54651.1| unknown [Zea mays]
Length=441

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  260  HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  319

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFGDGVDIV WVR +T   KEGV+KI D RLSTVP++E  H+ YVA+LCV EQ+V
Sbjct  320  RKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSV  379

Query  372  ERPKMREVVQMLTELP  325
            ERP MREVVQ+L ++P
Sbjct  380  ERPTMREVVQILADMP  395



>gb|KDO44093.1| hypothetical protein CISIN_1g001922mg [Citrus sinensis]
Length=995

 Score =   224 bits (571),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW ++ T+G+KE  + ILD RLS VP  EAMH+ +VA+LC++E ++E
Sbjct  888  RPVGDFGDGVDIVQWSKRATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIE  947

Query  369  RPKMREVVQMLTELPKQ  319
            RP+MREVVQML+E P+ 
Sbjct  948  RPRMREVVQMLSEFPRH  964



>ref|XP_006492589.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=995

 Score =   224 bits (571),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW ++ T+G+KE  + ILD RLS VP  EAMH+ +VA+LC++E ++E
Sbjct  888  RPVGDFGDGVDIVQWSKRATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIE  947

Query  369  RPKMREVVQMLTELPKQ  319
            RP+MREVVQML+E P+ 
Sbjct  948  RPRMREVVQMLSEFPRH  964



>ref|XP_006349327.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=999

 Score =   224 bits (571),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLVDGGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIVQW +K+T+ K+E V  I+D RL+TVP  EAMH+ ++++LC++E +VE
Sbjct  887  RPVGEFGDGVDIVQWSKKVTNCKREQVTHIVDPRLTTVPEDEAMHLFFISMLCIQENSVE  946

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREV+QML+E P+Q
Sbjct  947  RPTMREVIQMLSEFPRQ  963



>ref|NP_001049453.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|ABF94768.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11367.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|EEE58640.1| hypothetical protein OsJ_10012 [Oryza sativa Japonica Group]
Length=1007

 Score =   224 bits (570),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 114/180 (63%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
             HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  829   HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  888

Query  552   KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
             +KPVGEFGDGVDIV WVR +T   KEGV KI D RLSTVP+HE  H+ YVA+LCV EQ+V
Sbjct  889   RKPVGEFGDGVDIVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSV  948

Query  372   ERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             ERP MREVVQ+LT+LP     T  +  +       +        D +++   P  DLLSI
Sbjct  949   ERPTMREVVQILTDLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1007



>gb|AAM27467.1|AC099732_4 Putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=1001

 Score =   224 bits (570),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 114/180 (63%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
             HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  823   HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  882

Query  552   KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
             +KPVGEFGDGVDIV WVR +T   KEGV KI D RLSTVP+HE  H+ YVA+LCV EQ+V
Sbjct  883   RKPVGEFGDGVDIVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSV  942

Query  372   ERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  193
             ERP MREVVQ+LT+LP     T  +  +       +        D +++   P  DLLSI
Sbjct  943   ERPTMREVVQILTDLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1001



>dbj|BAJ99137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   223 bits (568),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 119/183 (65%), Positives = 132/183 (72%), Gaps = 14/183 (8%)
 Frame = -1

Query  729   HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
             HV DFG AKFL  ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G
Sbjct  832   HVADFGLAKFLNGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTG  891

Query  552   KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
             +KPVGEFGDGVDIVQWVR  T   KEGV+KI D RLSTVPI E  H+ YVA+LCV EQ+V
Sbjct  892   RKPVGEFGDGVDIVQWVRMATGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSV  951

Query  372   ERPKMREVVQMLTELP---KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDL  202
             ERP MREVVQ+L ++P       GT+ E T   E    +     GT D          DL
Sbjct  952   ERPTMREVVQILADMPGATSMTVGTRSEATVEVEEEHQD-----GTQDSP-----AQQDL  1001

Query  201   LSI  193
             LSI
Sbjct  1002  LSI  1004



>gb|EEC74807.1| hypothetical protein OsI_10619 [Oryza sativa Indica Group]
Length=1010

 Score =   223 bits (568),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 106/136 (78%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  827  HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  886

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFGDGVDIV WVR +T   KEGV KI D RLSTVP+HE  H+ YVA+LCV EQ+V
Sbjct  887  RKPVGEFGDGVDIVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSV  946

Query  372  ERPKMREVVQMLTELP  325
            ERP MREVVQ+LT+LP
Sbjct  947  ERPTMREVVQILTDLP  962



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score =   223 bits (568),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  843  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  902

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW ++ T+  KEGVVKILD R S +P+ EAM + +VA+LCVEE +V
Sbjct  903  RPVGDFGEEGLDIVQWTKRQTNWNKEGVVKILDQRASNIPVEEAMQVFFVAMLCVEEHSV  962

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  963  ERPTMREVVQMLAQ-AKQP  980



>gb|EMT21762.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=313

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 122/145 (84%), Gaps = 8/145 (6%)
 Frame = -1

Query  729  HVXDFGXAKFLQ--------DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVV  574
            HV DFG AKFL+        ++G SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVV
Sbjct  141  HVADFGLAKFLRSRSRRGAANAGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVV  200

Query  573  LLELVSGKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALL  394
            LLELV+G++PVG+FG+GVDIVQW +++TDG++E V K++D RLSTVP+ E  H+ +V++L
Sbjct  201  LLELVTGRRPVGDFGEGVDIVQWAKRVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSML  260

Query  393  CVEEQAVERPKMREVVQMLTELPKQ  319
            CV+E +VERP MREVVQML+E P+ 
Sbjct  261  CVQENSVERPTMREVVQMLSEFPRH  285



>ref|XP_010520784.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Tarenaya hassleriana]
Length=958

 Score =   222 bits (566),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 107/172 (62%), Positives = 129/172 (75%), Gaps = 18/172 (10%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G+
Sbjct  792  HVADFGLAKFLTDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGR  851

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQWV+ +T  +KE V+ ++D RLS VP  EA H+ +VA+LCVEE +VE
Sbjct  852  RPVGDFGEGVDIVQWVKTVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVE  911

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-----GTSDDAK  229
            RP MREVVQML E P      +PE       +   PPP+      G ++DAK
Sbjct  912  RPSMREVVQMLLEFP------RPE-------TPFSPPPAVHSPCKGVTNDAK  950



>ref|XP_009355307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   223 bits (567),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLMDGGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQAV  373
            +PVGEFG+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMHM ++A+LC++E +V
Sbjct  887  RPVGEFGEGVDIVQWSKKATNCRKEDVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSV  946

Query  372  ERPKMREVVQMLTELPKQPP  313
            ERP MREVVQML+E P+  P
Sbjct  947  ERPTMREVVQMLSEFPRHTP  966



>ref|XP_006859064.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
 gb|ERN20531.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
Length=737

 Score =   221 bits (562),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVL+EL++G+
Sbjct  586  HVADFGLAKFLLDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLVELITGR  645

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIVQW +  T   KEGV +ILDSRL  +PI EA H+ +VA+LCV+EQ+VE
Sbjct  646  RPVGEFGDGVDIVQWAKSTTSACKEGVFEILDSRLKDIPIEEAKHVFFVAMLCVQEQSVE  705

Query  369  RPKMREVVQMLTE  331
            RP MREVV ML +
Sbjct  706  RPTMREVVHMLQQ  718



>ref|XP_010520783.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Tarenaya hassleriana]
Length=994

 Score =   222 bits (566),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 107/172 (62%), Positives = 129/172 (75%), Gaps = 18/172 (10%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G+
Sbjct  828  HVADFGLAKFLTDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQWV+ +T  +KE V+ ++D RLS VP  EA H+ +VA+LCVEE +VE
Sbjct  888  RPVGDFGEGVDIVQWVKTVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVE  947

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPST-----GTSDDAK  229
            RP MREVVQML E P      +PE       +   PPP+      G ++DAK
Sbjct  948  RPSMREVVQMLLEFP------RPE-------TPFSPPPAVHSPCKGVTNDAK  986



>emb|CDO97616.1| unnamed protein product [Coffea canephora]
Length=1001

 Score =   222 bits (566),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 103/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  825  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  884

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLST-VPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG+GVDIVQW R+ T+ ++E V  I+D RLST VP  EAMH+ ++A+LCV+E +V
Sbjct  885  RPVGDFGEGVDIVQWARRATNCRREEVDGIVDPRLSTAVPKDEAMHLFFIAMLCVQENSV  944

Query  372  ERPKMREVVQMLTELPKQPPGTKPEGTT  289
            ERP MREVVQML+E P+Q   T P+  T
Sbjct  945  ERPTMREVVQMLSEFPRQFSSTPPDYRT  972



>ref|XP_010228930.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1008

 Score =   222 bits (566),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 114/159 (72%), Positives = 125/159 (79%), Gaps = 13/159 (8%)
 Frame = -1

Query  729  HVXDFGXAKFLQDS--GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVS  556
            HV DFG AKFL  S  G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++
Sbjct  830  HVADFGLAKFLHGSNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIA  889

Query  555  GKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
            G+KPVGEFGDGVDIVQWVR +    KEGV+KI D RLSTVPI E  H+ YVA+LCV EQ+
Sbjct  890  GRKPVGEFGDGVDIVQWVRMVAGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQS  949

Query  375  VERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPP  259
            VERP MREVVQ+LT+LP         GTT   S +L PP
Sbjct  950  VERPTMREVVQILTDLP---------GTTT--SMSLPPP  977



>ref|XP_003592924.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63175.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1007

 Score =   222 bits (565),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D   +ECMS+IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLVDGAAAECMSSIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVG+FG+GVD+VQW +K T+G++E VV I+DSRL  VP  EAMHM ++A+LC+EE +V+
Sbjct  888  KPVGDFGEGVDLVQWCKKATNGRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEENSVQ  947

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREVVQML+E P+Q
Sbjct  948  RPTMREVVQMLSEFPRQ  964



>ref|XP_008356104.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   221 bits (564),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+ +KEGV+KILD RL TVP+ EAM + +VA+LCV+EQ+V
Sbjct  904  RPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEQSV  963

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  964  ERPTMREVVQMLAQ-AKQP  981



>ref|XP_007224667.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
 gb|EMJ25866.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
Length=998

 Score =   221 bits (564),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  826  HVADFGLAKFLIDGGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  885

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQAV  373
            +PVGEFG+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMH+ ++A+LC++E +V
Sbjct  886  RPVGEFGEGVDIVQWSKKATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIAMLCIQEHSV  945

Query  372  ERPKMREVVQMLTELPKQPP  313
            ERP MREVVQML+E P+  P
Sbjct  946  ERPTMREVVQMLSEFPRHSP  965



>ref|XP_007041221.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX97052.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=988

 Score =   221 bits (563),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 94/139 (68%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVV+LEL++G+
Sbjct  824  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVILELITGR  883

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIV W +++T+ ++E V++I+D RL+TVP  EAMH+ ++A+LCV+E ++E
Sbjct  884  RPVGDFGEGVDIVHWAKRVTNCRREEVMRIVDPRLTTVPKDEAMHLLFIAMLCVQENSIE  943

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P+  P
Sbjct  944  RPTMREVVQMLSEFPRHSP  962



>ref|XP_004985112.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2-like [Setaria italica]
Length=998

 Score =   221 bits (563),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 115/182 (63%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  820  HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITG  879

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFGDGVDIVQWVR +T   KEGV+KI D RLSTVP++E  H+ YVA+LCV EQ+V
Sbjct  880  RKPVGEFGDGVDIVQWVRMVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSV  939

Query  372  ERPKMREVVQMLTELPKQPPGT--KPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLL  199
            ERP MREVVQ+L ++P     +   P      E ++ E PP      +      P  DLL
Sbjct  940  ERPTMREVVQILADMPGSTSTSIDAPLVIEPKEDASSEKPPR---QQEGPHDSPPQQDLL  996

Query  198  SI  193
            SI
Sbjct  997  SI  998



>gb|KDP42443.1| hypothetical protein JCGZ_00240 [Jatropha curcas]
Length=995

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 95/139 (68%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  825  HVADFGLAKFLTDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  884

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW R++T  ++E V++++D RL+ VP  EAMH+ ++A+LC +E ++E
Sbjct  885  RPVGDFGEGVDIVQWSRRVTSNRREDVMQVVDRRLTMVPKDEAMHLFFIAMLCSQENSIE  944

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P+  P
Sbjct  945  RPTMREVVQMLSEFPRHSP  963



>ref|XP_009363288.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   221 bits (562),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+ +KEGV+KILD RL  VP+ EAM + +VA+LCVEEQ+V
Sbjct  904  RPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDAVPMDEAMQVFFVAVLCVEEQSV  963

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  964  ERPTMREVVQMLAQ-AKQP  981



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   221 bits (562),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  839  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  898

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  TD +KEGV+KILD RL +VP+ EAM + +VA+LCV+E +V
Sbjct  899  RPVGGFGEEGMDIVQWTKLQTDSRKEGVIKILDQRLGSVPLDEAMQVFFVAVLCVQEHSV  958

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  959  ERPTMREVVQMLAQ-AKQP  976



>ref|XP_008218726.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=982

 Score =   220 bits (560),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  810  HVADFGLAKFLIDGGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  869

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQAV  373
            +PVGEFG+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMH+ ++A LC++E +V
Sbjct  870  RPVGEFGEGVDIVQWSKKATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIATLCIQEHSV  929

Query  372  ERPKMREVVQMLTELPKQPP  313
            ERP MREVVQML+E P+  P
Sbjct  930  ERPTMREVVQMLSEFPRHSP  949



>emb|CBI29704.3| unnamed protein product [Vitis vinifera]
Length=895

 Score =   219 bits (559),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  746  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  805

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW ++ T+  KE V++I+D RL+T+P +EA H+ ++ALLC+EE +VE
Sbjct  806  RPVGDFGEGVDIVQWAKRTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVE  865

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTT  289
            RP MREVVQML+E  +  P  K   ++
Sbjct  866  RPTMREVVQMLSESHRNSPDNKTSSSS  892



>ref|XP_009368577.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   220 bits (560),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKFLQDTGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+ +KEGV+KILD RL TVP+ EAM + +VA+LCV+E +V
Sbjct  904  RPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSV  963

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  964  ERPTMREVVQMLAQ-AKQP  981



>ref|XP_008349109.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   220 bits (560),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKFLQDTGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+ +KEGV+KILD RL TVP+ EAM + +VA+LCV+E +V
Sbjct  904  RPVGGFGEEGMDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSV  963

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  964  ERPTMREVVQMLAQ-AKQP  981



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   220 bits (560),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQ+SGTSECMSAIAGSYGYIAPEYAYTLKVDE+SDVYSFGVVLLEL++G+
Sbjct  849  HVADFGLAKFLQNSGTSECMSAIAGSYGYIAPEYAYTLKVDERSDVYSFGVVLLELITGR  908

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG DG+DIVQW +  T+  KEGVVKILD RL  VP+ EAM + +VA+LCV+E +V
Sbjct  909  RPVGDFGEDGMDIVQWTKIKTNWSKEGVVKILDERLKNVPVDEAMQVFFVAMLCVQEHSV  968

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  969  ERPTMREVVQMLAQ-AKQP  986



>gb|KJB32855.1| hypothetical protein B456_005G265400 [Gossypium raimondii]
Length=992

 Score =   219 bits (559),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL   G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLVGGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG+G+DIV W + +T+ +K  V  I+D RL+TVP  EAMH+ ++A+LCV+E ++E
Sbjct  888  KPVGEFGEGIDIVHWTKLVTNCRKAEVTSIVDPRLTTVPKDEAMHLLFIAMLCVQENSIE  947

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P+Q P
Sbjct  948  RPTMREVVQMLSEFPRQSP  966



>gb|KHG14208.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=992

 Score =   219 bits (559),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  828  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  887

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG+G+DIV W + +T+ +   V  I+D RL+TVP  EAMH+ ++A+LCV+E ++E
Sbjct  888  KPVGEFGEGIDIVHWTKLVTNCRIAEVTNIVDPRLTTVPKDEAMHLLFIAMLCVQENSIE  947

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P+Q P
Sbjct  948  RPTMREVVQMLSEFPRQSP  966



>ref|XP_002263291.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=976

 Score =   219 bits (559),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW ++ T+  KE V++I+D RL+T+P +EA H+ ++ALLC+EE +VE
Sbjct  887  RPVGDFGEGVDIVQWAKRTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVE  946

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTT  289
            RP MREVVQML+E  +  P  K   ++
Sbjct  947  RPTMREVVQMLSESHRNSPDNKTSSSS  973



>gb|KDO77158.1| hypothetical protein CISIN_1g012213mg [Citrus sinensis]
Length=468

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+LQD+G SECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  325  HVADFGLAKYLQDTGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  384

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KEGVVKILD RLS  P+ EAM + +VA+LCV+E  V
Sbjct  385  RPVGDFGEEGLDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGV  444

Query  372  ERPKMREVVQMLTELPKQPPGT  307
            ERP MREVVQML +   Q P T
Sbjct  445  ERPTMREVVQMLAQ--AQKPNT  464



>ref|NP_001145765.1| uncharacterized protein LOC100279272 [Zea mays]
 gb|ACL52548.1| unknown [Zea mays]
Length=771

 Score =   218 bits (555),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  590  HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  649

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFGDGVDIV WVR +T   KEGV+KI D RLSTVP++E  H+ YVA+LCV EQ+V
Sbjct  650  RKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSV  709

Query  372  ERPKMREVVQMLTELP  325
            ERP MREVVQ+L ++P
Sbjct  710  ERPTMREVVQILADMP  725



>gb|EMT15500.1| hypothetical protein F775_52402 [Aegilops tauschii]
Length=811

 Score =   218 bits (556),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 117/183 (64%), Positives = 134/183 (73%), Gaps = 12/183 (7%)
 Frame = -1

Query  729  HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG A FL  ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G
Sbjct  637  HVADFGLATFLNGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTG  696

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFGDGVDIVQWVR  T   KEGV+KI D RLSTVPI E  H+ YVA+LCV EQ+V
Sbjct  697  RKPVGEFGDGVDIVQWVRTATGSSKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSV  756

Query  372  ERPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD---qqqppPDL  202
            ERP MREVVQ+L ++P     T   GTT  E++        G  ++ +D   +     DL
Sbjct  757  ERPTMREVVQILADMPGATSMTA--GTTRVEATV------EGEDEEHQDGPQESPAQQDL  808

Query  201  LSI  193
            LSI
Sbjct  809  LSI  811



>ref|XP_008795253.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=992

 Score =   219 bits (558),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 97/148 (66%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  823  HVADFGLAKFLHDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  882

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFGDGVDIV W +K+T+  K    +I+DSRL  VPI+E MH+ ++A+LC  E ++E
Sbjct  883  RPVGEFGDGVDIVHWAKKITNCDKNNASRIVDSRLGAVPINEVMHIFFIAMLCTHENSIE  942

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTA  286
            RP MREVVQML+E P      +   ++A
Sbjct  943  RPTMREVVQMLSEFPHHASEDQSPSSSA  970



>tpg|DAA44225.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1002

 Score =   219 bits (557),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQ-DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKFL+ ++G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  821  HVADFGLAKFLRGNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAG  880

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +KPVGEFGDGVDIV WVR +T   KEGV+KI D RLSTVP++E  H+ YVA+LCV EQ+V
Sbjct  881  RKPVGEFGDGVDIVHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSV  940

Query  372  ERPKMREVVQMLTELP  325
            ERP MREVVQ+L ++P
Sbjct  941  ERPTMREVVQILADMP  956



>ref|XP_008786484.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Phoenix dactylifera]
Length=995

 Score =   219 bits (557),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 95/135 (70%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL+D G SECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  824  HVADFGLAKFLRDGGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  883

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFG+GVDIVQW +++T+  ++ V  I+DSRLST+PI+E MH+ ++A+LC+ E +VE
Sbjct  884  RPVGEFGNGVDIVQWAKRITNCSRDNVATIVDSRLSTMPINEVMHVFFIAMLCIXENSVE  943

Query  369  RPKMREVVQMLTELP  325
            RP MREVV ML+E P
Sbjct  944  RPTMREVVLMLSEFP  958



>ref|XP_008347921.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   219 bits (557),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 99/136 (73%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLMDGGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQAV  373
            +PVGEFG+GVDIVQW +K T+ +KE V  I+D RL+ +VP  EAMHM ++A+LC++E +V
Sbjct  887  RPVGEFGEGVDIVQWSKKATNCRKEXVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSV  946

Query  372  ERPKMREVVQMLTELP  325
            ERP MREVVQML+E P
Sbjct  947  ERPTMREVVQMLSEFP  962



>gb|KDP23869.1| hypothetical protein JCGZ_27138 [Jatropha curcas]
Length=989

 Score =   218 bits (556),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  846  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  905

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  KE VVKILD RLS +P+ EAM + +VA+LCV+EQ+V
Sbjct  906  RPVGGFGEEGLDIVQWTKIQTNSSKERVVKILDQRLSEIPLIEAMQVFFVAMLCVQEQSV  965

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML E  KQP
Sbjct  966  ERPTMREVVQMLAE-AKQP  983



>gb|EYU26470.1| hypothetical protein MIMGU_mgv1a019834mg [Erythranthe guttata]
Length=1001

 Score =   218 bits (556),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 97/136 (71%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G+
Sbjct  829  HVADFGLAKFLVDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGR  888

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVGEFG+GVDIVQWVR  T+ ++E V +I+D R++  P  EAMH+ +VA+LCV+E +VE
Sbjct  889  RPVGEFGEGVDIVQWVRCSTNCRREDVTRIIDPRITVAPKDEAMHLFFVAMLCVQENSVE  948

Query  369  RPKMREVVQMLTELPK  322
            RP MREVVQML+E P+
Sbjct  949  RPTMREVVQMLSEFPR  964



>emb|CAN71863.1| hypothetical protein VITISV_023530 [Vitis vinifera]
Length=954

 Score =   218 bits (556),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  805  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  864

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW ++ T+  KE V+ I+D RL+T+P +EA H+ ++ALLC+EE +VE
Sbjct  865  RPVGDFGEGVDIVQWAKRTTNCCKENVIXIVDPRLATIPRNEATHLFFIALLCIEENSVE  924

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTT  289
            RP MREVVQML+E  +  P  K   ++
Sbjct  925  RPTMREVVQMLSESHRNSPDNKTSSSS  951



>ref|XP_011087678.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=992

 Score =   218 bits (556),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            H+ DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G 
Sbjct  825  HIADFGLAKFLVDGGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGH  884

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG FG+GVDIVQW+R  T+  +E V +I+D RL+ VP  EAMH+ +VA+LCV+E  VE
Sbjct  885  RPVGGFGEGVDIVQWIRCSTNCNREEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQENCVE  944

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P++ P
Sbjct  945  RPTMREVVQMLSEFPRRSP  963



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   218 bits (555),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL+D+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  845  HVADFGLAKFLRDTGNSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  904

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T   KEGVVKILD RL+ +P+ EAM + +VA+LCV+EQ+V
Sbjct  905  RPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQRLTDIPLIEAMQVFFVAMLCVQEQSV  964

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  965  ERPTMREVVQMLAQ-AKQP  982



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   218 bits (554),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKFLQDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW    T+  KEGVVKILD RL  VP++EAM + +VA+LCV+E ++
Sbjct  904  RPVGNFGEEGLDIVQWANIQTNWSKEGVVKILDERLKNVPLNEAMQVFFVAMLCVQEHSI  963

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  964  ERPTMREVVQMLAQ-AKQP  981



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   218 bits (554),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  845  HVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  904

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T   KEGVVKILD  L+ +P+ EAM + +VA+LCV+EQ+V
Sbjct  905  RPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSV  964

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML E  KQP
Sbjct  965  ERPTMREVVQMLAE-AKQP  982



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  843  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  902

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  KEGV+KILD RL +VP+ EAM + +VA+LCV+EQ+V
Sbjct  903  RPVGGFGEEGLDIVQWTKIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCVQEQSV  962

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  963  ERPTMREVVQMLAQ-AKQP  980



>ref|XP_011092305.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=1004

 Score =   218 bits (554),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  837  HVADFGLAKFLVDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  896

Query  549  KPV-GEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PV GEFG+GVDIVQW +  TD ++E V +ILD RL+ VP  EAMH+ +VA+LC++E +V
Sbjct  897  RPVGGEFGEGVDIVQWTKCSTDCRREEVSRILDPRLAVVPKDEAMHLFFVAMLCIQENSV  956

Query  372  ERPKMREVVQMLTELPKQPP  313
            ERP MREVVQML+E P++ P
Sbjct  957  ERPTMREVVQMLSEFPRRSP  976



>ref|XP_004485432.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMS+IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++GK
Sbjct  830  HVADFGLAKFLVDGGASECMSSIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGK  889

Query  549  KPVGEFGDGVDIVQWVRKMTD-GKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            KPVG+FG+GVD+VQW +K T+ G++E V  I+DSRL  VP  E MHM ++A+LC+EE +V
Sbjct  890  KPVGDFGEGVDLVQWCKKSTNGGRREDVFNIVDSRLVVVPKEEVMHMFFIAMLCLEENSV  949

Query  372  ERPKMREVVQMLTELPKQ  319
            +RP MREVVQML+E P Q
Sbjct  950  QRPTMREVVQMLSEFPPQ  967



>ref|XP_008339390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D GTS+CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLMDGGTSQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQAV  373
            +PVGEFG+GVDIVQW +K T+ +KE V  I+D RL+ ++P  EAMHM ++A+LC++E +V
Sbjct  887  RPVGEFGEGVDIVQWSKKATNCRKEDVTNIVDHRLTVSLPKDEAMHMFFIAMLCIQENSV  946

Query  372  ERPKMREVVQMLTELPKQ  319
            ERP MREVVQML+E P+ 
Sbjct  947  ERPTMREVVQMLSEFPRH  964



>gb|KJB16198.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=770

 Score =   216 bits (549),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 94/137 (69%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+
Sbjct  616  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGR  675

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG+GVDIVQW ++ T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E ++E
Sbjct  676  KPVGEFGEGVDIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIE  735

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREVVQML+E  + 
Sbjct  736  RPTMREVVQMLSEFARH  752



>ref|XP_002526451.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF35946.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score =   217 bits (552),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  826  HVADFGLAKFLIDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  885

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW +++T+ +KE V+ I+DSRL+ VP  E MH+ ++ALLC +E ++E
Sbjct  886  RPVGDFGDGVDIVQWSKRVTNNRKEDVLNIIDSRLTMVPKDEVMHLFFIALLCSQENSIE  945

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREVVQML+E  + 
Sbjct  946  RPTMREVVQMLSEFHRH  962



>ref|XP_006468612.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like isoform X1 [Citrus sinensis]
Length=987

 Score =   216 bits (551),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+LQD+G SECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKYLQDTGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KEGVVKILD RLS  P+ EAM + +VA+LCV+E  V
Sbjct  904  RPVGDFGEEGLDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGV  963

Query  372  ERPKMREVVQMLTELPKQPPGT  307
            ERP MREVVQML +   Q P T
Sbjct  964  ERPTMREVVQMLAQ--AQKPNT  983



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score =   216 bits (551),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL+D+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  845  HVADFGLAKFLRDTGNSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  904

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T   KEGVVKILD RL  +P+ EAM + +VA+LCV+EQ+V
Sbjct  905  RPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQRLIDIPLIEAMQVFFVAMLCVQEQSV  964

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  965  ERPTMREVVQMLAQ-AKQP  982



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   216 bits (551),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 100/139 (72%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  863  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  922

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KEGV+KILD RL+ VP+ EAM + +V +LCV+E +V
Sbjct  923  RPVGDFGEEGLDIVQWTKMNTNWNKEGVMKILDERLTNVPLDEAMQVFFVGMLCVQEHSV  982

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML +  KQP
Sbjct  983  ERPTMREVVQMLVQ-AKQP  1000



>ref|XP_010687839.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1010

 Score =   216 bits (551),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  839  HVADFGLAKFLADGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  898

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW R  T+ +KE V  ILDSRL+ VP  EAMH+ +VA+LC +E ++E
Sbjct  899  RPVGDFGEGVDIVQWSRVQTNCRKETVPIILDSRLTAVPQDEAMHLFFVAMLCTQENSIE  958

Query  369  RPKMREVVQMLTELPKQPPG  310
            RP MREVVQML+E P    G
Sbjct  959  RPTMREVVQMLSEYPYHAMG  978



>ref|XP_010243895.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X1 [Nelumbo nucifera]
 ref|XP_010243896.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Nelumbo nucifera]
 ref|XP_010243898.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X3 [Nelumbo nucifera]
Length=991

 Score =   216 bits (550),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  823  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  882

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+F +GVDIVQW ++ T+ +KE V++I+D RL+ VPI EAMH+ ++A+LCV+E +VE
Sbjct  883  RPVGDFEEGVDIVQWAKRSTNCRKEEVIRIIDPRLTGVPIDEAMHVFFIAMLCVQENSVE  942

Query  369  RPKMREVVQMLTEL  328
            RP MREVVQML+E 
Sbjct  943  RPTMREVVQMLSEF  956



>gb|KHG23359.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Gossypium arboreum]
Length=995

 Score =   216 bits (551),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  851  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  910

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQA  376
            +PVG+FG +G+DIVQW ++ T  KKEGVVKILD R+S T+P  E M + +VA+LCVEE +
Sbjct  911  RPVGDFGEEGLDIVQWSKRETKLKKEGVVKILDHRVSNTIPKEEVMQVFFVAMLCVEEHS  970

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQML +  KQP
Sbjct  971  VERPTMREVVQMLAQ-AKQP  989



>gb|AAX96206.1| Similar to receptor-like protein kinase 3 [Oryza sativa Japonica 
Group]
 gb|ABA92267.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=1061

 Score =   217 bits (552),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 8/165 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSG----TSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL  562
             HV DFG AKFL+  G    +SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL
Sbjct  886   HVADFGLAKFLRSGGGATASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLEL  945

Query  561   VSGKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEE  382
             ++G++PVG+FG+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+ +V++LCV+E
Sbjct  946   ITGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQE  1005

Query  381   QAVERPKMREVVQMLTELPK----QPPGTKPEGTTACESSALEPP  259
              +VERP MREVVQML+E P+    QP  +     T  ESS  + P
Sbjct  1006  NSVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP  1050



>gb|KJB32927.1| hypothetical protein B456_005G268400 [Gossypium raimondii]
Length=995

 Score =   216 bits (550),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  851  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  910

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQA  376
            +PVG+FG +G+DIVQW ++ T  KKEGVVKILD R+S T+P  E M + +VA+LCVEE +
Sbjct  911  RPVGDFGEEGLDIVQWSKRETKLKKEGVVKILDHRVSNTIPEEEVMQVFFVAMLCVEEHS  970

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQML +  KQP
Sbjct  971  VERPTMREVVQMLAQ-AKQP  989



>ref|XP_006385034.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
 gb|ERP62831.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
Length=1001

 Score =   216 bits (550),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 3/144 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  825  HVADFGLAKFLVDGGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  884

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW ++ T+ +KE  + I+D RL+ VP  EAMH+ ++A+LC +E ++E
Sbjct  885  RPVGDFGDGVDIVQWSKRATNSRKEDAMHIVDPRLTMVPKDEAMHLFFIAMLCSQENSIE  944

Query  369  RPKMREVVQMLTELPKQPPGTKPE  298
            RP MREVVQML+E P+    T P+
Sbjct  945  RPTMREVVQMLSEFPRH---TSPD  965



>gb|EEC67924.1| hypothetical protein OsI_35629 [Oryza sativa Indica Group]
Length=1035

 Score =   216 bits (550),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 8/165 (5%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSG----TSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL  562
             HV DFG AKFL+  G    +SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL
Sbjct  860   HVADFGLAKFLRSGGGATASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLEL  919

Query  561   VSGKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEE  382
             ++G++PVG+FG+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+ +V++LCV+E
Sbjct  920   ITGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIVDRRISTVPMDEVAHIFFVSMLCVQE  979

Query  381   QAVERPKMREVVQMLTELPK----QPPGTKPEGTTACESSALEPP  259
              +VERP MREVVQML+E P+    QP  +     T  ESS  + P
Sbjct  980   NSVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP  1024



>ref|XP_011028346.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1001

 Score =   216 bits (549),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 3/144 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G S+CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  825  HVADFGLAKFLVDGGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  884

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FGDGVDIVQW ++ T+ +KE  + I+D RL+ VP  EAMH+ ++A+LC +E ++E
Sbjct  885  RPVGDFGDGVDIVQWSKRATNSRKEDAMHIVDPRLTMVPKAEAMHLFFIAMLCSQENSIE  944

Query  369  RPKMREVVQMLTELPKQPPGTKPE  298
            RP MREVVQML+E P+    T P+
Sbjct  945  RPTMREVVQMLSEFPRH---TSPD  965



>ref|XP_009401113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=987

 Score =   216 bits (549),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 102/167 (61%), Positives = 121/167 (72%), Gaps = 13/167 (8%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQ  G SE MSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  821  HVADFGLAKFLQHGGASETMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  880

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG FGDGVDIVQW + +T   ++    I+D RLSTVP+ E MH+ +VA+LCV+E +VE
Sbjct  881  RPVGGFGDGVDIVQWAKSVTSCSRDNAAAIVDPRLSTVPVDELMHVFFVAMLCVQENSVE  940

Query  369  RPKMREVVQMLTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAK  229
            RP MREVVQML+E P   P               + P S+ T+ D K
Sbjct  941  RPTMREVVQMLSEFPHHVPEN-------------QSPSSSSTARDKK  974



>ref|XP_009353760.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   216 bits (549),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D GTS+CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLMDGGTSQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  886

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLS-TVPIHEAMHMXYVALLCVEEQAV  373
            +PVGEFG+GVDIVQW +K T+ +KE V  I+D RL+ ++P  E MHM ++A+LC++E +V
Sbjct  887  RPVGEFGEGVDIVQWSKKATNCRKEDVTNIVDHRLTISLPKDEVMHMFFIAMLCIQENSV  946

Query  372  ERPKMREVVQMLTELPKQ  319
            ERP MREVVQML+E P+ 
Sbjct  947  ERPTMREVVQMLSEFPRH  964



>gb|KHG17337.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1006

 Score =   216 bits (549),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/137 (69%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+
Sbjct  852  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGR  911

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG+GVDIVQW ++ T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E ++E
Sbjct  912  KPVGEFGEGVDIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIE  971

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREVVQML+E  + 
Sbjct  972  RPTMREVVQMLSEFARH  988



>gb|KJB16199.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=1007

 Score =   216 bits (549),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/137 (69%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+
Sbjct  853  HVADFGLAKFLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGR  912

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            KPVGEFG+GVDIVQW ++ T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E ++E
Sbjct  913  KPVGEFGEGVDIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIE  972

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREVVQML+E  + 
Sbjct  973  RPTMREVVQMLSEFARH  989



>gb|KCW57119.1| hypothetical protein EUGRSUZ_I02765 [Eucalyptus grandis]
Length=760

 Score =   214 bits (544),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  589  HVADFGLAKYLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  648

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW +KMT  +KE V  I+D +L  VP  EA H+ ++A+LCV++ +VE
Sbjct  649  RPVGDFGEGVDIVQWSKKMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVE  708

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P+  P
Sbjct  709  RPTMREVVQMLSEYPRHSP  727



>ref|XP_006448558.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
 gb|ESR61798.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
Length=987

 Score =   215 bits (547),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 3/142 (2%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+LQD+G SECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKYLQDTGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KEGVVKILD RLS  P+ EAM + +VA LCV+E  V
Sbjct  904  RPVGDFGEEGLDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVATLCVQEHGV  963

Query  372  ERPKMREVVQMLTELPKQPPGT  307
            ERP MREVVQML +   Q P T
Sbjct  964  ERPTMREVVQMLAQ--AQKPNT  983



>dbj|BAJ90459.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1024

 Score =   215 bits (548),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 96/143 (67%), Positives = 122/143 (85%), Gaps = 6/143 (4%)
 Frame = -1

Query  729  HVXDFGXAKFLQ------DSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLL  568
            HV DFG AKFL+      ++G SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLL
Sbjct  849  HVADFGLAKFLRSGAGQANAGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLL  908

Query  567  ELVSGKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCV  388
            ELV+G++PVG+FG+GVDIVQW +++TDG++E V K++D RLSTVP+ E  H+ +V++LCV
Sbjct  909  ELVTGRRPVGDFGEGVDIVQWAKRVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCV  968

Query  387  EEQAVERPKMREVVQMLTELPKQ  319
            +E +VERP MREVVQML+E P+ 
Sbjct  969  QENSVERPTMREVVQMLSEFPRH  991



>ref|XP_008799579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Phoenix dactylifera]
Length=984

 Score =   215 bits (547),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 102/141 (72%), Positives = 119/141 (84%), Gaps = 2/141 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  841  HVADFGLAKYLRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  900

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW R  T+  KEGVVKILD RL   P+ EAM + +V +LCV+EQ+V
Sbjct  901  RPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINFPLEEAMQVFFVGMLCVQEQSV  960

Query  372  ERPKMREVVQMLTELPKQPPG  310
            ERP MREVVQML E  KQP G
Sbjct  961  ERPTMREVVQML-EQTKQPFG  980



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   214 bits (546),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 101/139 (73%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQ +G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  845  HVADFGLAKFLQGTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  904

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T   KEGVVKILD  L+ +P+ EAM + +VA+LCV+EQ+V
Sbjct  905  RPVGDFGEEGLDIVQWTKTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSV  964

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML E  KQP
Sbjct  965  ERPTMREVVQMLAE-AKQP  982



>gb|KCW62729.1| hypothetical protein EUGRSUZ_G00319 [Eucalyptus grandis]
Length=958

 Score =   214 bits (545),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 96/140 (69%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL DSG SECMS IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  795  HVADFGLAKFLVDSGGSECMSVIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  854

Query  549  KPVGEFGDGVDIVQWVR-KMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FGDGVDIVQW +   T+ ++E   +++D RLS VP  EA H+ +VA+LCV+E + 
Sbjct  855  RPVGDFGDGVDIVQWTKIATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENST  914

Query  372  ERPKMREVVQMLTELPKQPP  313
            ERP MREVVQML+E P+ PP
Sbjct  915  ERPTMREVVQMLSEFPRHPP  934



>ref|XP_010065309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=990

 Score =   214 bits (545),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 96/140 (69%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL DSG SECMS IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  827  HVADFGLAKFLVDSGGSECMSVIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  886

Query  549  KPVGEFGDGVDIVQWVR-KMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FGDGVDIVQW +   T+ ++E   +++D RLS VP  EA H+ +VA+LCV+E + 
Sbjct  887  RPVGDFGDGVDIVQWTKIATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENST  946

Query  372  ERPKMREVVQMLTELPKQPP  313
            ERP MREVVQML+E P+ PP
Sbjct  947  ERPTMREVVQMLSEFPRHPP  966



>ref|XP_010030176.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=994

 Score =   214 bits (544),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L D G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  823  HVADFGLAKYLVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGR  882

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            +PVG+FG+GVDIVQW +KMT  +KE V  I+D +L  VP  EA H+ ++A+LCV++ +VE
Sbjct  883  RPVGDFGEGVDIVQWSKKMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVE  942

Query  369  RPKMREVVQMLTELPKQPP  313
            RP MREVVQML+E P+  P
Sbjct  943  RPTMREVVQMLSEYPRHSP  961



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score =   213 bits (543),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  843  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  902

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  KEGV+KILD RL +VP+ EAM + +VA+LC +EQ+V
Sbjct  903  RPVGGFGEEGLDIVQWTKIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCAQEQSV  962

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  963  ERPTMREVVQMLAQ  976



>ref|XP_009392568.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=1040

 Score =   214 bits (544),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 97/136 (71%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQD-SGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG A+FLQD +G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G
Sbjct  856  HVADFGLARFLQDDNGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITG  915

Query  552  KKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            ++PVG+FGDGVDIVQWV++ T  ++E    I+D RLS+VP  E MH+ +V++LCV+E +V
Sbjct  916  RRPVGDFGDGVDIVQWVKRATACRRENAASIVDCRLSSVPTDEVMHVFFVSMLCVQENSV  975

Query  372  ERPKMREVVQMLTELP  325
            ERP MREVVQML+E P
Sbjct  976  ERPTMREVVQMLSEFP  991



>ref|XP_010094628.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Morus notabilis]
 gb|EXB56447.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Morus notabilis]
Length=998

 Score =   213 bits (542),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 104/150 (69%), Positives = 122/150 (81%), Gaps = 13/150 (9%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  844  HVADFGLAKFLQDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  903

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLST-----------VPIHEAMHMXY  406
            KPVG+FG +G+DIVQW +  T+  KEGVVKILD RL +           VPI +AM + +
Sbjct  904  KPVGDFGEEGMDIVQWTKINTESSKEGVVKILDERLMSNNINNNNNNDDVPIEQAMQVFF  963

Query  405  VALLCVEEQAVERPKMREVVQMLTELPKQP  316
            VA+LCV+EQ+VERP MR+VVQML +  KQP
Sbjct  964  VAMLCVQEQSVERPTMRDVVQMLAQ-AKQP  992



>ref|XP_008793129.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Phoenix dactylifera]
Length=988

 Score =   213 bits (542),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  845  HVADFGLAKYLRDTGVSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  904

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            KPVG+FG +G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM + +V +LCV+EQ+V
Sbjct  905  KPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSV  964

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  965  ERPTMREVVQMLEQ  978



>gb|EEE51888.1| hypothetical protein OsJ_33462 [Oryza sativa Japonica Group]
Length=881

 Score =   212 bits (540),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 8/165 (5%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSG----TSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL  562
            HV DFG AKFL+  G    +SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL
Sbjct  706  HVADFGLAKFLRSGGGATASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLEL  765

Query  561  VSGKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEE  382
            ++G++PVG+FG+GVDIVQW +++TDG++E V +I+D R+STVP+ E  H+ +V++LCV+E
Sbjct  766  ITGRRPVGDFGEGVDIVQWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQE  825

Query  381  QAVERPKMREVVQMLTELPK----QPPGTKPEGTTACESSALEPP  259
             +VERP MREVVQML+E P+    QP  +     T  ESS  + P
Sbjct  826  NSVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP  870



>ref|XP_009600411.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=964

 Score =   213 bits (541),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+LQ++GTSECMSAIAGSYGYIAPEYAYTLK+DEKSDVYS+GVVLLEL++G+
Sbjct  821  HVADFGLAKYLQNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSYGVVLLELITGR  880

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +GVDIVQW ++ T+  KEGVVKILD RL  V   EAM + +VA+LCVEE +V
Sbjct  881  RPVGNFGEEGVDIVQWAKRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSV  940

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML++  KQP
Sbjct  941  ERPTMREVVQMLSQ-AKQP  958



>ref|XP_008793131.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Phoenix dactylifera]
Length=813

 Score =   212 bits (539),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  670  HVADFGLAKYLRDTGVSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  729

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            KPVG+FG +G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM + +V +LCV+EQ+V
Sbjct  730  KPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSV  789

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  790  ERPTMREVVQMLEQ  803



>ref|XP_010918071.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=984

 Score =   213 bits (541),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  841  HVADFGLAKYLRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  900

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM + +V +LC++EQ+V
Sbjct  901  RPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCIQEQSV  960

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  961  ERPTMREVVQMLEQ  974



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score =   212 bits (540),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  845  HVADFGLAKFLQDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  904

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  KEGVVKILD RL  VP  EA+   +VA+LCV+E +V
Sbjct  905  RPVGGFGEEGLDIVQWSKIQTNWSKEGVVKILDERLRNVPEDEAIQTFFVAMLCVQEHSV  964

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREV+QML +  KQP
Sbjct  965  ERPTMREVIQMLAQ-AKQP  982



>ref|XP_009763204.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=958

 Score =   211 bits (538),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+LQ++GTSECMSAIAGSYGYIAPEYAYTLK+DEKSDVYS+GVVLLEL++G+
Sbjct  815  HVADFGLAKYLQNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSYGVVLLELITGR  874

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW ++ T+  KEGVVKILD RL  V   EAM + +VA+LCVEE +V
Sbjct  875  RPVGNFGEEGLDIVQWAKRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSV  934

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML++  KQP
Sbjct  935  ERPTMREVVQMLSQ-AKQP  952



>ref|XP_010087435.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
 gb|EXB29045.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
Length=1014

 Score =   212 bits (539),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 99/145 (68%), Positives = 118/145 (81%), Gaps = 8/145 (6%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL D G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  836  HVADFGLAKFLFDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  895

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLST--------VPIHEAMHMXYVALL  394
            +PVGEFG+GVDIVQW +K T+ ++E V++I+D RL T        VP  EAMH+ ++A L
Sbjct  896  RPVGEFGEGVDIVQWCKKATNCRREDVLQIVDRRLMTTSTTANYNVPKEEAMHLFFIATL  955

Query  393  CVEEQAVERPKMREVVQMLTELPKQ  319
            CV+E +VERP MREVVQML+EL + 
Sbjct  956  CVQENSVERPTMREVVQMLSELTRH  980



>ref|XP_004491265.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=976

 Score =   210 bits (535),  Expect = 8e-59, Method: Composition-based stats.
 Identities = 100/141 (71%), Positives = 119/141 (84%), Gaps = 4/141 (3%)
 Frame = -1

Query  729  HVXDFGXAKFLQDS--GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVS  556
            HV DFG AKFLQD+  GTSECMS+I GSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++
Sbjct  832  HVADFGLAKFLQDAANGTSECMSSIVGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLT  891

Query  555  GKKPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQ  379
            G++PVG+FG +G+DIVQW +  TD  KE VVKILD RL  +P+ EAM + +VA+LCV+EQ
Sbjct  892  GRRPVGDFGEEGIDIVQWTKLQTDWNKEKVVKILDGRLHHIPLDEAMQLFFVAMLCVQEQ  951

Query  378  AVERPKMREVVQMLTELPKQP  316
            +VERP MREVV+ML +  KQP
Sbjct  952  SVERPTMREVVEMLAQ-AKQP  971



>ref|XP_003545159.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Glycine max]
Length=986

 Score =   210 bits (534),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  843  HVADFGLAKFLQDTGTSECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  902

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  K+ VVKILD RL  +P+ EA  + +VA+LCV+EQ+V
Sbjct  903  RPVGNFGEEGLDIVQWTKLQTNWSKDKVVKILDERLCHIPVDEAKQIYFVAMLCVQEQSV  962

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVV+ML +  KQP
Sbjct  963  ERPTMREVVEMLAQ-AKQP  980



>ref|XP_002532709.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF29676.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=991

 Score =   210 bits (534),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 96/134 (72%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  848  HVADFGLAKFLQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  907

Query  549  KPVGEF-GDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG F  +G+DIVQW +  T+  KE V+KILD RLS +P++EA  + +VA+LCV+E +V
Sbjct  908  RPVGAFEEEGLDIVQWTKIQTNSSKEKVIKILDQRLSDIPLNEATQVFFVAMLCVQEHSV  967

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  968  ERPTMREVVQMLAQ  981



>ref|XP_010924539.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=986

 Score =   209 bits (532),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+
Sbjct  843  HVADFGLAKYLRDTGVSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGR  902

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW R  T+  KEGVVKILD RL  VP+ EAM + +V +LCV+E +V
Sbjct  903  RPVGDFGEEGLDIVQWARMNTNWSKEGVVKILDPRLIDVPLEEAMQVFFVGMLCVQEHSV  962

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  963  ERPTMREVVQMLEQ  976



>gb|KHN12015.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Glycine soja]
Length=695

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  552  HVADFGLAKFLQDTGTSECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  611

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  K+ VVKILD RL  +P+ EA  + +VA+LCV+EQ+V
Sbjct  612  RPVGNFGEEGLDIVQWTKLQTNWSKDKVVKILDERLCHIPVDEAKQIYFVAMLCVQEQSV  671

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVV+ML +  KQP
Sbjct  672  ERPTMREVVEMLAQ-AKQP  689



>ref|XP_004229499.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=960

 Score =   208 bits (530),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+ +++GTSECMSAIAGSYGYIAPEYAYTLK+DEKSDVYSFGVVLLEL++G+
Sbjct  817  HVADFGLAKYFRNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSFGVVLLELITGR  876

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T   KEGVVKILD RL  V I EAM + +VA+LCVEE ++
Sbjct  877  RPVGNFGEEGMDIVQWAKTETKWSKEGVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSI  936

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML++  KQP
Sbjct  937  ERPTMREVVQMLSQ-AKQP  954



>ref|XP_007146301.1| hypothetical protein PHAVU_006G029000g [Phaseolus vulgaris]
 gb|ESW18295.1| hypothetical protein PHAVU_006G029000g [Phaseolus vulgaris]
Length=1017

 Score =   209 bits (531),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -1

Query  729   HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
             HV DFG AKF+QD+G SECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  874   HVADFGLAKFMQDNGASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  933

Query  549   KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
             +PVG FG DG+DIVQW++  T+G KE V+KILD RL  +P+ EA  + +VA LCV E +V
Sbjct  934   RPVGNFGEDGLDIVQWIKMQTNGNKEMVMKILDERLHQIPLAEAKQVFFVAKLCVHEHSV  993

Query  372   ERPKMREVVQMLTELPKQP  316
             ERP MREVV+ML +  KQP
Sbjct  994   ERPTMREVVEMLAQ-AKQP  1011



>gb|KHN28525.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Glycine soja]
Length=853

 Score =   207 bits (527),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKF+QD+G SECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  713  HVADFGLAKFMQDNGGSECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  772

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KE V+KILD RL  +P+ EAM + +VA+LCV E +V
Sbjct  773  RPVGDFGEEGLDIVQWTKMQTNWNKEMVMKILDERLDDIPLAEAMQVFFVAMLCVHEHSV  832

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVV+ML +  KQP
Sbjct  833  ERPTMREVVEMLAQ-AKQP  850



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   208 bits (529),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 96/134 (72%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYS+GVVLLEL++GK
Sbjct  835  HVADFGLAKYLRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSYGVVLLELITGK  894

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+ G +G+DIVQW R  T+  KEGVV I+D RL  VP+ EAM + +VA+LCV+E +V
Sbjct  895  RPVGDLGEEGLDIVQWARMNTNWHKEGVVNIMDRRLIDVPMEEAMQVFFVAMLCVQEHSV  954

Query  372  ERPKMREVVQMLTE  331
            ERPKMREVVQML +
Sbjct  955  ERPKMREVVQMLEQ  968



>ref|XP_009415217.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=995

 Score =   207 bits (528),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+L+D+G SECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  852  HVADFGLAKYLRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  911

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+D+VQW R  T+  KEGVV+ILD  LS VP+ EA  + +VA+LCV+E +V
Sbjct  912  RPVGDFGEEGLDLVQWTRMSTNWSKEGVVRILDPWLSNVPLEEATQVFFVAMLCVQEHSV  971

Query  372  ERPKMREVVQMLTE  331
            ERP MREVVQML +
Sbjct  972  ERPTMREVVQMLEQ  985



>ref|XP_003530709.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Glycine max]
Length=994

 Score =   207 bits (527),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKF+QD+G SECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  851  HVADFGLAKFMQDNGASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  910

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KE V+KILD RL  +P+ EAM + +VA+LCV E +V
Sbjct  911  RPVGDFGEEGLDIVQWTKLQTNWNKEMVMKILDERLDHIPLAEAMQVFFVAMLCVHEHSV  970

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVV+ML +  KQP
Sbjct  971  ERPTMREVVEMLAQ-AKQP  988



>ref|XP_006602289.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Glycine max]
Length=987

 Score =   207 bits (527),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKF+QD+G SECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  847  HVADFGLAKFMQDNGGSECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  906

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KE V+KILD RL  +P+ EAM + +VA+LCV E +V
Sbjct  907  RPVGDFGEEGLDIVQWTKMQTNWNKEMVMKILDERLDHIPLAEAMQVFFVAMLCVHEHSV  966

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVV+ML +  KQP
Sbjct  967  ERPTMREVVEMLAQ-AKQP  984



>gb|EPS62062.1| protein kinase, partial [Genlisea aurea]
Length=979

 Score =   207 bits (526),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFL +  TS+CMSA+AGSYGYIAPEYAYTLKVDEKSDVYS+GVVLLEL++G 
Sbjct  823  HVADFGLAKFLIEGTTSQCMSAVAGSYGYIAPEYAYTLKVDEKSDVYSYGVVLLELITGH  882

Query  549  KPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAVE  370
            + VGEFG+GVDIVQW R+ T+ +   V +ILD RLS VP  EAMH+ ++++LCV++ +V+
Sbjct  883  RAVGEFGEGVDIVQWTRRSTNCRTAEVTRILDPRLSVVPKDEAMHLLFISMLCVDDNSVQ  942

Query  369  RPKMREVVQMLTELPKQ  319
            RP MREVVQML+E P++
Sbjct  943  RPTMREVVQMLSEFPRK  959



>gb|KHM99687.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Glycine soja]
Length=685

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKF+QD+G SECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  542  HVADFGLAKFMQDNGASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGR  601

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG+FG +G+DIVQW +  T+  KE V+KILD RL  +P+ EAM + +VA+LCV E +V
Sbjct  602  RPVGDFGEEGLDIVQWTKLQTNWNKEMVMKILDERLDHIPLAEAMQVFFVAMLCVHEHSV  661

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVV+ML +  KQP
Sbjct  662  ERPTMREVVEMLAQ-AKQP  679



>emb|CDX93999.1| BnaC07g36330D [Brassica napus]
Length=844

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKF-LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKF LQD+G SECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G
Sbjct  703  HVADFGLAKFMLQDNGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITG  762

Query  552  KKPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
            +KPV +FG +G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM + +VA+LCV+E +
Sbjct  763  RKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHS  822

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQM+++  KQP
Sbjct  823  VERPTMREVVQMISQ-AKQP  841



>emb|CDX98665.1| BnaA03g44500D [Brassica napus]
Length=844

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKF-LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKF LQD+G SECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G
Sbjct  703  HVADFGLAKFMLQDNGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITG  762

Query  552  KKPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
            +KPV +FG +G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM + +VA+LCV+E +
Sbjct  763  RKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHS  822

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQM+++  KQP
Sbjct  823  VERPTMREVVQMISQ-AKQP  841



>emb|CDY54567.1| BnaA08g30460D [Brassica napus]
Length=844

 Score =   205 bits (522),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKFL-QDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKF+ QD G SECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G
Sbjct  703  HVADFGLAKFMMQDDGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITG  762

Query  552  KKPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
            +KPV +FG +G+DIVQW +  T+  K+GVVKI+D RLS VP+ EAM + +VA+LCV+E +
Sbjct  763  RKPVDKFGEEGIDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHS  822

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQM+++  KQP
Sbjct  823  VERPTMREVVQMISQ-AKQP  841



>ref|XP_003576141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1043

 Score =   207 bits (526),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 9/145 (6%)
 Frame = -1

Query  726   VXDFGXAKFLQDSG---------TSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVV  574
             V DFG AKFL+             SECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVV
Sbjct  866   VADFGLAKFLRSGSGNNNNSSSNASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVV  925

Query  573   LLELVSGKKPVGEFGDGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALL  394
             LLELV+G++PVG+FG+GVDIVQW +++TDG++EGV K++D RLSTV + E  H+ +V++L
Sbjct  926   LLELVTGRRPVGDFGEGVDIVQWAKRVTDGRREGVPKVVDRRLSTVAMDEVAHLFFVSML  985

Query  393   CVEEQAVERPKMREVVQMLTELPKQ  319
             CV+E +VERP MREVVQML+E P+ 
Sbjct  986   CVQENSVERPTMREVVQMLSEFPRH  1010



>ref|XP_006356981.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=960

 Score =   206 bits (523),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AK+  ++GTSECMSAIAGSYGYIAPEYAYTLK+DEKSDVYSFGVVLLEL++G+
Sbjct  817  HVADFGLAKYFHNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSFGVVLLELITGR  876

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+  KE VVKILD RL  V I EAM + +VA+LCVEE ++
Sbjct  877  RPVGNFGEEGMDIVQWAKTETNWSKEEVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSI  936

Query  372  ERPKMREVVQMLTELPKQP  316
            ERP MREVVQML++  KQP
Sbjct  937  ERPTMREVVQMLSQ-AKQP  954



>ref|XP_003518489.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Glycine max]
Length=999

 Score =   206 bits (524),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -1

Query  729  HVXDFGXAKFLQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGK  550
            HV DFG AKFLQD+GTSECMS+IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+
Sbjct  856  HVADFGLAKFLQDTGTSECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGR  915

Query  549  KPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQAV  373
            +PVG FG +G+DIVQW +  T+   + VVKILD RL  +P+ EA  + +VA+LCV+EQ+V
Sbjct  916  RPVGNFGEEGLDIVQWTKLQTNWSNDKVVKILDERLCHIPLDEAKQVYFVAMLCVQEQSV  975

Query  372  ERPKMREVVQMLTELPK  322
            ERP MREVV+ML +  K
Sbjct  976  ERPTMREVVEMLAQAKK  992



>ref|XP_009137141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=967

 Score =   206 bits (523),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKF-LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKF LQD+G SECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G
Sbjct  826  HVADFGLAKFMLQDNGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITG  885

Query  552  KKPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
            +KPV +FG +G+DIVQW +  T+  ++GVVKI+D RLS VP+ EAM + +VA+LCV+E +
Sbjct  886  RKPVDKFGEEGIDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHS  945

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQM+++  KQP
Sbjct  946  VERPTMREVVQMISQ-AKQP  964



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score =   205 bits (522),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -1

Query  729  HVXDFGXAKFL-QDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG  553
            HV DFG AKF+ QD G SECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G
Sbjct  854  HVADFGLAKFMMQDDGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITG  913

Query  552  KKPVGEFG-DGVDIVQWVRKMTDGKKEGVVKILDSRLSTVPIHEAMHMXYVALLCVEEQA  376
            +KPV +FG +G+DIVQW +  T+  K+GVVKI+D RLS VP+ EAM + +VA+LCV+E +
Sbjct  914  RKPVDKFGEEGIDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHS  973

Query  375  VERPKMREVVQMLTELPKQP  316
            VERP MREVVQM+++  KQP
Sbjct  974  VERPTMREVVQMISQ-AKQP  992



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470